`86ޥp NqNuBootsector protected by Antidotepuke'(*** [&R @`  @`! #@%`')+-/1 3@5`79;=?A C@E`GIKMOQ S@oWY[]_a c@e`gimqs@u}O` @ @ ` @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` @`!Oa   !Aa!!#A%a')+-//3A5a79;=?A!CEIMQ!SAUWY[_a!cAegikmoq!sAuawy}!Aa&!Aa!Aa!Aa!Aaǁɡ!Aa١Aa!Aa " B b  !"!B!b!!!!!!""#B"%'")"+"-"1"#3B#5b#7#9#;#=#?$A"$CB$Eb$G$I$K$M$O%Q"%SB%Ub%W%Y%[%]%_&a"&cB&eb&&i&k&m&o'q"'sB'ub'w'y'{'}'("(B(b((((()")B)b)))**+"+B+b++++@`  @`! #@%`')+-/1 3@5`79;=?A C@E`GIKMOQ S@oWY[]_a c@e`gimqs@u}O` @ @ ` @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` @`!Oa   !Aa!!#A%a')+-//3A5a79;=?A!CEIMQ!SAUWY[_a!cAegikmoq!sAuawy}!Aa&!Aa!Aa!Aa!Aaǁɡ!Aa١Aa!Aa " B b  !"!B!b!!!!!!""#B"%'")"+"-"1"#3B#5b#7#9#;#=#?$A"$CB$Eb$G$I$K$M$O%Q"%SB%Ub%W%Y%[%]%_&a"&cB&eb&&i&k&m&o'q"'sB'ub'w'y'{'}'("(B(b((((()")B)b)))**+"+B+b++++ACCFOLDR `jDCMAXTRK #`nLEONARD (`vSILKM26A .`AUTO P`RDD3 F`CATALOG 2_1y!ADVERT PRG `DESK_ALTPRG :`DDPIC PI1 !"}ABFORMAT `DISKSPC `AUTO60 0!FCONVERT 5!JEXPANDER2039!OMEGA_DPK C!\PINHEAD I!zSTDCAT P!/POWER_PD !DESKTOP INF ``D|(x$H f$oID|x`ID|.|)|@)J0Hz$?<&NN\O gv"j)I(A W*j,Jf J-gRMJg"RlV Af^&MRM Rf Gf Vf =fp#@JgN&I P@Jf"Ͱf ,Ma"*N#MJfB` _fj Pfd Bf^ PfX =fRYIJfLrpg: 0e< 9dҀ` Ae( zd" Fc ae Ҁ`²$W`"JfgBN&IAp }bB0,HaxN "@$ p l\ep@9@R)IL"`BQ)IH`BQ , o2V@ l$)IAxB"Y"XI#I2B"2)I@$" VA"Ad?<`JfF" l\eT)A , 0BAHAR@&, HCBCHCFC׬ .I/ JSB?/ / ?<?<JNAO DpA"P < "0<NB @gA@0kNJhf9DPN0 _N>`> ,,g/?<?<NMPO?<LNAJ =fJRNrtB0m B nҁ&ҁҁ҃҂`.g g+g fv RNJg)A$ NNup0,Vr2,e ЀЀNu)xD x h9h\2(I9A^BNuN,N9hNNNVH;4~| | | | B.p?NNTO9@hpAjCQ .AnN9@jpAPCQ .ArN9@l|` HA@!RFp@m|͗` FAH!AHBAH!RF Fmp)@<)@<)@=)@=rP9A=9|=tNB=9|=9|=B=vC=9@d9@fx)D=)D=9@=C?yCvCCCC9|<>\9A>^9@>`B>bB>c|P>d lPHCfA"HJfS ACFf0,hJ@krAnJljf|F=9|=BldACN*@ gP~0<A"MN-f0AN_ACNJgБCN&@ gACfJffp KNl9@=ACfJffp KNJ9@=ACf JffS=ACfJffp KN9@=ACxfJffp KN9@=ACdfJffp KN9@>\ACNfJffp KN9@>^AC8fJffp KN9@>`AC"fJffp KNf9@dAC fJffp KND9@fACf JffS>bACf JffS>cACf JffS>dACfJff KCfpACNJ@f KJfS RNkp/@ JgAN"HA@!  K"o f` MNh,=rFfp?NNTOU@fJGf 9|/=9|d,=rFfp?NNTOU@g 9|=BldNd(HzNZXO)|>h)|0>l)|.>p)| >t)|>x)|!>|)|">)|#>)|>)|$>)|%>)|&>)|2>)|1>)|>)|>)|>)|>)|>)|>)|>)|/>)|>)|->)|>)|,>)|)|")|&)|*)|.)|2)|6)| :)| >)| B~` A>1A>BRGp@mpL,N^NuRDD3PATHA:\RDD3\RDD.PRG MiNTGnvaINFrLINE_LENGTHTAB_SETTINGTEXT_MODESCREEN_LINESTOP_OF_SCREENPAGE_LENGTHPAGE_WIDTHLEFT_MARGINSMALL_FONTIBM_FONTPAGE_NUMBERSPAUSEPORTEDITORUTILITYEwfN+NN;N0NxpaNV*H?4*H~|p*(-@2`5@r*gr?fz`RD MJfS Hep@f/ p/?NATO$_&@/ Hn.p?NA\O$_/ Bg/ pN?NAPO$_Jg/ / p?NA\O$_p`  MC[fA["HJfS. `A[*Hp\fB-`SGJGnA[CfACLNz Aa.JGjp`,`.A[CfACLNyAa.JGj `p,/ pO?NATO$_Jg/ / p?NA\O$_ `Jxz` FAHJf(`RE Emp@fp`/ p/?NATO$_&@/ Hn.p?NA\O$_/ 0<?/ pN?NAPO$_Jg/ / p?NA\O$_p`.Co0/ / p?NA\O$_ MCfACNyAa `/ / p?NA\O$_B.[Hn[ MCNblXO&@ fp`j.[f MC[f KNbN/ p/?NATO$_&@/ Hn.p?NA\O$_/ BgHn[pN?NAPO$_Jg/ / p?NA\O$_p` &.H/ / p?NA\O$_Jfp` MJfS r c& MJfS "M AfJff~ACfp"QJGfT MC7fA7"HJfS r7c&|<7"HJfS AptFC8HNdvAfC7Nw` AfCNwAfCNwAf"HJfS /Hz/NwAfCNwzAf"HJfS /H0N_b?@4O / HxrH?NA\O$_r@N`/?/,Hz`//.Nw4prAfN5OA["HJfS rc/ p?p ?NMXO$_fA["HJfS AWC@fJfgLA["HJfS AWC fJfg&A["HJfS AWCfVJffPA["HJfS rЁrN$@ fp`Hn[Hz/ NvNO A["HJfS &r ց|A["HJfS AWCfJfgA["HJfS AWC|fJfgtA["HJfS AWC\fJfgNA["HJfS AWC<fJfg(A["HJfS AWCfJff|AfC NHz /NuZAf"HJfS /H,N]R*CH3>P,CH#.CH#6C=/H(AH!:AH!>AH!(BAHB2)J<)C=9D=)A=A[C=f L,N^Nu\*.*rb\SCRAP.TXT | RDD3 - Loading, | Filename: Clipboard | Size: %ld bytes. | Docs Loaded: %d Free Memory: %ldK.PI1.PI2.PI3PICFILE: %s .ARC.ZIP.LZH.ZOO.ARJSizeScanning archive file. | ICE!Ice! | RDD3 - Depacking, | Filename: N$N,N'NN0NNY*rdЁ-@,-IB N\,$@ fp`, N\&@ fp`-J-K M*H$ACp"Q nBCSfAS"HJfS r7c&|/Hz/NnA"HJfS /H0NV?@4O / HxrH?NA\O$_r@NX/?/,Hz//.NnvprAN-O (o r}NW,`| -Fzpr-AF-@J-@N`x ."Sfd "NW/@$ "/$NW,rd܁ .⼀n `"-A .,  JNrJg,$@-@  KN^Jg&@-@t TA,.J@JAg RGRrdځ`r gr fr ".NWJf( ".>NW/HzHnNmnprAN*,O .N7R~RrdځTNX-FJXF.t f t fRMRځ%h`dr f& ?@$H2,=R@.0/$GfARpdڀ`| RGRpdڀl=m$ .N7R~".F%TN XXF-@J,.>mprA4N)r Ѐ7 % T,  JN*@ g-M  KN*@ g M-H)n<)n=p)@=)@=Bl= L,N^Nu | RDD3 - Formatting, | Filename: | Percentage done: 0% (%ld bytes) | Docs Loaded: %d Free Memory: %ldK%ld%%100%Ndpa/~` NJRG Gm~` HA@Jg A@ pNm RGp@mNPHz NFXO.NuEvH. Gld FAH*HJg UNlp*Jg mNl m Nl mNlp+@|` A>*H0Gf:RFp@mL NuHB?< NA\#NP3LT/?< NA\ 9P#Z#V 9P#b#^ 9Tg`(LNuA)XC7X <"<$< |`$A:XCAX <"<$<|`NqEfGf(K$&QQAfCfEfGfIfKf.< < FFQAfCfpt"<02FPBQAf"9Pp QA"9Pp2 Q 9TfAXC$T <"<$<|EfGf(K$&QQAfCfEfGfIfKf.< <FFQ`THCfEfGf 9Tg\(r$L~M N6"pg6@ H:s]]@]]] ]]`R(J6``NqLNu(rpgN@ H:s]P]]]@]]]0]]] ]p]]]`]R``HCf`$HCf`HCf`HCf`HCf`HCfEGf(rpg.@ H:s]P]]]@]]]0R`LNuHCf`HCf`HCf`HCf`HCf`vH瀀 yP <?BQLNuH yV"yZaaaaaaaaa a L NuH LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8LHC8L NuH y^"ybpL8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(L8H8C(QL NuH "yPC} IAaaaaaaaaa a L NuH LH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?ALH?AL NuH "yPC} IAXpL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAL8HAQL Nu  !$%(),-014589<=@ADEHILMPQTUXY\]`adehilmpqtuxy|}ffffffffffff>~``|>~|ffl 06ff8|ll88ppv  `0880`ff<<<<80 8pp8~~~~p88p<~ff 8|~<<~fff~~ffff|~ff~|ffff~|<~ff````ff~<x|nffffffn|x~~``||````~~~~``||``````>~``nnffff~<ffff~~ffffff~~~~ff~<``````````~~fffvv~~nnfff<~ffffffff~<|~ffff~|````<~fffffffj|6>~``p8~|~~ffffffffff~<ffffffff<<Ƃfff<<<>~ff~>```|~fffff~|<|`````~>>~fffff~><~ff~``~>~~>~ffff~>~|```|~fffffff88<< |x88<<l<~fffffff<~fffff~<|~fffff~|``>~fffff~>|~f``````>~`p<~|~~fffffff~>fffff<<Ƃff<<<~|~~ 00~~880000880000b<$fB<~ff````ff~< 8fffffffff~> <~ff~``~>>~ff~>ff<>>~ff~>`0<>>~ff~>6<>>~ff~><|`````~> 8ff<~ff~``~>`0<~ff~``~>ff88<<~`0fffffff~>ffffffff~>~|ff<~ffffff~<ffffffffff~<<~f``f~<80000000ffff~<~>~ff~> 88<< <~fffff~< fffffff~>2zL<~fffffff2zLffv~~nfff<>>~ff~>~<~fffff~<~00ff~<~~```~~` #&,0n ` #&,2f2?6ll6l6lذ2zL<>>~ff~>2zL<~fffff~<=~ffnnvvff~=~fn~vf~~~~`0<~ff~~ffff2zL<~ff~~ffff2zL<~ffffff~<ff |zz |Ƃ||Ƃ|[_UQfffffffff<8fffffffff|xfvv><><``~~000ln>6fffnnn |||66666666~~~~ffvv~~~nnf6>~~>>>66666000|~~~ffffff88~~~>666666>>~~ffvvnnfv>62 0~~>|~~~~~~~~~~`p88p`~~8p8~~ؘp~~>|@>|@8lDl88|||8<<Pp 0xHHHH0H0`xx0H0""""UUUUUUUU666666666666666lllllll66666666666666666666666666666666666666666666666666666666667666666666666670??07666666666666666666666666667076666666666666666666666666666666666666666666?000000?0??0?0000000lllllll666666666666666fffllll>`<|fl0fF8l8pvp88pf< 80 0 ~~`0 0```nff>fff~fff<<f<flxpxlf``````~fv~~nfffffff<ff<f>``|fff|<```<>fff>ff>|``|ffff8<p``flxlf8<|fffffff>|f```>`<|~ffff>fff<|lf<|~ 0~0p p` 44b~ <~`<f<~>f<>f>0<~><~><``<f<~`<f0fff>ffff>|f<``<:0|00~ff<<6f|ff|`0|000` <~> 8< 4X|fff4Xfvnf<>f><000| 6kÆ6n֟6ll6l66l4X<~>4X>`~l>ffn <>6666666~~fv~ff<~>6640x |lll >fff~~fv66 p`~`p><H.,*H,=rFfBJldfJlff " MN`H " MN` K"Jf,=rNfpOr AQ MJfS H"ЁB6 "Aa R@?@$"A@a T@"A@a 2/$Aa E MJfSH"ЁX2/$A~a`pO2<AQ| MJfS H"Ё MJfS H"ЁB6 "Aa(| MJfS H"Ё T@"A@apOr AQ| MJfS H"Ё MJfS H"ЁB6 R@"A@a(TD R@?@(" M@a MJfS&VC H"$ԁ/@* 2/( Ka MJfS /*"$ԁ KJfS Ԁ 2/(A@a-o*`2N! / p??NMXO$_"tF@/A$Nd /$ ag uf JN>Vp`p.f8 R@Hr J`Sd_B2P MJfS H"Ё"RA Ja B JJfS.p.f.JGo*B2p MJfS H"H$҂Ҁ R@AlAa.r mXElTpB2p MJfS ".Ҁ0/( JAa MJfS ".Ҁ JJfS Ҁ0/(AAadp .f J"Kf JN=TN KJfS L,N^NuNVlH?4.-@txBl=-HxJfp`JfSx|-H`p| nx0`fRDRF Hm nxJfSx RN'&@ K/H( fp`<&H"nx Kf HN'$@ f KNNx`( . &f g uf| ufN0,=FAH!=AH!="AH!=&NP*JEk 9E=B=|p@fprA N2p??NMXON}(Jf~N N|` .f fprA NJ@f0,=N 9|=z`" FAHJg9E= NNL`RE Empl=f.9|T`N9@=B=T@f Nvp` 0,=J@kBlTNN|(JfN N|`N` !f f0,=?@ FAH!="AH!=&AH!=:/ N"`& -@roL2,=H$,=(o"R-A .Jjr-A)n=0,=H",=nB=l=gN |N6N|,(Jf o N,6` 1f f0,=?@ FAH!="AH!=&AH!=:/ N$&-@Tgpo<0,=H",=$(o&RJjv)C=0,=HnB=l=gN ^|NxN{n(Jf>poT .N+z`H f f0,=?@ FAH!="AH!=&AH!=:/ N% &(pgpo@0,=H",=$Ho(RJjx)D=0,=HnB=l=gN |Npo N*` "fH f> ,=N.(0,=H",=&o(RJjx)D=Nz^(Jf.NX`D fZ0,=FAH!=AH!="AH!=&NR@f N|`NNbNz(JfN N |` ffNz`r H".Af\ rFAHJgL0,=@gDAH!="AH!=&AH!=9E= N NNyz(JfJN TN p|REp @mz`x H".A,fb rFA JgR.G 0,=@gDAH!="AH!=&AH!=9G= NN Nx(JfNN |REp @m fF f<0,=FAH!=AH!="AH!=&N-NN~N |` "fL fB,=rFf8p?NNTOU@f,Jldf9|d9|/=` Bld9|=NPN$N @| .f fNLNN ` 2fJ f@0,=FAH!="AH!=&AH!=NP-@RfN `p-@ 0f^ fT0,=FAH!="AH!=&AH!=NP"-@N pgfNwlJgNJN f-|z` . g f H".A>hf NN`Jf H".A>hfx0,=FAH!="AH!=&AH!= NNR@g S@g S@g$`HN `B|NNv(JfNN `&|NNv(JfnNxN ` REp@m2 fB f80,=FAH!="AH!=&AH!=p",=NP|N @`, fJ f@pl=f8 ,=2,=FAH!"$,=AH!&AH!="NP(N ` -f fNU|NN ` -f fNW<|NN ` fP fFpl=f> ,=2,=FAH!"$,=AH!&AH!="Njp|N*N F`2 fP fFpl=f> ,=2,=FAH!"$,=AH!&AH!="NnJ|NN` fz fp0,=FAH!=AH!="AH!=&No>*JEk9E=B=|Nt(Jf`p@fprANp??NMXO|NLNh`Tp@fN:NV fJlff9|f`BlfNN2| bf N52N| f f NWTN| &f fN[`NN| /f fNoNN| f fNs f fNuNfN|`lz`T(HA*H .찕f"JfA@JHg N{ N(ND|` .찕f f Ny|REp @m f fNxfNN|` f f Nv8|` GfJfNN|` fJ f@0,=FAH!="AH!=&AH!=N|N N NRNn|`X . ag* f ". g f. f"prANB`p??NMXO-@ . g0 1g( rg g ag ug tf . g rg g ag tf tfNN`N`~NpL$N^Nup Sorry, running the RDD3 from the AUTO folder is not currently supported. q %ld - %ld | You cannot load any more documents. | | Press any key. Close Document | Cancel | Do you really want to exit RDD3 (Y/n)? | N N N>NNVH# pOr AQB.<,>\H,>brYfU 2,=F/@AH 0/A"/N 2,AH / 0"/N JgR>,=`p"AN:RG0,=l=@mN Z?@HxrH?NA\Or@N /?/HzHnN#4A"HJfS  B.p"NpOr AQAC=NHAN:0,=R@",=R./,=/?HnHzHnN"A"HJfS  B.prNO$pOr AQB.|[|]Jlff AC"` ACfprANp$rANLN^Nu RDD v3.00(Oct 23 1993) Files Loaded: %d Free Memory: %ldk Filename: %s[%d] Lines: %ld Bytes: %ld Pages: %ldST IBM Displaying Lines:N'N"(/0,=H",=. ,="n 2,=SAHӬ= ,=o R)@=a.NuLMKJ=g0,=S@H=lB=a|NuNV/J=gS= ,=Aaf.,=rFfpP@g pJldfN&`N`p2,=ANݸJl=fp2,=ANݤ`0 ,="=m=np2,=ANޤ`p2,=ANr.N^NuNVH#0,=H",= ,=$nR=0,=H",=Ҁ,S Aa.,=rFfpP@g pJldfN`N`p2,=ANJl=f0,=l=S@rA@N`:=m=n0,=l=S@rA@N`0,=l=S@rA@NܞLN^NuNVH>,=*,=`޺=n Aa,`|pOr AQB.,=rFfVpP@g `Jl=f RGrA@N.`=m=n RGrA@N0`d RGrA@N`Rp"ANJl=f RGrA@N`.=m=n RGrA@N` RGrA@NۨR0,=H",=ҀmLN^NuNVH#4*H~&M2,=H-@t K`Sd0l= B3 ."ҁ l<< l=$PJFo*`$p f H2,=R@"G.RJ`RGFmB5` L,N^NuH Bp ?NA\O2<H A/r ?NA\OLNur ///////// /////// /////// /////// /// /// /// /// /// /// /// /// /// /// /// /// /// /// ///////// /// /// /// /// ///// /// /// /// /// /// /// /// /// /// /// /// /// /// /// /// /// /////// /////// ///////---------------------------------------- The Revenge Document DisplayerCopyright (c)1990,91,92,93 Stuart CoatesVersion 3.00 Document Information: | | Document Number: %d | Filename: %s | Size: %ld bytes | Number of Lines: %ld | Number of Printed Pages: %ld | RDD3 - Please move the mouse | H Bp ?NA\O2<H A /r ?NA\OLNuNV/ *HHn MC\NXO*@ fp` MNA *_N^NuH! ~`p??p?NN\O"HҁA=1RGp@mLNuH! ~` HЀA=?0?r?NN\ORGp@mLNuH 0<w?Bgp?NN\OBgp?p?NN\OLNuH Bp ?NA\O0| P/r ?NA\OLNuH ,=rFfjJlhfpBg//r?NNO N0<NNaJBp ?NA\O2<H A=/r ?NA\O0,="A??p#?NN\Op?NNTOLNuH ,=rFfpJlhfpr?//r?NNO N|Bp ?NA\O2<H AP= /r ?NA\Op?p ?p#?NN\O9@=0<N>Na`aNLNuH ` p??NMXOp?p?NMXOJfLNu/ ,=rg",=tg o9|=`Bl=$NuNV9@=FAH)p=AH)pprAN2prAN&prA(NprAFNpr AbNpr ANpr ANpr A>Np"rANNuH~|` FAHJgRGRF Fm LNuNVH!$>,>\H,>brYfU0,="FAH*H" -/AN4. -"/N&JgR0,=R@"-R///-/?HzHnNhp2,=ANO~HHG`p??NMXO. Hg Pg Kg MgL$N^NuH' |~N*rdҁځ`BNlJGf~0,=T@rA@NՆp?p?NMXOJgp??NMXO, Hg Pg Mg Kfap@f JlTfNBl=LNuNN NNN(paNVpl=fN> |N!NH02(#w#w# w#w#w#w#wtvxz|~JAgJ@gn`fJ@g\`V,ywTfa x`0,=FAH1>R*AH1>P,AHCH!.AHCH!6A=CH#:AHCH!>AHCH!B",= l=",<$AH!2pr AdN0,=FArCNBlXJnfpr AZNˮp??NMXOp`0,=FAH!2 .LN^NuFind: | Searching, please wait. | | No match found, Press any key. | | Cannot search beyond the end of the document. | | Press any key. | | Cannot search beyond the start of the document. | | Press any key. | Direction (ALT-D):Case Sensitive (ALT-C):Global Search (ALT-G):_Forward BackwardNo Yes_ | Sorry, global reverse searches are | not currently implemented. | | Searching, please wait. | | Document number: %d | | | No match found, Press any key. | | NVH! ,=fp`pl>Tfa`0,=FAHBp,AH"02AHR2.AH"02=m"AH!2pr ANp??NMXOp`hpr AdN0,=FArCNJnf*0,=FAH!2pr ANNȢp??NMXOp`0,=FAH!2 .LN^NuNVH! ,=fp`pl>Tfa `0,=FAH1,AH"02AHS2.AH"02=m"AH!2pr A:N p??NMXOp`hpr A|N0,=FArCNJnf*0,=FAH!2pr AfNǺp??NMXOp`0,=FAH!2 .LN^NuNVxH?4.,*HB.x6,>P=l>R=l>T:. R@H-@-INZ&@ fp`:. n"Kf V@HN6$@ f KN Pp`:.,=rNfpOr AQ MJfS ?@(H"ЁB6 "ANŦ \@"A@NŖz0/("@H-A`F E?@$"A@N 2/$ANb MJfS ".ҀX0/$AAN@REp@m` pO2<AQ| MJfS ?@(H"Ё MJfS0/(H"ЁB6 "AN| MJfS0/(H"Ё \@"A@NŢz o(H-@`lpOr AQ MJfS0.H"ЁB6 E?@$"A@Nü 2/$ANJ MJfS ".ҀX0/$AAN(REp@m T@"VA?@(ANp X@2/(A@N^ Z@2/(A@NL R@?@$2/( M@N8 n"Jf JCNT MJfS V@?@&H"$ԁ/@. 2/$ JN-o.`$p@fJCf @"VAAN` @"VAAzN¾JEf @"XAAnN¨` @"XAA^N”Jnf @"ZAABN|` @"ZAA2NhxN/ p??NMXO$_/@*NH /*"tF‚$HA-B f f JCfv`vx .f fJEfz`z=Ex "f fJnfz`z=Ex ag uf KN JNp` p.f< .r K`Sd_0.B3 MJfS0/&H"Ё"RA KN\B KJfS*p.f0JEo,B3P MJfS H2/(H$҂Ҁ R@AAN.r m>nl8PB3P K"Jf JCN MJfS ".Ҁ0/$ JANr .V@:.J@f9C>P9E>R9n>T K"nf KN JNN nJfS L,N^NuNV/.pOr AQ ANA"HJfS  B.,=rNgrFf =2,=HҀpN<.N^NuNV H/ x>,= FAH!=9G>V9G>Xpl>Pfpr ANp??NMXOp`F0,>X9@=NB=?,=HzHn Npr A Nz0,=FAH1l>R*1l>P,!h.!h6C=!I:!h>!hBB2C*AIN:O pnf2,=$FAH!(2(.`z|:,=RE`&0,>VEf|` FAHJg9E>X|`RE Emzp@f.`&0,>VEf|` FAHJg9E>X|`REl>VmJFgp@fxpf$pr AN|p??NMXO9G= Nzp` LN^NuNV H/ x>,= FAH!=0,>X9@=NB?,=HzdHn Nzpr A N0,=FAH1l>R*1l>P,!h.!h6C=!I:!h>!hBR2C*AINO pnf2,=$FAH!(2(.`|:,=RE`60,>VEf|`0 rFAHJg9E>X0,=rAH!2|`RE Emzp@f>`60,>VEf|`0 rFAHJg9E>X0,=rAH!2|`REl>VmJFgp@fxpf$pr ApNp??NMXO9G= Np` LN^NuH pr ANp??NMXOpLNuN#NH~<,=RF` FAHJg.`RF Fmp@f0,=`9G= Nt0,=LNuH~<,=SF` FAHJg.`SFJFjp@f0,=`9G= N,0,=LNuNVH.B.p?prANCNlTOJ@j `2.r-gr+fAN2,܀` AN$,SJj, LN^NuGoto line:NpaNVH4B.p?prACNTOJ@kAN.p@mnp@nh0,=Gg`9G=*l<&l=0,=FAH$H ,= l<"RN,Hl )M<)K=`& MN8 KN2%F5l=%l< %l=)F=L,N^NuTab setting:N)NxH?<NNT @g> @g33#`<33#` 3?333?<"NNT @A Ad//?<?<NNO LNuH?<"NNT @A A4.,H/</?<?<NNO //?<?<NNO LNuH"<SSfLNuHaf ICE!g Ice!fPaTKaN.(I,I&N%aL,Katd4><aldpap>|8#zD@DADBDCQQHQLNurQNua*d"ra$dCv !a"H@@Vҩ%QnNuf%Nurf%AQNuCtaTxr1 Hka1 Ag"CvtaTr1 HaBq jD`rptadpt?aBC@!!Q`R   NVPH*H&IA,CPp"QAPC8NAPCNNzAPCdNnAPCzNbAPCNVAPCNJAPCN>APCN2APCN&APCNAPCNAPC0NAPCHNAPC`NAPCxNAPCNAPCNAPCNAPCNAPCNAPCNAPCNAPC,N~APCBNrAPCXNfAPCpNZAPCNNAPCNBAPCN6APCN*APCNAPCNAPCNAPC*N0,=U@?p2,=APN0PTO @#dZ@0;NDP`p ,<L\l| *8B*B`*!&`*1&`*&`*&&`*&`*.&`*"&`*&`*0&`t*B`h*"&`X*&`H*.&`8*&`(*&`*&`*&`*#&`*&`*&`*0&`*2&`*/&`*-&`*&&`x*&`j* &`\* &`N*&`@*&`2*GB`(*&`*bB`*aB`p*&L(N^Nu Switch Document [Tab]| Search for text [Alt F]| find next [Alt N]| find previous [Alt P]| Load Document [Alt L]| Load Clipboard [Ctrl A]| Close Document [Alt C]| Goto Line [Alt G]| Goto Top [Alt T]| Goto Bottom [Alt B]| ST/IBM Font [Escape]| Toggle text size [Ctrl G]| Tab Setting [Ctrl T]| Printer Config [Ctrl C]| Print Document [Ctrl P]| Print Marked Block [Ctrl W]| Start Block [Alt S]| End Block [Alt E]| Hide Block [Alt H]| Save Block to File [Alt W]| Save Block to Clipboard [Alt A]| Set Bookmark [Ctrl B]| Goto Bookmark [Alt M]| View Picture File [Alt V]| Execute Program [Alt X]| Locate RDD [Ctrl L]| Save Config [Ctrl S]| Locate Editor [Ctrl D]| Edit Document [Alt D]| Locate Utility [Ctrl U]| Execute Utility [Alt U]| Document Info [Clr Home]| Sort Documents [Alt O]| Help [Help]| Exit RDD3 [Undo]NVH# B.prAVNJprA^N0. R@m @l@0;N (L:B.`ACp"Q2BACN@ACN4AC N(ACFNACNACNACNAC(NAC`NACNACNACNAC4NACjNACNACNAC NACBNtACxNhACN\ACNP`A Cp"Q2BAC >N,`pA Cp"QAC N AC NAC NAC .NAC ZNAC NAC NAC NAC NAC ,NAC lN`A Cp"QAC NtAC NhAC N\AC FNPAC xNDAC N8AC N,AC N AC NAC NAC NAC N`4A (Cp "Q2AC DNAC lNAC NAC NAC NAC NAC NACNzACNnAC8NbACHNVACXNJACjN>`AxCp "Q2BACNACNACNACNACNACNAC2NAC8NACDN.g^JGfprANP` prANB|HHF`p??NMXO, Hg Pg Kg MgJGfNrLN^Nu Select Help Topic Keyboard Controls | Program Details | Credits | Registration | Support | Latest Versions Cursor Up/Down - Move Up/Down Line Alt S - Start Block | Shift Cursor - Move Up/Down Page Alt E - End Block | Spacebar - Move Down Page Alt H - Hide Block | Ctrl L - Locate RDD Path Alt W - Save Block to File | Ctrl S - Save Settings Alt A - Save Block to Clipboard | Tab - Switch Document Alt L - Load Document | Keypad + - Next Document Ctrl A - Load Clipboard | Keypad - - Previous Document Alt C - Close Document | Alt F - Search for text Alt X - Execute Program | Alt N - find next Ctrl C - Printer Config | Alt P - find previous Ctrl P - Print Document | Alt G - Goto Line Ctrl W - Print Block | Alt T - Goto Top Ctrl B - Set Bookmark | Alt B - Goto Bottom Alt M - Goto Bookmark | Ctrl G - Large/Small Text Shift A-Z - Set Bookmark | Ctrl T - Set Tab Width A-Z - Goto Bookmark | Keypad * - 50/60Hz Ctrl U - Locate Utility | Escape - ST/IBM Characters Alt U - Execute Utility | Ctrl D - Locate Editor Ctrl 0-9 - Locate Utility | Alt D - Execute Editor 0-9 - Execute Utility | Clr Home - Document Info Ctrl X - Execute Document | Alt O - Sort Documents UNDO - Exit RDD v3.00 (Oct 23 1993) | Copyright Stuart Coates 1990,91,92,93 | | Written using: Lattice C v5.52 | Devpac ST v3.00 | 520STe,16MHz,4MB Ram,48MB HD Design & Coding : Stuart Coates| | Beta Testing : Mark Matts Keith Frisby | Trev Ward Gordon Meyer | John Charles Robert Darling | Daron Brewood Stuart Richards| | Compiler/Assembler: HiSoft (Lattice C / DevpacST)| | Music while Coding: Frank Zappa Steve Vai | Yngwie Malmsteen Infectious Grooves| | Thanks also go to:| | Sega for the Mega Drive and Mega CD, Virgin for the game 'Cool Spot', | The Coca Cola Company for Tab Clear & Diet Coke, ZyXEL for fast modems, | Geraldine Matts for excellent chips. The RDD is shareware, this means that if you use the RDD | then you are required to register. All registered users | will receive the latest copy and other related software. | | The registration fee for the RDD is 5 (or US$10) and should | be sent to Mark Matts at the address below who is handling | all RDD registrations.| | Mark Matts | 66 Telford Way | Leicester LE5 2LX | England U.K. | | The RDD may be distributed freely by any PD library or BBS, | but may not be distributed on magazine cover disks without | the permission of the author. Any bug reports for the RDD should be sent via | email to the author or via the official support | BBS sysop, Mark Matts. Mark's address can be | found in the 'registration' section under Help. | Bug reports can be sent to: | | System ST| Modem Number: +44 533 413443| Online Times: 22:00 - 07:00 GMT| Speeds : 1200 - 9600 | | Internet : scoates@filesys.demon.co.uk | CompuServe: 100010,2106 | Fidonet : 2:255/320.42 | NeST : 90:100/101.42 | AtariNet : 51:6/4.42 Latest versions of the RDD can be obtained from | the following sources: | | System ST BBS| - see 'support' information for details. | | System ST BBS Sysop, Mark Matts | - send 2 (or US$4) + disk | - see 'registration' information for details. | | Compuserve | - GO ATARIPRO | | Most good PD Libraries and on-line services. NV2H~`?,>`?,>^?,>\HzHn4NnA4C:N|O,>brYfA4C0N|` A4C&N|A4CN|,>crYfA4CN|` A4CN|A4C N|,>dH@Fg(@ gW@g`(A4CN|\`A4CN|N` A4CN|@prA4N.  @d4@0;N >B.4p?prAC4NZA4NvTO,JFo9F>\NR`B.4p?prAC4N&A4NvbTO,JFo 9@>^0,>^l>`lBl>`N`B.4p?prAVC4NA4NvTO,JFk l>^l9F>`N`l,>brYf|N>b`ZA>b`T,>crYf|N>c`BA>c`d`|S>d`|F>dp@fLN^Nu Page Length: %d | Page Width: %d | Left Margin: %d | Page Numbers: YesNo | Pause Between Pages: No | Printer Port: ParallelSerialFilePage Length:Page Width:Left Margin: Parallel Port | Serial Port | File NVA>1=A>!=N^Nu<< Unused >><< Available >> %c: %s | %c: %s: %s |H. A>*HpUg2>*-0,=@f|`|FAH!=9G= NX)E= L NuHpANmV*@ fp`F MC^a0,=U@?p2,= MNTO.p@f MNp` MN~ HA>h 0L NuHpANl*@ fp`F MC aD0,=U@?p2,= MNdTO.p@f MN~p` MN~ HA>h 0L NuNVH4*H-IB>,=|` A>&HpSf$ @AH/.?HzHn,NjO`0N0 +ANE`RJp g&J` p|f RKJfA=CfA"HJfS rc&|<"HJfS AptFCHNu A"HJfS JB(F @AH/ Hn?HzHn,NiLO MC,NwRFp@m MJfS B5 NVL,N^NuNV$H?4.,,>drFf*pA?prACUNTOAU"HJfS g,>drSf ACUf,>drPf ACUf0,>^rPAg^=l=9@=*l<&l=-l=0,=F/@$ ,= ldrFg,>crYf pr JNfxz6,>\,>brYfUC-G` ??Hz0HnTNgprATNO 0,>`J@oHr AT`SdAT0,>`"HB .Jk=nAT>`N,,>drPgrSfHnTHz/ NbO `HnTHz/ NbO RE/ p?p?NMXO$_Rf4/ p??NMXO$_. g ag uf -@ .Ⰶf =E`Hzb/ NbFPORERn0.CoCfz,>brYf\0<r ATQ0,>^jR@@_@Hlr=A| TAT RD?Hz/NfjHnTHz/ NaO`RDHz/ NaPO,>crYftp??Hl=HzHn(Nf(prA(NBO/ p??NMXO$_.`/ p??NMXO$_. Hg Pg Kg MgR .Ⰶo,>brYfb`Hz4/ NaPORECo0<r ATQ0,>^jR@@*_Elz| TAT?Hz/NedHnTHz/ N`O` Hz/ N`PO JN\0pPl>^g$ lHz~NV\XO`p??NMXO, Hg Pg Mg KgNlNLN^NuNVdH!4AdNxAdNs*@ lPHCfJffaJ@fNTNp lPHCifAi"HJfS AfCf0,=R@rA@NAiCNu&@ g=Hz/ NZ>=Hz/ NZ,=H>Hz/ NZ>=Hz/ NZ>=Hz/ NZt>>\Hz/ NZf>>^Hz/ NZXOH?,>`Hz/ NZF>dHz/ NZ8>fHz/ NZ*,>bH>Hz/ NZ,>cH>Hz/ NZ,>dH>Hz/ NYO2,gHlHz/ NYO ~`& HA@*HJg/?Hz/ NYORGp@m KNU"`0,=R@rA@NBp??NMXOL,N^NuRDD.PRGINF | Saving, Please Wait. | w*** *** Config file for RDD v3.00 *** *** Editing of this file is not supported. *** *** File created: %s*** LINE_LENGTH %d TAB_SETTING %d TEXT_MODE %c SCREEN_LINES %d TOP_OF_SCREEN %d PAGE_LENGTH %d PAGE_WIDTH %d LEFT_MARGIN %d SMALL_FONT %d IBM_FONT %d PAGE_NUMBERS %c PAUSE %c PORT %c EDITOR %s UTILITY%d %s | Error writing to file. | \*.PRGRDD3 - Locate RDD.PRG | Please Wait | \RDD3PATH | Cannot read file | | Not enough memory | rb | Invalid program file | wbNV*H#4|Npl=fN(plPgzB,?pAmNIAmC2NiplhgNNnHz"HnAmC?NCNNN0,=R@rA@N|POpnfp//Hn`AmCNk:ACfAC`NibANJ2O A`"HJfSȲg ACNi6AC?Ni*ACWfAWCNip/?NATO*@Hn*p?NA\OBgHnpN?NAPOJg,/ p?NA\O0,=R@rAd@Np??NMXOp`B/ p?NA\Op ЮDN\*@ f"0,=R@rAB@Nrp??NMXOp`AC>Np&@ f"0,=R@rA@N>p??NMXOp` .Dr M"KN KNP&M..D`p KCWNi:J@f|Y`RKSJnpNf& MNm0,=R@rA@Np??NMXOp`lACfACNp&@ f 0,=R@rAj@Np??NMXOp`. .Dr M"KN0 KNPD MNm lPHCfp`pL,N^NuNAdN=NCf R@"ERAAN4` R@"ERAANxRE8.nm,=rNf$ 2/&AN HЮR2/&AN*`8. Pf . g f:.SE0.El0."SAAl$D B&SC`( D&SCEo& DR@=@z .$TA*H(RD=A-B` .r A`Sd0.EH/2HzHnNS4O A"HJfS  B,=rNf. ER@?@$"A@N HЮR2/$AN`, ER@?@$"A@N HЮR2/$A|N ER@"A@N8REnm: .Tr A`Sd H rCfA"HJfS "H "HB 8."D*RE"N0,=rNf "AN HЮR"AN*` . g ug af r=A` g rg tf tfbp9@=`X:.CV@8.J@g:0.S@@oSD=DRnz ."TA*H-A` .r A`Sd0.E( H/2Hz HnNQDO A"HJfS  B,=rNf. ER@?@$"A@N HЮR2/$AN`, ER@?@$"A@N HЮR2/$ANCf R@"ERAANx` R@"ERAAN6RE8.nmJDjRD=DSnz ."TA*H-A` .r A`Sd0.E( H/2HzHnNP2O A"HJfS  B,=rNf. ER@?@$"A@N HЮR2/$AN`, ER@?@$"A@N HЮR2/$AzNCf R@"ERAANf` R@"ERAAN5RE8.nm .T-@r A`Sd0.H rCfA"HJfS "H "H*IB*RE n D?@$"@N5J,=rNf$ 2/$AN HЮR2/$AN .r A`Sd H rCfA"HJfS "H B "D*RE"Nb,=rNf "ALNL HЮR"A:N8*=E`|:.N6 o(Nb JNb L,N^Nu%s ><NCNDtNV/-@Htl=fN|plPg,vfpAvN;AvCN\0B,AC?fAvC{fplhgNNHzHnA{C?N5DN POA{CvfA?CfplhgNnpnfxp//HnA{CN]hACafAaCN[AaN<`O A"HJfSȲg AaCDN[dAaC?N[XBg .".Aaa$.N^Nu\*.*RDD3 - Save Block\wr | WARNING: %s already exists. | | WARNING: The clipboard already contains data. | Overwrite | Append to End a | ERROR Opening file | | Saving, Please wait. | %s A:\CLIPBRD | ERROR Writing to Clipboard. | SCRAP.TXTNV2H/$.,*H:.AC22 MCNbZJgx @NBJEfNPNl/ HzHn4NKO `HzHn4NKPO0,=R@rA4@N0,=\@r?rA@NRTO*JEkdp@fAC22` JEfNN MC2Na*@ fN0,=\@rA@N~HHG`p??NMXO. Hg Pg Kg Mg`||20,=\@rA@Nh`p?p?NMXORf0p??NMXO( g ag ugJkx=nr A4N6Hn4HzB/ NEO r NJJfJ0,=^@r)A2@N0|.2r|ft/B2`&t/ft-B2`t-ft\B2` t\fA2Ro> MN@L$N^NuNV6H#$.-AAkNL$N^NuA:\CLIPBRD\SCRAP.TXTr | There is no data in the clipboard. | NVr?NAOHnp;?NA\OB=0,=NA-H`Am-Hdp-@hNNHnmHzN5POAmCfJffxA)H@l0<N)J@g.fJBp ?NA\O2<FH A4/r ??BNA\OACf0/A@A)H@l0<N)jAC~NNA-HdAC`NIJ?p?NAXOHnRp;?NA\ONNNAmC&f JffNP`AmNLN^NuNVdH|~`* HA@*HJfp܀` UJfS P܀RGp@m rЁNA*@ gB~` HA@&HJf& MJfS "M R@?Hz/ N?jO `n SCefAe"HJfS rORGp@mR MJfS B5p2,= MN.JGjN|` 9|= aL(N^Nu %2d. << Available >> | %2d. %s | %2d. << Unused >> |\*.PRGRDD3 - Locate Utility\ | You've not defined this utility. | ClipboardA:\CLIPBRD\SCRAP.TXT Executing: %s >ELoading %s. NVdH|~`* HA@*HJfp܀` UJfS P܀RGp@m rЁN?*@ gB~` HA@&HJf& MJfS "M R@?Hz/ N=bO `n SCefAe"HJfS rpr AfCN0O J@kp?NATO. R@?HnrG?NAPOp//Hnj U"@NJ( UH@A>r?NAOHnjp;?NA\OACQfA"HJfS @PB=0,=NNN/HzN.PO UJfS rc UJfS "UYIAf`B.BHnP/BgpK?NAO?p?NAXOHnp;?NA\ONNNN>AkC$f JffN`AkNL$N^NuNG4NN NJNDpaNV H/$A=C!fp2,=A1A>BRGp@mL$N^Nu | Sorting, Please Wait | H~|` FAHJf.`RF Fm LNuNDpa/ *H MJfS rdp` MNI MJfS "MYIAfJff Ma` MJfS "MYIAfJff Maj` MJfS "MYIAfJff Ma `V MJfS "MYIAfJff Ma`, MJfS "MYIAdfJff Ma`p*_NuJanFebMarAprMayJunJulAugSepOctNovDec.ARC.ZIP.LZH.ZOO.ARJ|rb %-21s %10s %10s %4s %-10s %-5s %-6s FilenameOrig SizeComp Size%CmpDateTimeCRC ====================== ========= ========= ==== =========== ===== ==== \%2d%4x%s%s %-21s %-21s %10ld %10ld %3d%% %2d-%3s-%4d %2s:%2s %4s Total files: %-5d %10ld %10ld %3d%% ====================== ========= ========= ==== =========== ===== ======== %8lx. %-21s %10ld %10ld %3d%% %2d-%3s-%4d %2s:%2s %8s NV|H?4*Hz@~xvA,C2p@N6~$@ fp`B MC NJ&@ fp`pPN6R/@$Jgpr@ K"o$N2 JaHz2Hz(HzHzHzHzHzHz/N3 JadHz /N3O,B.M.r|ft/B`&t/ft-B`t-ft\B` t\fAprAN KN+@+fjrfb@Skm kRp` KN+T@+f6Jg0rfN.MgbAM"HJfS ALBAM"HJfS, `AM*Hp\g(BSFJFj`p rA"KNY~+f.rf*prA9"KNY\AMCN@AMC N@`prA"KNY2+fxAa8prA"KNY+fXAapn=@0<nHr2A\-p0<nHH=@prA"KNX+fAapn=@0<nH=@0<nHH=@prA"KNXv+fAa\prA"KNXV+fAa\?.HzHnN1jO .r f|0?.HzHnN1FO .r f|0?.HzHnN1"O .r fp0@.ݰfp0@.ްf|0Jg .rdN1".N1:rd,`|HnHnMHzpHnN0OA"HJfS rc" JaFHnHzF/N0O A@CB Ja$rҮ4<nHnHnHn?/.?.?//.HnHz/N0@O* JJfS rdҁЁc  JN5$@ fp`RGخpЮր .r KN-,+gB KN&*o$ g MND JaxHz/N/POJg rdN0"N/rd,`| JaJ?//?Hz/N/ L,XN^NuNVH?4*Hz@~xvAXC2p@N1&@ fp`B MC8NE*@ fp`pPN1~$@ gpr@ M"JN. KaHzbHzXHzNHzDHz6Hz(HzHz/N. KaHz/N.O,.r|ft/B`&t/ft-B`t-ft\B` t\fAprANprA"MNUTAad-fv KPfjprA"MNU(-fRprA"MNU-f:prA"MNT-f"prA"MNT-f Aapn=@0<nH=@0<nHH=@prA"MNT-fAa~pn=@0<nHr2A\-p0<nHH=@prA"MNTD-fnAaJ/.HzHnN-XO |`p 6`f0`RFp@mprA"MNS-f AaprA"MNS-fAaprA"MNS-fAaprA"MNS-fAa|0.R@r2 N.-@gr2.p n"MANSX np0.B?.HzHnN,pO .r f|0?.HzHnN,LO .r f|0HnHnp/ n"@N<(ACN:\ACN:PO Jg .rdN,".N,Nrd,`| nJfS rc$ Kar/.Hzr/N+O Al"nf KaN2<nHnHnHn?/.?.?/././.Hz/N+n nN?O* KJfS rdҁЁc  KN1&@ fp`RGخpЮրp0.".Ҁp MAN(H-g* MN! g JN?* KaHz/N*POJg rdN+"N+ rd,`| Kaj?//?Hz/N* L,rN^NuNVH?4*Hz@x~vBAtC2p@N,&@ fp`B MCTN@*@ fp`npPN,$@ gpr@ M"JN)* KaHz~HztHzjHz`HzRHzDHz6Hz/N* KaHzV/N)O,.r|ft/B`&t/ft-B`t-ft\B` t\fAprAN MN!@-f^reV MN!@-fBprA"MNP@-f*B.prA"MNP$-fAa*prA"MNP-fAa prA"MNO-fAapn=@0<nH=@0<nHH=@prA"MNO-fAapn=@0<nHr2A\-p0<nHH=@prA"MNOH-f2p"A"MNO0-fp.R@HN*-@gr.p n"MANNp. nBprA"MNN-fAa ?.HzHnN'O .r fp0@.ڰfp0@.۰f|0?.Hz`HnN'O .r f|0?.HzA(a prA,"MNI-fA,a MN6@0-f MN"@1-f MN@2-fprA4"MNI-fA4aprA8"MNIr-fA8aX MN| MN@-fA:RFJf-fh?. HzHnN"TO .r f|0?."HzHnN"0O .r f|0HnHnp/A:"@N2 ACrN0@ACN04O J(g .,rdN"".(N"2rd,`|A:"HJfS rc" KaVHn:HzV/N!O APC:B Ka42<nHnHnHn?/.?.?/.,/.(Hn:Hz/N!TO* KJfS rdҁЁc  KN'&@ fp`|RGخ(pЮ,ր . r MNB-g MN g JN5$ KaHz8/N POJg rdN!"N!rd,`| Kad?//?Hz/N L,N^NuNV2H?4*Hz@~xvArCD2p@N"&@ fp` B MCRN6*@ fp`pPN"$@ gprP M"JN( KaHz|HzrHzhHz^HzPHzBHz4Hz/N KaHz/NprA"MNFAaO,-f0. @`g @`g MNp`\prA"MNFx-g MNp`:AaT0.X@r2p MANprA>"MNF:A>a*|` MNRFn>eJn>gprA@"MNF A@a.Dr|ft/BD`&t/ft-BD`t-ft\BD` t\fADprADN,prA2"MNEA2a-f0.2 @`g @`f prA4"MNEA4apJn4g MN@6 MN@7 MN@8 MN@9 MN@: MN@; MN@< MN@=prA>"MNE-fA>apn>=@D0<n>H=@B0<n>HH=@@prAF"MND-f>AFapnF=@N0<nFHr2A\-pJ0<nFHH=@HprAP"MNDv-fAPa|prAT"MNDV-fATa\prAX"MND6-fAXa???prAN. M"KN>.0,W@2,WA4,\B6,\C>??????r@NO"` )M@l)K@p)n @t0<DN". n0@ L(N^NuA 0A"P"0<NBA@0Nu     !"#$%&'()*+,-./0123 456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}NVH# .-Hp9@@r9A@9@d9AbNHJ@gcp9@|9@@N0J@g0<lz9|@` 9|Bzp9@@p9@9@@NJ@g9|9|@` 9|B9|@|p@n NJ@f HA@RF`p?p?pF?NA\Op9@@r9A@9A@t9B@9A9|9@9|BJlLg"@@@9A@9B@  n"l(NN pLN^NuNOhpa)_4H8??<>NAXON-:)_4H8?/?<BBg?Hx?<BNAO rJWD?A NAO 0L8Nu)_4H8?/?<=NAPON,H'$.*H,BXJfp`JGkf N`J@gtJGo/ /?p??NAO *JkNJgpfHl,Hx?p@?NAO z`,g XRHl,Hx?p@?NAO ` p f N,` @/ /?r??NAO N+L$Nu)_4H8?/2?<BNAPON+)_4H8JfpN+//??<@NAO N+H#$.*HJGf"p?NATO,HJj N+x`, rAЁ` @@|:A?/pG?NAPON+JL$Nu// "QS@t `| SAgU@c дgSAW  _ $Nu/2H@t `WWf(CQQ`дWWf CQQ g$NuNVH# .-Hp??/rC?NAO N*,JFjp`gg 9| Tp`pLN^NuNVH -Hp:(fHN$@A?r?NAXOT/.p;?NA\ON*4LN^Nu/.BXJGk&l4l HA@Jpg HA@ `9| Tp.NuH!$. N*@ fp`.-gp:` ?-p>?NAXON)p:JXgp`pL$NuNVH/4.*H, Nb&@ fp`>++g Jl8gHl--gJl8gHl@Hxp?p@?NAO -gUOp? rNXO*Jjp`g " nN|*`n n-H-Hp@Ѐe^(,l( O ",@(p@Ѐm&A`:HxpH?NA\O(p@Ѐm$ Ѐc( m(</pH?NA\O&@ gx-K d"`" nCNb-@윀f ." Jg." K@N`" ." " K@NRg -K-n` l@g/ pI?NA\O`rJgnp " nN-@f " nNd n"H-I`B" n@NF".찁f& rABN.UfR ."윁-@` .*JXgp` L,N^NupaNVH.*H*p1mgp`FJmfb-fZp;@ rAg* MN,J@g p`0-;@ Sm m mR r`  MNr" `-g,p@fp` @x H2-A@N0,~`, - (JDg H2- m @N,`|pf` Hg-gp;@ `0-;@ m +Hp@g"Sm m mR r`  MN"p0mgp` p@fp` L N^Nu/ *HJmg -fp`40,HN +@+@ f 9| Tp`;lpmp;@ ;@*_NuNVH*H&I-n nHJg:p%f*fR` M/ / nCN&bPO-@g-@`H KN`L(N^NuNVH|A -H n-HJgp%f-HH@dgF@ gW@fd n*X-H`J n(-HKzJEkSM rASE`B.` n8H-H AN`K/ NrXO@`lRFSlrm llRl r`PHAhN"`>RFSlrm llRl r`"HAhN"` L N^Nu/ *o MJfSp" MChN2$*_NuH'4.&l g kN&S`KP g.pmU@f - ,JFg H2- m @NH*U`Jg lXH/pA?NA\ON" l)P`zl4l HA@Jpg A@00NRE` NL,NuH*H~-g MN<.p mfJmg m NBm0-N|,p@gJFfpL NuH*H g-f*+m p;@B-;@ -g`pJmgj0- J@jr;A 0-m ,JFg, H2- m @N.p@f` Fg+m -gp;@ rm`;m p0mgp`&p`"~KP gJmg Ma.J@g~*U` L NuNVH*H~-gAPf pAhNSmm mR~ `p3mS@g"0<m @f` p;@p`-gFBm~-gB-`0-rAN6.JGo~.`|JGf`~`fJmf MNjJ@g p`N+m 0-H2- m @N;@.oSm mR~`JGf` Bm~ L N^NuNVH*H.&I-M SGJ@gJGg-MJkgZ km0+* Hr n"k@N|*@ g ѫ2+H7A`B k'Hk n*HE` KNN,p@f nfp`SG p @fpB .L(N^NuNVH*n-H-I gBNd-@Jf nr/gr\gp:(fp`>,TCHNJ@oANACf` ACfAN&@ gdHlp@Ѐ KCN*XO&@.gB g A"Mfp//.HnA|"@NA|"nNO -@Jg9GT`2JfACfJfgACf`l gBpL(N^NuH.*H&MRS0+Rk"0+ @mAHr"k@N,BkL(NuNV/ *np=@=@-MAHn/. CN POJng0.HrA"n@N,-f-gp`0.*_N^NuNVH.*H| @Sm m2 mR -gp @f MN0,JFg ` `p3mU@gR0<m @f0-;@ `4-gp`0<m @f;m ` p;@ `-g0Bm 0-rAN4,p@f`|p@gv`nJmf" MNJ@g p`^0-;@ +m 0- J@n MNT,JFg `8Jm g mR Sm -gp @f MN,JFg ` L N^NuH*H.,-g MNp@f MNVހ|+m p;@;m B--g rm;@ UO?0-"N#XORfp`pL NuH*H-g\-g MNvUOp?0-rN#XO.`jUOp?0-rN#XO2-H.&m<- SFJ@g>r fS`UOp?0-rN#PXO.-g0-m Hހ`0-H L(NuH.*H&MRS0+Rk"0+ @mAHrCh@N)BkL(NuNVp=@=@AHn /.CNPOJng0.HrACh@N),{f,{gp`0.N^NuNVH*H&I., J@n @DY@g 9|Tp`-fJmg-f m Np;@ ;@pm J@g4Y@g@,T-Ip\ INp-@Jf n-Hp. nNJg"p nN$J@gp` n"Mf`Hl( M"nN p MNXOJ@gfHl, M"nN p MNXOJ@gJHl0 M"nN p MNXOJ@g.Hl4 M"nN zp MNXOJ@gHl8 M"nN ^p` BX9GTpL N^NuNVxH*H-Ix MNJ@fp`r nxr/gr\gp:(fp`TA@6g S@g@fRzr+ n(W@(`<:<r+ n(W@(`$x n(H@ag S@g @fz`:< nH@ag@gN[@g`JDgp`p@@?,H?/.N PO,p@fp`><@JDg``xJDgp`p@?,H?/.N PO,p@fp`|JDg><`F~`BJDgp`p@@@?,H?/.N zPO,p@fp`>JDg><`~`p`,fp+@ ;@;F+m ;@ ;@;G L N^NuNVH-HJ(gDJfS. Jg2*l(Jg*  U"nNJ@f U"Hp=f C `XM`pL N^NupaNVH*HAN. @AN.N^ެA~ g* L N^Nu  # "_` "l4L8Jj$AD)@X @ClApfp9@TpNBXN"_` "l4L8Jkp)@XNpaNVH /.p9?NA\ONLN^NuH0`HxCr1fJ@m @$n @f Bt` -fP` +fJ@fp 0f8p Xg xf(p`" f 0f xfRH` xfRHJgt 0mT 9n0` Am>7l4&gHCHCJCfԃek`PPԁek`PP`JgD"/ g"ASH"" L NupaNJAg$HA f JAggpJAgRr"9ATNuNVH'*I&n-H~|zp| r=A=|A@@=A=A-H nJg<H@ gW@gQ@gU@gW@g` ~`|`z`|`|0R`p* n̰f"UT0=@l ~=@R`CN n-H nr.fJng0. n NBnJ.g$.rxgrXfp0 n N.H n NSnm.H n N`Jng 0. n NJ.g$.rxgrXfp0 n N.H n NSnm nH-H n N` .L(N^NuNVH/.,:. N*@ fp`p@g Jo-fUO?0-"N`UOp?0-rNXO(JEf-F` І-@UO?0-"NXO-@".g|JjUOp?0-rN˞XO-@0<rAQ .".$o@, c,<0-"ANv(gJo ".Ё` .` ݮ` .L N^NuNVH'$*n-I-Hg?NAXOJgp> nf?NAXOL$N^NuNVH!4*H&IpA&-@-@r gr fRM`Jgtp@"g$[@g @gU@g `RM-M~`RM-M~` RM&`&~Jg,Jg V@`r g r gp`pJ@gRM`JgB`xpNJ@gp?p?pF?NA\OB n"nap& L,N^NuNVHBX|l4l HA@JpgRF`0,4Ff 9|Tp`, HA@*Hpn 2<l0n =@. grn A=A J@gS@gS@f>. RG` 9|Tp`=lT0. nNr*JkZJXg Np`0<n @f Nƶ9|Tp` J@k^. gV NƖ nN nNƞ*`<. g00,F@2.@9nT=Ag fp`p nNf*`p`"pfp` NjJ@f: ;@ L N^NuNVH*H-I g M` lA&H fp`4 KNDJfp`$ K"nN4-@g @JgB-H)nA L(N^Nu)W4H8B/?<CNAO NNVH*H.,&I "N*Jfp`fJ f"0,Hd+f KNLJ@gp3kS@g 0<k @f` Bkp`Jg +f 0+Hcz0+H k"M`Sd M0+H"0+Nr(pf0+H"N,`(JfJkf |`0+H"Ҁ "N؜,p7@`Jkg<0+Hm =@H k"M`Sd k0.'HkH*MJg( KN =@rAf"҇S "N*" `0.S*MRM` L(N^NuNVH.,*I-H "Np*Jfp`J f00,Hd&-f MN˺J@g` ;m +m Jgp3mU@gV0<m @f0-;@ `8-gp`0<m @f0-;@ ` p;@ p`h-f 0-HcJ g`0- H n"m`Sd0-H2- m @Np(0-Hg$pf p` "N`+m  n0- H"0-N"(0- H"g4pf0- H"N֌,`,0- HЄ"Nt,`0- H"Ҁ "N^,0-;@ `pJm gD0- Hm =@H n"m`Sd m0.+Hm H n-HJgX MNJ@gL ЇS"N" ` L N^NupaNVAN-@fb0,^ @dP@0;N&&D&&&&&:0&&:&A-H`&A-H`A-H`A-H`A-H nPAhAhAB,ACA)IACAINV@ n0.H"<-HNՔ)@A~ nJgPAhAhAp@A9|A|`B,ABlA|AA)HAN^NuTZCST6CET-1???-2???-3GMT0NV/-H0( H2(H4<lh ???(?(?(A/0A/0HzHlANAA $.N^Nu%.3s %.3s%3d %.2d:%.2d:%.2d %d NVH7-H. "<QN, "<QNӶ. "<NӨ9@A "<NӘ. r?@ABCDTUVWXYZ[\].26:>BFJNRVZE E( E (P @ ( EEFF,0123456789abcdefPATH,;PATHPATH (ARGV=prgttptosappgtpPATH;, \JanFebMarAprMayJunJulAugSepOctNovDecFFFGGGG GGGGG SunMonTueWedThuFriSatGTGXG\G`GdGhGl ((((( H ((((( H  \pFL  4&<L  L : & L DDHV" H xb* Fvb(Z   N40` 8@( OSELACUNAELADANUMLADYBUGLAGGARDLAKELETLAMAISMLAMBENTLAMBKINLAMELLALAMINAELAMINARLAMPERNLAMPOONLAMPREYLANDINGLANDMANLANGUIDLANGUORLANIARDLANOLINLANTERNLANYARDLAPILLILAPPINGLAPPISHLAPWINGLARCENYLARGELYLARGESSLARGESTLASHINGLASTINGLATAKIALATCHETLATENCELATENCYLATERALLATRINELATTI The Revenge Document Displayer Copyright (c)1990,91,92,93 Stuart Coates Version 3.00 23rd October 1993 Welcome to the Revenge Document Displayer v3 (RDD3). The objective with the release of RDD3 is to provide a text viewing utility for the Atari ST range of micros that is powerful and easy to use. Previous versions of RDD had a vast number of options available to the user, RDD3 has omitted some of the less used features of previous releases but has gained several very powerful ones. A Brief History The RDD v1.00 was released on 15th April 1990 in response to a request from a friend of mine for a text viewing utility that was more flexible than the GEM Desktop's own. RDD1.00 was written in Hisoft Basic and didn't contain many features. I decided to develop the idea of the RDD from this base with several releases throughout the year resulting in RDD 1.93 released on 28th October 1990. That Xmas I purchased Lattice C v5.00 and decided to learn C - no better way than to port RDD to C. RDD v2.00 was released on 3rd February 1991 and contained many more features and was a lot faster. RDD2 was a lot more stable than RDD1 because of this rewrite. During 1991 and 1992 no less than 21 versions were released and 14 organisations purchased custom copies. Several other text viewers sprang up during this time which I'm grateful for as they gave me new ideas for the RDD, this also gave the ST community greater choice. Version 2.30 was released on 27th September 1992 and was the last RDD2 release. I received a large amount of feedback from RDD2 which encouraged me to start work on RDD3 in December 1992. The first beta release was shipped to testers in January 1993. Very few bugs were found in this although many features were missing. The RDD3 that you see today has taken many months to develop and has been thoroughly tested. Using The RDD3 Loading a document: There are several way to load documents into the RDD3, 1. Double click on RDD.PRG from the desktop and use the GEM file selector to pick a document. 2. Rename RDD.PRG to RDD.TTP and enter a document name on the command line when running. 3. Install RDD.PRG as an application on the desktop so that it is loaded every time that you click on a text file. 4. If you have TOS2 installed or one of the many replacement desktops that allow you to place items on the desktop then place the RDD3 on the desktop and you can simply drag documents to it. (I strongly recommend Terradesk for this). 5. Machines running Neodesk 3 can have the RDD installed as the default text viewer so that any docs are displayed using the RDD3. 6. (For programmers only..) Launch the RDD from your own shell using the GEMDOS Pexec function. On the command line you should pass a list of documents that you wish to load separated by spaces. The RDD3 supports the ARGV protocol for extended command lines. Loading Multiple Documents: The RDD3 has support for multiple documents in memory, in fact currently up to 200 docs can be resident at once, this is of course dependent on available memory. To load more than one doc you can either specify individual filenames or use wildcard matches, for example if you wanted to load all .TXT files then tell the RDD3 to load *.TXT. The RDD3 also understands folder structures, so to load all of the documents within a folder just specify the folder name. The RDD3 does not scan folders recursively. Compressed Documents RDD3 supports documents that have been compressed using Pack-Ice 2.40, this allows you to have an archive of compressed documents that don't eat up huge amounts of disk space. Archive Files RDD3 can recognise most popular archive formats and has the ability to perform a verbose listing of the archive contents. The current release of RDD supports ZIP,ARC,ZOO,ARJ,LZH files. To make use of this feature simply load the archive file, to bypass the automatic listing feature hold down the Alternate key while loading the archive. Pictures RDD3 has limited support for Degas PI? picture files and will only display pictures that are compatible with the current screen resolution. When a picture is loaded a document will be created with the line: 'PICFILE: ', press Alt-V to view this picture. Document Formatting Before a document can be displayed by the RDD3 it must be formatted, this is done whenever a doc is loaded. Formatting causes any long lines within that doc to be wrapped at 80 characters and tab characters to be expanded. On-Line Help The RDD3 has built in help that gives you a list of keyboard controls, to gain access to this press HELP while you are viewing a document. Main Features I'm not going to go through every feature in the RDD3 in great detail as that would take far too long and you probably wouldn't want to read it anyway, so I'll just list the main features and give a small explanation for each. Scrolling: Probably the most important feature, to scroll up and down use the arrow keys or move the mouse up and down. You can also move a screen at a time by holding down either shift key while scrolling. Move to Top or Bottom of Doc: Press Alt-T to go to the top or Alt-B to go to the bottom Goto a line: To go to a particular line press Alt-G and enter the line number that you want to go to. Find a word: Press Alt-F to search for a piece of text. You can also set up case-sensitive and global searches using this option. Pressing Alt-N and Alt-P allow you to find the Next or Previous occurrence. Load a document: To load another document press Alt-L or click the right mouse button, you will then be presented with a file selector, select the file that you wish to load and the RDD will do the rest. The contents of the Atari clipboard can be loaded by pressing Ctrl-A. Close a document: When you've finished with a document hit Alt-C to close it. Switching Documents: If you've got several documents loaded then you can switch between them in several ways: Keypad - Move to previous document Keypad + Move to next document Tab Show list of loaded documents F1-10 Move to document 1-10 Shift F1-F10 Move to document 11-20 Changing tab width: Press Ctrl-T to change the tab setting for the current document. Tab settings are stored on a per document basis. Printing a Document: Press Ctrl-P to print the current document and Ctrl-C to configure the printer. Ctrl-W will let you print a marked block. Marking a block: Alt-S and Alt-E allow you to start and end a block, pressing Alt-H will hide any block. A block can be saved to disk by pressing Alt-W, or to the Atari clipboard by pressing Alt A. Locate RDD: Pressing Ctrl-L will allow you to locate the RDD.PRG file to allow a configuration file to be saved in the correct directory. Press Ctrl-L and the file selector will appear, find the RDD.PRG file and select it. The RDD.PRG file will now be loaded and its location encoded within it. Save settings: The configuration can be saved by pressing Ctrl-S. Before using this option for the first time you must run the 'Locate RDD' option. Bookmarks: You can store the current position in a document by setting a bookmark. RDD3 supports 26 bookmarks. To set a bookmark simply press Shift and any letter A-Z. You can return to a stored bookmark by hitting just the letter A-Z. You can also set bookmarks by pressing Ctrl-B. Bookmarks can be accessed easily by pressing Alt-M. ST/IBM Characters: RDD3 supports both ST and IBM character sets, you can toggle between them by pressing Escape. Feature menu: RDD3 features a menu that you can perform operations from without using any strange key combinations. This menu can be accessed by clicking the left mouse button or pressing Insert. Toggle Text Size: If you're using a high rez monitor with your ST then the RDD3 can display a 50 line text mode, press Ctrl-G to toggle between 25 and 50 line modes. 50/60Hz: On colour screens you can toggle between 50/60Hz refresh rates by pressing Keypad *, not all monitors support this feature. Locate external editor: The RDD has the ability of support an external editor program to manipulate documents. To tell the RDD the location of this program press Ctrl-D. Execute external editor: To load the current document into an external editor press Alt-D. The current document will be re- loaded after editing. Document Information: To obtain statistics on the current document press Clr Home. View Picture: If a line with the structure 'PICFILE: ' is at the top of the screen, pressing Alt-V will display it. Sorting Documents: If you have many documents loaded into the RDD you can sort them into alphabetical by pressing Alt-O. Using this option will result in all bookmarks being cleared. Running External Programs: The run an external program press Alt-X and select the program that you require. If the current document is an executable file then you can press Ctrl-X to run it. Utilities: The RDD has the ability to store up to 20 external utilities that are accessible with a single keystroke. These programs can be set up two ways. Press Ctrl-U or Ctrl-0 to 9 to locate a utility. A utility can be accessed by either picking it from a menu by pressing Alt-U or by pressing the appropriate number key, 0 to 9. Mouse Control: The mouse plays an important role in the use of the RDD. You can scroll through documents by moving the mouse up and down and call up the feature menu by pressing the left mouse button. The mouse can also be used within menus to make selections. In fact, although the RDD is a text based program, all of its features can be accessed via the mouse. Getting Help: If you require help while using the RDD press the Help key for a list of available help topics. Exiting: To exit from the RDD press the UNDO key twice. Compatibility The RDD3 was written on an Atari 520STe with 4MB of RAM and TOS 1.62, therefore it should be 100% compatible with a similar platform. The beta testers of the RDD3 have varying configurations and have not reported any problems in the many months of testing. The code for the RDD3 does not make any illegal calls and does not rely on any special hardware being present (blitter, hardware scrolling, etc...) so should work on most configurations. If you plan to run RDD3 on a TT or Falcon then you must select an ST screen resolution as the RDD3 text routines do require this. If I eventually get access to a Falcon I shall make the RDD3 fully compatible. I have made a guess on making the RDD3 compatible with MultiTOS - if there is a 'MiNT' entry in the cookie jar then the RDD3 will resort to using just VT52 codes to draw the screen so that it may be ran in a console window. Due to Atari's unwillingness to place technical details of its machines and operating systems into the public domain I cannot make the RDD compatible with machines that I do not own or have regular access to. If Atari changed its policy of charging large amounts of cash for technical documents then the software produced for the ST (and the rest of its machines) would be of a higher quality and more compatible. The RDD3 should not conflict with any other programs that are running on your machine as it only accesses memory that it allocates itself. When RDD1 was released I did notice a problem with TurboST 1.82 when the RDD changed screen resolution, I can only assume that this problem still exists in RDD3 as the same TOS call is used - This is a problem with TurboST. System Requirements The RDD3 will run on anything from a 520ST upwards. If you plan to make extensive use of the multi-document features then you'll be needing plenty of memory. To gain extra speed from a basic ST the RDD3 uses highly optimized text routines for all of it's text output and scrolling. If you have a screen accelerator loaded such as Warp 9, QuickST, or TurboST, you will not notice any speed change at all while using the RDD3 as my routines are faster and completely bypass the TOS routines. RDD3 Program Details Design and Coding Stuart Coates Beta testers Mark Matts Keith Frisby Trev Ward Gordon Meyer John Charles Robert Darling Stuart Richards Daron Brewood Development Tools Lattice C v5.52 Devpac 3.10 Harlekin 2 Development Hardware Atari 520STe 16MHz Accelerator 4MB Ram 48MB Seagate 157N Atari SM124 Essential Development Tools Jolt Cola Infectious Grooves CDs Yngwie Malmsteen CDs Bill & Ted Videos Sega Mega CD Support The RDD3 is a complex program and therefore may contain some bugs. I would be very grateful if you could report any bugs that you find direct to myself via email (addresses below) or if you don't have email access then via my support BBS sysop Mark Matts at the address below: Mark Matts 66 Telford Way Leicester LE5 2LX England U.K. My email addresses: (preferred) Internet : scoates@filesys.demon.co.uk Compuserve: 100010,2106 Fidonet : 2:255/320.42 NeST : 90:100/101.42 Atarinet : 51:6/4.42 Official support BBS: System ST BBS Inside UK : 0533 413443 International: +44 533 413443 Times : 2200-0700 GMT Speeds : 1200-9600 The very latest version of RDD can always be downloaded from System ST first, and from Compuserve within a couple of days of release in the ATARIPRO forum. Registration The RDD is distributed as shareware which means that if you use it then you're expected to register. The registration fee is 5 pounds sterling (or US$10) and should be sent to my support BBS sysop, Mark Matts (his address is mentioned earlier in this doc). All registered users will receive a copy of the latest version. The latest version of the RDD will also be made available via various BBS's and on-line systems. If you don't have access to a modem then you can obtain a copy of the latest version by sending a blank disk and 2 pounds sterling (or US$4) to Mark Matts. The RDD may be distributed freely by any PD Library or BBS but may not be used on any magazine cover disk without permission from the author, any magazine failing to comply with these restrictions will have action taken against them. Disk only magazines are free to use the RDD without the authors permission on the condition that a copy of the relevant edition is sent to Mark Matts in advance of publication. Why no direct support? I'm not publishing my current address as it is currently changing every few months and this would result in some correspondence being lost. Mark Matts has offered to handle all registrations and correspondence on my behalf and will forward any bug reports direct to myself. I do have several email addresses available if you do require to contact me. Future plans for RDD: The RDD is undergoing continual development, some of the features that are likely to be included in future releases are listed below. If you have any suggestions for additional features then please contact either the author or Mark Matts. Future features: Support for non-ST screen resolutions - including all Falcon/TT modes and third party high resolution boards. Greater support for picture files - really dependent on user feedback - do you really need a doc displayer to display pictures? Support for MultiTOS / MiNT / Geneva - background printing and document formatting. Full support for the Falcon 030/040 including the DSP - just imagine the scrolling speed that this would be capable of - need to get my hands on a Falcon! HWHORLEDWICKLOWWIDGEONWIDOWEDWIDOWERWIELDEDWIELDERWILDCATWILLINGWILLOWYWINDAGEWINDBAGWINDINGWINKINGWINNINGWINSOMEWINTERYWISEGUYWISHFULWISTFULWITHERSWITHOUTWITLESSWITLINGWITNESSWITTILYWIZENEDWOBBLEDWOBBLERWOLFDOGWOLFISHWOLFRAMWOMANLYWOODC. `j.. ACC_FOLDPRG kBACC_FOLDTXT l[`8(oO:3 /<?<NA\?</<?<NNAPJ@fTy ?<ONATJ@g3  09 f3` 3B?< NA\O/ x#!?< NA\O&, ּ֬֬Hz?< NA\OBg/?<1NAJ"z#Nh g O\0|Ng29JAgJ|=gL|Kf>0N:$P"|2<Jg&Jg"fQ 3  3"yN$PJgV<.g`"|2<Jg@Jg<f6Q$P"|Jg` Sy 09 n 3N2 Accessory V1.0 by |\/| | |urray Levine \*.ACC\ACCS\*.ACC\ACCS\  > EQUACYADEQUATEADHERENTADHESIONADHESIVEADJACENTADJUSTEDADJUTANTADMIRALSADMITTEDADMONISHADOPTINGADOPTIONADOPTIVEADORABLEADORABLYADROITLYADSCRIPTADSORBEDADULTERYADVANCEDADVISORYADVOCACYADVOCATEADVOWSONAERATIONAERIFORMAEROFOILAEROLITEAERONAUTAESTHETEAFFECTEDAFFERENTAFFIANCEAFFINITYAFFLATUSAFFLUENTAFFORDEDAFFORESTAFFRIGHTAFFUSIONAGGRIEVEAGITATEDAGITATORAGNOSTICAGRARIANAGREEINGAIGRETTEAIRBORNEAIRBRUSHAIRCRAFTAIREDALEAIRFIELDAIRINESSAIRLINERAIRPLANE *********************************** *** Accessory v1.0 *** *** *** *** by *** *** |\/| *** *** | |urray Levine *** *********************************** Accessory (ACC.PRG) is a program that will let you load all of your accessories out of a folder called ACCS on the boot drive instead of loading them out of the root directory of the boot drive. This helps to keep your main directory less cluttered especially for hard drive owners. Just place ACC.PRG in your AUTO folder or add it to your STARTUP.INF script file for STARTUP.PRG. All accessories will now be loaded from the ACCS folder on the boot drive. They will also get re-loaded the same way after changing resolutions from the desktop with a color monitor. Chances are that this program will not work with any of the accessory loaded programs, but if there is any interest in having it do so just send me Email to either of the following ID's and I will try to enhance to program to work with these other programs. |\/| | |urray Levine Compuserve ID - 74435,1015 GEnie ID - MURRAY ROVEDAPTEROUSAPTITUDEAQUALUNGAQUARIUMAQUARIUSAQUATICSAQUATINTAQUEDUCTAQUILINEARACHNIDARBALISTARBOREALARBORETAARCADIANARCHAEANARCHAISMARCHDUKEARCHIVALARCHIVESARCHNESSARDENTLYARGONAUTARGUABLEARGUMENTARIANISMARIDNESSARMAMENTARMATUREARMCHAIRARMENIANARMINIANARMOUREDARMOURERAROMATICARPEGGIOARQUEBUSARRANGEDARRESTEDARRESTERARROGANTARROGATEARSONISTARTERIALARTESIANARTFULLYARTICLESARTIFACTARTIFICEARTISTICARTISTRYASBESTOSASPERITYASPHODELASPHYXIAASPIRANTASPIRATEASPIRINGASSASSINASSEMBLEASSEMBLYASSERTEDASSESSEDASSESSORASSIENTOASSIGNEDASSIGNEEASSONANTASSORTEDASSUMINGASTERISKASTERISMASTEROIDASTONIEDASTONISHASTRAGALASTUTELYATHELINGATHENEUMATHENIANATHLETICATLANTESATLANTICATOMICALATOMISERATROCITYATROPINEATTACHEDATTACKERATTESTEDATTESTORATTITUDEATTORNEYAUDACITYAUDIENCEAUDITIONAUDITORYAUGUSTANAUGUSTLYAUREOLEDAURICULAAURIFORMAUTARCHYAUTISTICAUTOBAHNAUTOCRATAUTODYNEAUTOMATAAUTOMATEAUTONOMYAUTUMNALAVERMENTAVERSIONAVIATINGAVIATIONAVIONICSAVOIDING. #`n.. DCMAXTRKDOC po$ DCMAXTRKPRG prtDC MAX TRACK v1.0 (FREEWARE) DC MAX TRACK v1.0 is Copyright (c) 1990 Double Click Software Program by Keith Gerdes and Michael B. Vederman You may copy and distribute this program freely just so long as you do not charge for it, or alter the contents of the program or documentation. ============================================================================= Have you ever wondered how many tracks your floppy disk drive can format? Wonder no more, DC MAX TRACK will tell you how many tracks your floppy disk drive can handle. ============ INSTALLATION ============ No installation required. DC MAX TRACK comes fully prepared from the factory. ================== USING DC MAX TRACK ================== >To use DC MAX TRACK, do this: ------------------------------ 1) Execute DCMAXTRK.PRG from the desktop. You will be presented with a dialog box containing the following buttons and displays: DRIVE A: - selects testing of drive A: DRIVE B: - selects testing of drive B: Test It! - begin testing the designated drive Maximum - displays the maximum number of tracks on the disk thus far [Operation] - displays FORMAT, WRITE, VERIFY of current track during test 2) Click on the appropriate drive select button. 3) Click on TEST IT! to begin testing. NOTE: Make sure you insert a floppy disk in the drive you want tested. This floppy will get formatted and written to from track 75 and up for the testing. 4) The current track being FORMATTED, WRITTEN and VERIFIED will be displayed. The maximum tracks on the floppy will be displayed directly below. 5) When testing is done, you will see the maximum number of tracks this floppy disk drive can format. NOTE: This number represents the maximum tracks, not the maximum track number (84 tracks = tracks 0-83). DISCLAIMER: Double Click Software can not be responsible for any consequential damages caused to your disk drive by using this program. (We haven't run into any troubles, but your disk drive might be sensitive.) 100% Assembly ================== COMMENTS WELCOME ================== As usual, we would be EXTREMELY glad to hear your comments and suggestions for enhancements to this and any other of our programs. - mike and keith We can be reached at: Voice: (713)977-6520 Online: The DC BBS: (713)944-0108 / 300-1200-2400 baud / 24 hrs GEnie: DOUBLE-CLICK (CATegory 30) CompuServe: 75300,577 (go ATARIVendors, area 13) Usenet: uace0@menudo.uh.edu LISECIVILITYCIVILIZECLADDINGCLAIMANTCLAMANCYCLANGOURCLANNISHCLANSHIPCLANSMANCLAPPINGCLAPTRAPCLARINETCLARSACHCLASHINGCLASSIFYCLAVICLECLAYMORECLEANINGCLEANSEDCLEANSERCLEARINGCLEARWAYCLEATINGCLEAVAGECLEMATISCLEMENCYCLERICALCLERIHEWCLERKESSCLEVERLYCLICKINGCLIMATICCLINCHEDCLINCHERCLINGINGCLINICALCLIPPINGCLIQUISHCLITORISCLOISTERCLOTHIERCLOTHINGCLOUDILYCLOWNISHCLUBABLECLUBFOOTCLUBMOSSCLUBROOMCLUMSILYCLUTCHEDCLUTTTERCOACHBOXCOACHDOGCOACHINGCOACHMANCOAGULUMCOALESCECOALFISHCOALMINE`h 1``H DCSquish-DCMAXTRK12(zC<"EM.ަG"K<:t QJ g"JbfJg 6 B+ Uan*OK4dD`X .G/Hl?<HNA\Jg*@/?<IGra:NA.o Gp?BQp|ep:"M$IApr"QNHyLNA(Hz?<&NNz@bA2gA X`f??<>NAz/ ?< Nq .DNuAC C C CF C Ch MLa"A0*AI(aM:A(a`pA0000BPA"0<NBNu # x0(Nu&n$M0<g4Q~xvtpkg4 g 2iT@`Q`2ifP@R@ JQ`Ab"HpQ.O/?< Nq .G,n A(HC$I&I.ސ>Jhf2"g*rђgfE` N2AgSA0QSGL&^H&^L&^H&^ L&^H&^@L&^H&^`L&^H&^L&^H&^L&^H&^L&^H&^AQEt$"$ЁQJEgnCD*@|e*jg"@r g g> MS@$&(*,.$A&A(AH8H8H8H8H8H8HxQ`bAN` 0@A oOC @@!/ /HyJNAO p a"3 #@ A a apM@ B p A\0Q0@LpB\pN@4a@D@ p@@lLAl@LF z"@|f @`@f BCD\a<@B ~L8H@#@3A\p2@pX@D g(?v@0YC8a.02A@. r@`APDP@NuC ar z??p B2zvJ@p@"!0p ?SC zp aRF`$@Na0@Bpa:Nu"R t0HA@r/`n&Nu@0 vpfJgB6VNu@ NMX@z @&NN\Nu08Nup`pb#"p L&pL*pEA .pN2@zrp6`<<@ltp@@`JLNu3\ ^3@(`bDd3@f3@h3@j3@lp3@dCvAjBtBbCZ0E 4(Cg0E(f4`6Nu&z @@&SNutDƜB^B`BbBdBfp*@` "Hp0(#@JA@gS@ә@g"Ht@ B$E 6(g"H@( $It0)gd@g^@gXө @ gN@gH@ gB iBg(gA"gA> f ӐӨ@`@.fӐ`@ f GHp`#ʣ4bpr`&LCRBBfnNuBANu# C C 2@ `d A$p2@@2BQ"< j0<NB0: By@@` @N3@ @fBB" p`*pd3 @`C:De@ pI `p`pwFdB 0:@x`@DB$@@@pC`@ p`p `d@ vg2Rj(@DA<p@.EDpg@jEhDr@Vp`p@DAabBA.`|L@`h@A8DRD8`:`JHBVp`6N`"LX`pKBp ``pr tpbJp `kxp @<hFAp@TL(@@Lq@,eTCbp@L.`FCl@L(@PVp@bxp@R. @L\k@zL @fL@RL@>Lj@*L'@L(@L`L@Lh@Xpp@ cm@H|py@dn@Di@Dv@VLz@B{@0J|@J}@ J~0J@I@Lf@lj@JN#@J$@J%@vJ&@dB 4B@UAcE`@ AtBq@!IAIMJ@`@W@`;@@ V=2S @AAAA}Bca&@DMCB@CC`d@@@0\B bA$ , A $A+   @! @"B @ A@)@ FCC@@HA9@G@AMAQ@BQC BI@|`bAUSERDIGGINGSDIGITATEDIGITISEDIHEDRALDILATIONDILATORYDILIGENTDILUTIONDILUVIALDILUVIANDILUVIUMDIMINISHDINGDONGDINOSAURDIOCESANDIORAMICDIPLOMATDIPTERALDIPTHONGDIRECTEDDIRECTLYDIRECTORDISABLEDDISABUSEDISAGREEDISALLOWDISANNULDISARRAYDISASTERDISBURSEDISCIPLEDISCLAIMDISCLOSEDISCOUNTDISCOVERDISCREETDISCRETEDISCROWNDISEASEDDISENDOWDISFROCKDISGORGEDISGRACEDISGUISEDISHEVELDISINTERDISJOINTDISJUNCTDISKETTE. (`v.. CRASHER PRG ZQ%wLEONARD6PRG \Q%yLEONARD6TXT bQ%{g` /<8?< NA\OB?< NA\O#42<a?<?<NMXOJgBgNA0(@| xN8`"x im|`|C|fCd0< |n0<@o2G<<;8;pT4$H6|:;p&0QTIQĒQp JQNuPP@@@~?c9=k=k|c<8<>>??c9qkuku c191 <13s]{ w]{1  B>Fg~%^<~&W|?8/0_*Ez? @??<?>??c9qkuku c191 <13s]{ w]{1  B>Fg~%^<~&W|?8/0_*Ez? @??<?((HH:n:m : n:l@A#|L"N@6|H80:A"z2QL8F6Nu3R#TNuHy?<&NN\JfBJ9 fHy\?< NA\`Hy}?< NA\Hy?< NA\?<NATBgNAT?<Hy?<=NAP3 klHy /<?9 ?<?NA SM26 f6Hy /< ?9 ?<?NA fA C"""?9 ?<>NAX?<?<NNXм#L?<?<NNX @м#`#d?<"NNTм#Hy?<&NN\Hy?<&NN\ 9g< @ g62JX_VDOf3 ye3^3X#ZHyN?<&NN\Hy?< NA\?</<?<1NAP#Nu :м @#J(f@|J(gF` |FNuaB9 B xV08TS@"g .b "A SM26fP BNu#JQ08F9Nu y Nu CSilkMouse cannot install.  CSilkMouse already resident. CPress any key to exit.... p C SilkMouse 2.6a installed q A:\SM26.DAT  6    " X        "&ANCINGPRANDIALPRATIQUEPREACHERPREAMBLEPRECEDEDPRECINCTPRECIOUSPRECLUDEPREDATORPREENINGPREGNANTPREJUDGEPRELATICPREMIEREPREMOLARPRENTICEPREPAREDPREPARERPREPENSEPRESAGERPRESENCEPRESERVEPRESIDEDPRESSBOXPRESSINGPRESSUREPRESTIGEPRETENCEPRETTILYPREVENTSPREVIOUSPRIESTLYPRIMEVALPRIMNESSPRIMROSEPRINCELYPRINCESSPRINTINGPRINTOUTPRIORATEPRIORESSPRIORITYPRISMOIDPRISONERPRISTINEPROBABLEPROBABLYPROCLAIMPROCUREDPROCURERPRODIGALPRODUCEDPRODUCERPROEMIALPROFANERPROFORMAPROFOUNDPROGRESSPROHIBITPROLIFICPROLIXLYPROLOGUEPROMISEDPROMISERPROMISORPROMOTEDPROMOTERPROMPTEDPROMPTERPROMPTLYPROOFINGPROPERLYPROPERTYPROPHECYPROPHESYPROPOSALPROPOSEDPROPOSERPROPOUNDPROROGUE`NqM#+#,+ f& n A O//Bg?<JNAO `O+3#+A0<"< QBBBgNBNA#vNA/:Nu#vNM/:Nu#vNN/:Nu 9+Nu y+ <t"`JJnf0. @HмH @"n " nf"0. @Hм @ м @"n "N^NuNV``N^NuNV``N J@l"/<?< Nz\O?<?<LNzXOJyg/<?9,N \O32` BN XOazJyg&/<2N "XO y(2f092ְy2f/<?<&N\OJy2ga`aJyfN N^NuNV`8`By269T&yV X @#2J2g 2 y2 SM26f32SCJCoJy2gJy2gJy\f9G93\LN^NuNVH`v`V/<2BgBga4PO/<2/<2/<2/<2/92N ^092Hy232092Hy2323232?<NnTO?92?92?92?92?92?92?92?92BgN N?92?92?92?92?92?92?92?92?<N N?92?92?92?92?<Bg/92N  y2J(f6<`2 y2,(6<l6<wl6<l6<?aTO y2B@( `6<`6< `6< `` J@g|g`?aTO y2J(g6<`6<?aTO y2B@( `*6<-`* y2B@( `6<+`6<,``J@g``J@g`?aZTO y2( H` 6<'`26<&`,6<%`&6<$` 6<#``J@gܰ|gܰ|gܰ|g`?a TO y2B@(86<|l6<|l6<|l6<|l6<?aTOBg/92N 2\O:0`: y2B( ` y2| y2B( ` y2| y2| ` y2|d y2| ` y2| y2| ` y2| y2| `r y2| y2| `V y2B( y2B( `> y2|`. y2|` y2|` y2| ` y2|` y2B(` y2|` y2B(` y2| y2!|.` y2| y2!|`` y2| y2!|`h y2| y2!|~@`J y2B( `< y2| `, y2| `Bg?<aXO|f"?<?<aXO|f?<?<aXO?aTO`?<?<atXO|f?<?<a`XO?aTO`?<?<aFXO?aTO`?<?<a,XO|f?<?<aXO?aTTO`f?<?<aXO?a:TO`L?< ?<aXO|f?< ?<aXO?a TO`?< ?<aXO|f?< ?<aXO?aTO`?< ?<aXO?aTO``Ұ|mʰ|0nY@H {N     DRp  &4    Nj f  2 8  $|/fa?92?92?92?92?92?92?92?92?<N N?92?92?92?92?92?92?92?92?<N NBgNnTOLxN^NuNVH``:?<?<?92?92?92?92Bg?./92NN^NuNV``8?<Bg?92?92?92?92Bg?./92NN^NuNV``RBC| lBBgBg?92?92?92?92Bg0@Hм^ @?/92NRC`LN^NuNVH``/<?<N |\ON^NuNV``.Hn?. ?<aPOJ@g/.?.N |\O`N^NuNV`A+"Hpr2QC!IC"!I < ` <N <AN <2CAN <5` <3 CNNV <6tANrC N <4CAN  ?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrst03 #                 !   )"(#$%& '( !!/*.+",# -$.%)&0u %vSMCD.RSC-+,.#$%&'(  0/A:\SM26.DAT SilkMouse [3][SilkMouse 2.6 (SILKMOUS.PRG)|has not been installed.][Cancel] SMC does not run from AUTO folder: use SILKMOUS.PRG instead. [3][Registered users are sent a |version with a SAVE feature. |To register send $10 to:|SilkWare, 609 Church Street,|St. Johns MI 48879][ OK ][0][RS232 and MIDI input. The|"Buffer" setting is more|selective, but cannot report|activity when a program uses |a custom RS232 input buffer.][ OK ][0][WATCH MODEM is effective only |when the screen saver is on. |It restores the display when|modem input is detected.|"Port" is affected by both][OK| More ][0][dims, then goes out. (In|mono mode the display inverts|instead.) Touch the mouse or |any key to restore the|normal display.][ OK ][0][SCREEN SAVER extends the life |of the monitor screen by|preventing burn-in. After a |given time interval where no|input is sensed, the display][OK| More ][0][FUNCTION KEY GUARD prevents|phantom keypresses from being |reported to TOS. This|corrects for a widespread|hardware bug.][ OK ][0][This adjustment has no effect |in ST LOW resolution.][ OK ][0][The RESOLUTION CORRECTON|adjustment determines the|miniumum physical mouse speed |that will produce resolution-|independent pointer behavior.][OK| More ][0][For information on a specific |configuration option, click|on the  symbol next to it.][OK| More ][0][SENSITIVITY determines what |physical mouse speed will|produce full acceleration.| |A is slowest, E is fastest.][ OK ][0]["Partial" and "full" are |identical except where the|screen size is in excess of |640x480 pixels.][ OK | More ][0][When applicable, the "full"|setting preserves complete|resolution independence, but |there is better small-scale|control under "partial".][ OK ][3][Register SilkMouse 2.6 by|sending $10 to:| |SilkWare, 609 Church Street,|St. Johns MI 48879.][ OK ][1][SilkMouse 2.6 from SilkWare | configuration utility| 1992 Mark Slagell| | unregistered version][OK| More ]ExitofffullpartialMouse AccelerationEDCBAGearshift sensitivity54321Resolution correction thresholdonoffFunction key guard301051offScreen saver (minutes)portbufferoffWatch modemfrom SilkWareINFOFOR FREE DISTRIBUTION SilkMouse 2.60  4z (            :62ND           v  &  " " 20<H :&RTARICTARTARUSTASTABLETASTEFULTATTEREDTAWDRILYTAXATIONTEABREAKTEACHINGTEAMSTERTEAMWORKTEARAWAYTEARLESSTEASPOONTEATOWELTECHNICSTEENAGERTEETHINGTEETOTALTEETOTUMTEGUMENTTELECASTTELEGRAMTELLTALETELLURICTEMERITYTEMPEREDTEMPLATETEMPORALTEMPTINGTENACITYTENANTRYTENDENCYTENDERLYTENEMENTTENSIBLETENTACLETENTPOLETEPIDITYTERAPHIMTERMINALTERMINUSTERRAPINTERRIBLETERRIBLYTERRIFICTERTIARYTESSERAETESTATORTESTICLETETHEREDTETRAGONTETRARCHTEUTONICTEXTBOOKTEXTURALTEXTUREDTHAILANDTHALLIUMTHANEDOMTHANKFULTHATCHEDTHATCHERTHEATRICTHEISTICTHEODICYTHEOGONYTHEOLOGYTHEORISETHEORISTTHEORIZETHEREFORTHESPIANTHEURGICTHICKISHTHIEVERYTHIEVISHTHINKINGTHINNESSTHINNISHdsd26 SILKMOUSE֨X֨X֨ ""h U@"$Accelerator`&bN`#EdN yEdJhg p`` yEdJhfR yEd h/<;b/<;6/<#/<#/<#/<#/</<$/<.^?< BgBg?<N,#EhBElBEpBEtBExBE|BEBEBEBE <Eh`N^NuNV`*`=C`6S`|Xm|xn|XH {NT`$0L8xN^Nu<<`~?< / JFgP /N JFg8I?.?..H?.H??/ /. /.N@`I`0H`|.H?/ JFg* /N JFgI xf/ / NbPO`p0`|`<<|0=|=||`` LTABB.| `:*TI`` NVH&n(n *n.8.BE/ NBXO< -fz ng no<.Fl8:FJDfJFgJJnf0JDg,JFg Jg .0fBSF/ H?N\O`.SD`JFgJf`.SD`0L8N^NuJgRF`NVH&.&n 8.(KH//NPOмDx @H//NPO&JbB/ NXOLN^NuNVH&.&n (KJl - D&?./ /a LN^NuNV?./. 0.H/aN^Nu opRJgRJg RJgRJfNu o"HrAtZgmn( ` Nu o"H JfUo S`Nu /"/ C4&HCH@ЃH@B@Ђ&Nu /jD"/jD /aBJ/jDNu /jD"/jDa& J/jDNu /"/aNu /"/a NuJf <"Nubg"BNupBNufBNubH@B2B@H@NuLjb"$BBHBB6HC4"BAHAB0ЃLjNutBdԂҁjbf" LjNu o JfS` o "og ggfNu#NA/9NuDpDoDnDkDjDiDfDeDdD]D\D[DVDUDTDBDAD@D3D2D1D-D,D+DDDD D DCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC~C}C^C]C\C@C?C>C;C:C9C!C CC C C CCCBBBBBBBBBBBBBBBB{BzByB]B\B[B?B>B=B!B BBBBAAAAAAAAAAAAAAAAaA`A_ADACABA?A>A=A!A AAAA@@@@@@@@@@@@@o@n@m@j@i@h@O@N@M@/@.@-@@@????????????????}?|?{?]?\?[?>?=?<?#?"?!???>>>>>>>>>>>>>>>>>~>}>a>`>_>A>@>?>$>#>">>>>>>> > > ================m=l=k=S=R=Q=N=M=L=0=/=.===<<<<<<<<<<<<<<<?@ABCDEFGHIJKLMNOP QRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      B  @       @         @  @ @ @Q @ @@Q@@@ @Q @` C         C      C       ! " #C   $   % & ' (  ) * + C   ,   -./0 1 2 3C   4  5678 9C   :   ;<=> ? @ A BC   C D  EFG H I J  K C   L M  NOP Q R S TC   U   VWXY Z [ \ ]'0:EPYeq}#^SMCPXD.RSC  "&"    J( "   0"   0<"&:T 2 n*64 :TISEDOGMATISMDOGMATISTDOLEFULLYDOLOUROUSDOLTISHLYDOMINANCEDOMINICALDOMINICANDORMITORYDOUBTLESSDOUGHTILYDOUKHOBERDOWERLESSDOWNGRADEDOWNRIGHTDOWNWARDSDRACONIANDRAFTSMANDRAGONFLYDRAINPIPEDRAMATICSDRAMATISEDRAMATISTDRAVIDIANDREAMLANDDRENCHINGDRIVELLERDROMEDARYDRUIDICALDRUMSTICKDUBIOUSLYDUCTILITYDULCITONEDUMBFOUNDDUMPINESSDUPLICATEDURALUMINDUSKINESSDYNAMICALDYNAMITEDDYNAMITERDYSENTERYDYSLECTICDYSPEPSIADYSPEPTICDYSTROPHYEAGERNESSEARLINESSEARNESTLYEARTHWORKEARTHWOR. Q`.. LOAD_DSKPRG ]/`w,o . ЮЮмwf#Hy?<NA\HyN?<&NN\(yG?<HyD?<NNAPJf 9̰:k|?<Hy?<=NAPJ@kd>/ /9:??<?NA ,??<>NAXJk::f009BSf$ 9:ѹA)HA""T":RyBR9H09B f@A޷g23BHy@?<-?<NM#NP?</9?<1NA?<NA xk3#` #>NuHR6*A(y&U,OayBg3B3 @jl3333 yg I>`IJg"3###a yf CsfL$xj x yg kAt2\PWf$hN$m3`$m3`$m3`|$m3`n ygb ygV4, yfH yf<4,yf. Bg4,yf$mA Q 3 LRA"` Sf yf yg#3` 9fLRNs Cf3At2\PWfv$hN3 yf\ ygP3`D3aH`43`(3` m hf3`LR yJN/,?<NN\Nu?<NNTNu0 g2 of( of |g#J!| yNNCopyright 1987 by Computer Fenestrations, Lake Monroe, Florida, USA. All rights reserved.mtt@@((((r t 2*zi}"*.PI1 &        $        >`EHOODFALSENESSFALSIFIERFANATICALFANFARADEFANTASTICFARMHOUSEFARMSTEADFASCICULEFASCINATEFASHIONEDFASHIONERFASTENINGFATTENINGFATTINESSFAULTLESSFAVOURITEFAWNINGLYFEARFULLYFEATURINGFEBRIFUGEFEBRILITYFECULENCEFECULENCYFECUNDATEFECUNDITYFEDERATEDFEELINGLYFEIGNEDLYFELONIOUSFENIANISMFEOFFMENTFEROCIOUSFE`D&`,oL?H?&oO + // Bg?<JNAO B M?<NNTJ@g(`CNC!,nHV?< NA\?<?<NMXBgNAB?< NA\L@H*!N!N .и@B!Bx( B8``^~M*n,nLHJAR!   Hz:?<?<?<?<NNO `N?08(S@B9!0NuHAJC@""""""""LB9Ns`~~M nGLH@ xat xalK8(UG`><z QQQ`>HA hTC@""""""""LNu4<BBBBQNu`}~M nHPpNF _A!`~?<%NNTR M!$M ,-@??>ߕj$?UWU?As<P~UP QQ? LW<U]U?_ML=T_UDUwW?_ed3TuUUP?!p>#wEU_F]?U_qp#TU_|UT@*?)x/Uk<@Uw?U_yx/tU_?w?UQUUVEE?U_}|?#_}???T@@* @@*?"}|?UOj?~WU?U_}|? U_P??uU ?u}|?U_Gj?j* *?|??U?Q^z?* UWVUW~?|??_w?uU?|ހ?UUj?꪿@?UUVUU?|????_**?`տ@?U@ *??E?UUz?0@?  UU`UUU]U]P] Up"U@U@""U@U@*TT**:P**`EU_ EUEU UWUWUW|W}UwUQuUuUuUuUUQUQUUUUU*TT**T*@" UU EUEU WWWUUUUU]UUuUuUuUUUUUuU UWUUUUU UUUEU_UUUTLUTT@**T@T@UUUwUWQ UQUQUUUUuUuU UU UwUWUWEUEU_EU_UUD *UDUTUTT@@*UU"@@"*UW@MUUߪ U]U]UwUwUWUw UUUPUQUQEU_U]UUEU#U*UTU@""UDUT@"UUDD*W*UUUU]U EEU_U_UWUWUUUTwwqUUUU UUPPUUQQWUUUU]wUwUwD*T@T@" UUUU]UUUUߪ UWUUWUTUUUUQUuUPUUuUQuuUPUPwwwwUUWWUUEU]UU_TUUUUPDUU@""UTT@T@*"UTUT"EUEU]]DU UUUUgnfDfDssUUww EU]U UUU]]2f@f@ssUUD**U@UTU@"UU*DD"JJssEEUUUU TwUWUwUWwONsuUUUUuUP]UUEU]DUUUpƏ9p?sUUD**UTU@ UT*UUUDUD"* "UUU_U_ ETWUwUUwUUWvuUUQUUUUUU uuUQUQUUWWTUEU]EU]EUUT]]UUTD""UT@UT@(UwUWUUwUTUUUU]UUUUPuUPTuUPuUuUUUUWUWwwUTU]UUUUUDETUUUU]TD""UT@T@"TU"T"UU"UTUT@@ EUEUU]U]EU\UUuuUUUUQQ UUUUWWU|UU UUEUU_DDDDL**UT@UD*T*UD*UU*UDUDDD DDEUEUUUUU UUUwUwUUUw UUUUUUT UQ wUwUUUUUUUUUUUUwUwUWT*@*"UU*UUUUUUUUUUUUYUUUUUUU" UU_UUUwUUUWsuUUUQUUUUuUQwuwuUUUUUUUUUUUUYUQUWwWwUWUU]EUUEUUUU""U"*"*UUUUTDUD"UT@UWUWUUUUUUU]UUUuUUuUQUUPwwwwwwww{wUUUU_EUU]DDUUUUUU]TDDUUD@*U@"UT@" UU]UWUUwUUQUUUuUQUU]DUUUDD@UUD*UDU"T@"*"UU]wUWUUWwwUUUQuUUUUQUUw*"UUD" ccDUU]UwUUwUuw׌||ccwwwUWUQuUUTUUUx||ccǪ㮈UUU]UU] U | |b#b#xx]_WTD"UUDT*U"UT@||``xx'EUU] uUUUp||``LjUUWUU]UUU]pG}aa}U_G"*UU@UT*U*UTDp8EUUU "UUwUUUwuUUQUUPUU]EUU/U?pqUUUT@UT@*U_ ``?}w*_"UUwUUQqs||cc|uUUQUUQ__uw׈(|"cn__ww*UUUEUP \ |cc.UTDUT@UUWQUTt|cccwtwc㎎qqTQuUUUUUw((||]"c UW]*__wTTT EUU]DAU @`TUP @UT@UTUTUT@@@"_׀(NuXUnUn +aa WKhhUnUn( `` ` XvhUnUn `` `$$$NuG@f(|>9f|H>`9 f|+>J+>fJ@g:+?ea J+>g:gJ+Ng0S+GfS+Ng"zGz}<:u+:dAaAaA*a+NAa7@L@zP:L drAAa7@L@z(:$ drAAa7@L@z: drA zJ+@g0kzz:&fz+ +zJ+Ag.zzz:fzn++z_J+Bg.zOzH:fz:+$+z, +?@F'BJHfJ+Hf4 J+If4 J+Jf4l] R$9:5F`HGQ>BkB+ |?`@F'9?  FNuGJ+DgP>Nu Z z n "  B t YFzG`Y9`YY1| `XQD`p`B0( 4hT@Jsf4hp2s1@ `(/:/@=P`(/8:@=Q`(/ :+=P`rBhYY`^YE`XY.`R`DY*Q)Y+|@,`0B(,`*`"B(`NP-`Q-`S(f|B("hpk@J(g@;$h$!J R(Rhh!IJ(-g.J+@g+g J+Ag+gJ+Bg+gP-Nu(fNu(gR(NuS(Nu<eX e0e4d@Ez4r!J!J`B @9`6R@`,@E t4r!J$b`@@E4rN~(g$S(dh$h *kR @(h((:C(."hg"h!ICr0(,g\() (+gf*f(*d,r`(*e,A+ dAeIdA Gg$(SfBF(jFh1FF`D :sf:g C<<:9(/(-j(-(/8F|<C(Nu> ? M / gaw GGp0S#}Y8{eQ>, ~wpjd^YTOKGC?;852/,*'%#!"%(+-/135   hvT@)HHHHoooHooo5;;;I;;;;;;;;;I;;;I;;;;;IRRRx;;;;;I;;RRRx;I;;;I;;;I;;;I;;;I;;;I;;EEEdEEEdш  Ќ($ъ Ќ($ъ Ќ($ъЌ($ъЌ($ъЌ($ъ Ќ($ъ Ќ($ъ Ќ($ъ Ќ($($ъ Ќ($ъ Ќ($ъ Ќ($ъ Ќ($ъ Ќ($ъЌ($ъЌ($ъЌ($ъЌ($ъЌ($ъ Ќ($ъ Ќ($ъ Ќ($ъ Ќ($ъ Ќ($ъЌ($($ъЌ($ъЌ($ъ ++00)++0’00000000222222220000000022ևшѐ ԑ///20/+(+-//20/+///20/+(+-//-/+///20/+(+-//20/+///20/+(+-0/-+&(++747497474972729;97474749747497272927;;74 ѐ    $$$(+(+-+-+-+-+-+-+   Gܲ<fjQ@H@A0pp C^QzU7zP$+fzC*zEzA:8H@E4r'J'JR,|@Nu<fjQAH@A"0pp CQz7z&+fz*zz:H@E.4r'J'JR-|ANuQBH@A0pp CQz7z(+fz*zz:H@E4r'J'JR.|BNuNuGavJ+@kgaJ+AgaJ+Bgax`J+fJ+f Q@B+NuS+J+f4J+fJ+gdS+z:g:2:A%:A$S+:g S+f@J+gj 0:k$`0:k$+fz*S+f"zy$z~j <f$zl'J@,NuJ+fJ+f QAB+NuS+J+f4J+fJ+gdS+z5:5g:y:'A':A&S+:g S+f@J+gj 0:k&`0:k&+fzG*S+f"z$zj <f$z'J@-NuJ+fJ+f QBB+ NuS+J+f4J+fJ+gdS+z:g::A):|A(S+:yg S+f@J+gj 0:Xk(`0:Nk(+fz*S+f"z9$z>j <f$z,'J@.Nu*8FTbp~ @c?2 cB)0c `cAccc2c( ( Z  "("c#c2ccc*:RTj{            :H8  :Nu䙵GB@`;FXk                  Nq@@@@@@@@@@@@@@@@@<<888888 HaVLNuHaRLNudNuB9dHa8a4LNu` ``~` AB`M K - O- |- aNu?a0@CtEG2@A@A I0K#M0K%M0K'Mp@@@@@@p@@@@@@@@@A #H%H'HAOpr t<PfQp@@@ANuaA~JgC))8)ZfCH?<?gNuM2I~aM@Ia MNIabJ,gS,g)l B,`l| lj<<fX`<fB,Nu<l @`@lCiC`B,)HAH@00A)H` l S,gJja~)H NuJjapJ,g`Z<gR<~f O`, @H@C>1,@ |F)H *l.f`VX)H Nu<n@lC1C 5)INu<f@Nu<l @Nu<gFVHNu.f8, j0?f Nu~, f.S,fS,g l)HA,`FA #, H@Jk, f|Nu @R@)H,H@A=pNu $@|-M=G=Fm -dR@ mmBn It.m .g..g..f Al-HFNuAC   BPFNuACI?B B BAB(AB(AB(NuIMaMaMaACM0.n .gHM0.n .gHM0.n .gH :4 :B :PNu..fNu*nJng ngSna.fz nN-.k -.nmA-HNu-.k -.mmA-HNuJnfA-HNu-.jB..NuJnf`. g <g S. f0.n S. f -gjP Nu@ DnNu M / haw GGp1S$~Z8{fR?- wqjd_YTPKGC?<852/-*(&$"           !!#***((('''%%%***(((&%&(&%!(1* >>?"~~~~~~~~~~~~|~|~|?@||~~||||x @|~~|~|:Dz~|~|||||@???@ ||~||~~||::DD||~~||||?@||||?@||||||~|?@|~|~}};D||~~||||x@???p |||~~||~~|?@||~~||||>x|@x<|x<|x<|>|x<@|>x<~~~|~~~||~~||::DD||||||||||||~~||?@|~|~~~||~~||::DD||~~|||||@???|~|~|?@||||||~|?@|~|~~~||~~||::DD|~||x||~|@?|?|?|~|~~?@||x|x||||||~~||?@|~? ?||||||||@???@     ~~||~~||~~~~||~~||::DD|||||||||@???@|>@||x<|@|>x<@|>||>x<||>x<3H$@?  @|>@|x<|@|>x<@|>|}>y<|}{3H$~~|~||~~~||~~|?|? ?@||||||||||||~~||~~||~~||~~|?|?      x@@ >@>?>xx>x ??@@}~~||@???@@@@@@@@@@8 |x|; xx|x`|``  |?? |>    ` xx @     @@``88pp88<>    @?p `         @ xxxxyyx~|~xx<4BHxxxxxxxxxxx?? @@?@?@8@@@@| xx|x@@0`>  xxxxxxx ??`?yy0I x?|x4Hxxxxxxx??  x|?@xxxxxxxxx?? 8xx`  >> ? xxxxx|8|?? 8pxxxxxxxxx??  xxxxx|x|?x4H<x ??0 ?1!1111#$1 "&'()*+,-./0%1111  HELLO, THIS IS JAMES L. MATHEWS AT THE KEYBOARD. I HAVE WRITTEN A COUPLE OF INTROS FOR A.W.F. PDL, ONE OF WHICH IS ONE THE CATALOGUE DISK, I ALSO DO STAC TEXT ADVENTURES, SPL SAMPLES AND MUCH MUCH MORE. WE ALL KNOW THAT A.W.F. PDL IS THE BEST P.D.L AROUND SO WHAT BETTER PLACE TO GET YOUR COPIES OF POWER. INCASE YOU HAVEN'T ALREADY REALISED, I WRITE POWER DISK MAGAZINE WHICH COMES OUT MONTHLY. LET ME TELL YOU A BIT ABOUT IT......POWER USED TO BE P.D BUT GOT SO POPULAR THAT IT WAS COSTING TOO MUCH MONEY TO RUN, SO I DECIDED TO START SELLING IT AS LICENCEWARE. I JOINED POWERFIST AND POWER IS NOW SOLD AT 2 POUNDS 50P. THE P.D ISSUES ARE STOCKED BY A.W.F. PDL, SO SEARCH AROUND FOR THEM IN THE CATALOGUE (PROBABLY IN THE MISC. SECTION) AND ORDER A COPY OR TWO TO TRY IT OUT. IF YOU NEED ANY HELP, I AM SURE THAT A.W.F PDL WILL BE MORE THAN HAPPY TO HELP. THE P.D ISSUES ARE OF A LESSER STANDARD TO THE LICENCEWARE ISSUES THOUGH, BUT FOR A TASTE OF WHAT POWER IS ALL ABOUT, ORDER ISSUE 6 OR 7. ISSUES 8 ONWARDS ARE LICENCEWARE AND ARE OF A HIGHER STANDARD. A.W.F. PDL WILL BE GETTING HOLD OF THESE VERY SOON SO KEEP AN EYE OUT AROUND THE LICENCEWARE FOLDER. POWER IS FOR ALL TYPES OF USER, IT NOW HAS STE RELATED ARTICLES, A STOS HELP CORNER, STOS RELATED ARTICLES, A BEGINNERS ASSEMBLER TUTORIAL, OTHER PROGRAMMING ARTICLES AND TIPS, CHATS ON THE LATEST COMPUTER NEWS AND LOADS MORE. WE ALSO HAVE LOADS OF NON-COMPUTING ARTICLES THOUGH WHICH WILL APPEAL TO EVERYONE. FROM JOKES TO NORMAL CHAT AND EVEN THE HUMOUROUS DIARY OF AN ST USER. THERE IS SOMETHING FOR EVERYONE. THERE ARE LOADS OF INTERVIEWS, EXCLUSIVE P.D AND EVEN MORE TO KEEP YOU OCCUPIED SO WHY NOT GIVE IT A TRY?! IF YOU WOULD LIKE TO GET IN CONTACT WITH ME (I'M ONLY 14 BUT WHETHER YOU CAN BUILD A COMPUTER OR DON'T EVEN KNOW HOW TO LOAD A DISK THEN I AM STILL ALWAYS INTERESTED IN HEARING FROM YOU AND I HAVE LOADS TO OFFER!) MY ADDRESS IS (EACH PART WILL BE REPEATED TWICE)....................... HURRY UP AND GET A PEN!!!............. JAMES L. MATHEWS JAMES L. MATHEWS 3 SALISBURY ROAD 3 SALISBURY ROAD MAIDSTONE MAIDSTONE KENT KENT ME14 2TY ME14 2TY OKAY, WELL PLEASE GET IN TOUCH WITH ME AND TRY OUT POWER. MEANWHILE, YOU SHOULD BE THINKING ABOUT WHAT YOUR NEXT ORDER FOR QUALITY P.D WILL BE FROM OUR MUCH LOVED PUBLIC DOMAIN LIBARY.......A.W.F PDL!!!!!!!!!!!!!!!! THANKS TO A.W.F. PDL FOR THEIR SUPPORT IN POWER AND ALLOWING ME TO STICK THIS LITTLE ADD ON THEIR DISKS. NOW, LETS............................. WWWWWWWWRRRRRRRRRRRAAAAAAAAAAAAPPPPPPP !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! SSFIGURATIVEFIGUREHEADFILIBUSTERFILTERABLEFILTHINESSFILTRATIONFIMBRIATEDFINGERBOWLFINGERMARKFINGERPOSTFINITENESSFIREBUCKETFIRESCREENFISHMONGERFITFULNESSFLABBINESSFLACCIDITYFLAGELLANTFLAGELLATEFLAGITIOUSFLAGRANTLYFLAMBOYANTFLAN0PpppuwW'w x???8?`o? @?0? @?@??  ?>qqqq?   @@@?@?? ? @@?``??8???g<????|>|>|>ffffffff`>`>`>`ffffxxxx~~~~ <~<~<~<~ffff`v`v`v`v````````~>~>~>~ffffffffx0x0x0x0~~~~~~~~ ~~~~````EUTRONANTIPYRETICANTIQUARIANANTIQUENESSANTIRRHINUMANTISEMITICANTISTROPHEANXIOUSNESSAPOCALYPTICAPOLITICISMAPOLOGETICSAPOSTLESHIPAPOSTOLICALAPPALLINGLYAPPEASEMENTAPPELLATIONAPPELLATIVEAPPLICATIONAPPOINTMENTAPPRECIABLEAPPRECIABLYAPPRECIATEDAPPROACHINGAPPROBATIONAPPROPRIATEAPPROVINGLYAPPROXIMATEAPPURTENANTARBITRAMENTARBITRARILYARBITRATIONARBITRATRIXARBORESCENTARCHAEOLOGYARCHANGELICARCHDIOCESEARCHDUCHESSARCHDUKEDOMARCHIMEDIANARCHIPELAGOARDUOUSNESSARISTOCRACYARMINIANISMARRAIGNMENTARRANGEMENTARTICULATEDARTILLERISTARTLESSNESSASCERTAINEDASPHYXIATEDASSASSINATEASSERTIVELYASSESSORIALASSIDUOUSLYASSIGNATIONASSIMILABLEASSIMILATEDASSOCIATIONASSOCIATIVEASSUAGEMENTASSUREDNESSASTHMATICALASTIGMATISMASTONISHINGASTRINGENCYATHEISTICALATMOSPHERICAT. `.. ABFORMATDOC p ABFORMATPRG p"g ABFormatter: (c) 1991 Gregg Hungerford ABFormatter is a floppy disk formatter for 1 or 2 floppy disk drives. As ABFormatter is in itself a multitasking program, both drives are formatted independently of each other and don't re- quire the same set up. Non-critical bad sectors are mapped out of the File Allocation Tables. ABFormatter is run from one central dialog box with identical controls for each disk drive. OPTIONS: Selecting Drives: Toggle which drives are to be formatted by clicking directly on the buttons marked "Drive A" and "Drive B". IF you only have one floppy, you may only format Drive A (Drive B will be dis- abled). Sides: Click directly on the current number of sides to toggle. NOTE: As a one sided floppy drive can't announce it's one sided-ness, you will run into problems if you attempt to format a disk as double sided on a one sided drive. Tracks: Click directly on the current number of tracks to toggle the total number of tracks (80-83). Sectors/Track: Click directly on the current number of sectors per track to toggle between 9 or 10 sectors per track. Label: If a label is entered, it will be written to the disk directory. Go: Click on this button (or press ) to begin the format process. NOTE: If both drives are disabled, very little will happen... If a disk is write protected you will be given a couple chances to correct the problem without aborting that disk format operation. Let Me Out Of Here: That little button in the upper lefthand corner of the dialog box. Aborts the program. Say g'night, Gracie. Status Box: The status box will inform you of the progress of each format operation. You will be informed whether the format was good or if the disk was unusable. SHAREWARE: This program may be freely distributed as long as this doc file (ABFORMAT.DOC) is included. If you use this program and wish to encourage more programs of this nature, please send a $5.00 donation to : G. Hungerford 1718 Ocala Ave. #117 San Jose, Ca. 95122 Developed using TDI Modula-2/ST UTATIONCONGEALABLECONGEALMENTCONGELATIONCONGENIALLYCONGRESSMANCONGRUOUSLYCONJECTURALCONJUGATIONCONJUNCTIONCONJUNCTIVACONJUNCTIVECONJUNCTURECONJURATIONCONNECTEDLYCONNOISSEURCONNOTATIONCONNOTATIVECONNUBIALLYCONQUERABLECONSANGUINECONSCIOUSLYCONSECUTIONCONSECUTIVECONSENTIENTCONSEQUENCECONSERVABLECONSERVANCYCONSERVATORCONSIDERATECONSIDERINGCONSIGNMENTCONSISTENCECONSISTENCYCONSOLATIONCONSOLATORYCONSOLIDATECONSONANTALCONSONANTLYCONSPICIOUSCONSPICUOUSCONSPIRATORCONSTITUENTCONSTRAINEDCONSTRICTORCONSTR`clN` _b ШNYN"pNGNuNV*x ڄ=E*P-E@-M-VNh-H ng nf-n*.P-ENB nf Nh-hN. nf BBN n e Nh-PN-n Ic8B,)n9n)n )n)n)n|.n 9c/@>,VNhYN`NsN^NuNVBn:.EIBtPRn nfI* -EI* -EI* -EI* -EI* -Ez-E=| Bn=|BnBn <I* "NB=|N=|=|=|Bn=|z-E <I* "NB=|4=|=|=|Bn=|(mI* -E <I* "NB=|Bn=|BnBn <I* "NBN DpL?09cNAN^NuNV/-+NI Gz+WBn:.IJ4PgRn`=yc n d:.I0PN(z:. HEBEHE HEE08.I@Rnz:. HEE08.I@RnI GzWBn:.I8.nGP@Rn:.IJ4Pg`N+_N^Nu OAbrpNGNurpNGNV-|V*.Jf drpNG-n nBBB!.B"H$!.!.@ .PPB! 4"n "N^NuNFNuF'/NNn-/=-/H"Q ,IL?/^>/^Nf,oNsF'SSfWWNsSf>NsSfF NsSfNqNsSf N0NsNhBBB 9d&!B*H$C! `N D <L? <NAN`WNsNVHx". $.bBCh8BAHA62HC6BAHA`B6HCBAHA8<㑲eRCQ-C -ALN^NuNVH(. ,..BGg^<BEgV<✚G|HF⌈0BDHD8 H@∀HDkSEؼdREJEk|m pN(B` -D LN^NuNVH .g*2<bH@|bQAU-@LN^NuNVHLHD6HFC[40<@g6@gBC?ckp@@t?0H@26HFЃ6HGHACBCHCуHD6CHABCHCу6HFЃ6҃т6HGBDHD҄т6҃т6HFBCHC҃тHE6҃тHFHAFHABFHFцHGBEHE҅тPт6xz gRDCB詂[ f ԂӁрC c$JCk(H@@CH@JgvHLN^NuTOpr`pN(NVHLHD2AgHF0@gpA@?kx2A[FDHFHDrva"$rvar ՂkN@k,փՂ`@އ݆\Þ[j ޅ݄JA]NuTtvH LN^NupN(|Նd @kr2~ BHBB@HBJgp`NVHp".gH4?<N\/9dB?<N\/9dF?<N\/9dJ?<N\/9dv?<'N\/9dr?<&N\N^NuNqNqNq O h*#c(yc#d" ( ШШ(yd"*,Ѕ.@//??<JNA (yc*,ڬ ڬڬ#d&/<?<N\/<?<N\/<?<N\/<?<N\/<?<N\/<?<N\/<?<'N\/<?<&N\#LcpNGN GEMXModula-2/ST (c) Copyright Modula 2 Software Ltd. 1985,1986,1987. (c) Copyright TDI Software Inc. 1985,1986,1987. The team : Chris Hall, Paul Curtis, and Phil Camp .[3][Modula-2 Run Time Error : | | #][OK]NVId89n9n 9n 9n <Id* "NB3de =ye N^NuNV3 d3dN^NuNV3d3 d3 d3dN^NuNV3d3d3d3d3d3 d3 d3dN^NuNV(n8d(n8e(n 8e(n8eN^NuN NVIdB BBBBIdGd* (Gd* )EGd* )EGd* )E Ge * )EGe* )EN^N@NV?. ?.N XU?<?<?<BgBgN O 3e N^NuNV3d# e U?<2?<?<?<BgN O =_N^NuNV?.?.?.?.?.?.?. ?. N `O3dU?<3?< ?<BgBgN O 3e N^NuNV3d(n* #e U?<4?<?<?<BgN O =_N^NuNV#e U?<6Bg?<?<BgN O 3e (nHT(nHT(n HT(nHTN ON^NuNV3 d#e U?<N?<?<?<BgN O 3e N^NuNV?.?.?.?. N 8P3 d3d#e U?<*?<?<?<BgN O 3e N^NuNV3d# e U?<r?<?<?<BgN O 3e N^NuNVz.?z. ??<NMN^NuNV n e ne n$bz`z(n(nJg`Nz:.-EBn/./.N|.*=E n d:.E08.I@N:.E EA8.I@Rn/./.N|X-_Jg`J.g:.I-PNSn=n:.I8.n&n P@SnJnm`:.RE(n B4PN^NuNVHxN~HxN~NX*Y/NPIe((=|:.SEEIe/4P/4P/9f,/9f(NP:.EIeIP((Rn nfN^NuN NVYBNIf((YHxNIf ((YHx NIf(((a*YHx NIeX((YHxdNIe`((YHx'NIeh((/9el/9eh/9el/9ehNPIep((/9et/9ep/9et/9epNPIex((/9e|/9ex/9e|/9exNPIe((/9e/9e/9e/9eNPIe((/9e/9e/9e/9eNPIe((/9e/9e/9e/9eNPIe((#A e"#; e:#Be&#:oe>#F@e*#8QeB#L e.#6ŬeF#Ze2#57eJ#tŮe6#3VeNBeRN^NNV?.NA*-E N^NuNV/./. ?.?.NA*-EN^NuNV?.?. /. ?.NA*-EN^NuNVYBgaT-_N^NuNVY?<aT*(nN^NuNVY?<??.(n //.atO (n (N^NuNVY?<@?.(n //.aJO (n (N^NuNVY?<B/.?.z. ?a>O (n(N^NuNV?< NA*JVDEN^NuNV?<NA*(nN^NuNVB9f-EJgr/ ?,Hn/,NO (_*.JEl/ &nHS<a\(_N^NuN&z:,>g/ &nHS<a^\(_N^Nu*,:2c)l:2z)E6Bl>N^NuNV(n J9f@gB9f@/ &n HSa,X(_BB,*,:2e/ &n HS<a\(_N*,:p -E*.6g`N~/ &n HSaX(_JgN^Nu)n6/ /.?,B'HnN&O (_-|/ ?,Hn/,NO (_*.JEl/ &n HS<aP\(_N^Nu/ U*,:RE??,>a$X:(_9E>-l&n*,:E$nPR:N^NuNV(n J.g |N^NuNV(n B,gn,g8,gz:,@&nN/ &n HS<a\(_N*/ &n HS&nHSaHP(_z&n9E@N/ &n HS<aN\(_N^NuNNVByf>N^N.TMP.TMPNVz.??<NAN^NuNNV#lfB#fF#RfJN^NNV(nHTaX(nJf`N^NuNVJ9fPg(nfOB9fPN4U(yfJNJg(nHT(yfBNXN(nB(nfON^NuNNVB9fPN^NNVJ9fgX 9ffNJ9f[g B9fRN^NuHyfT(nHTN>PJ9fTf (n  f`J9fTWDfRNfz9f N NB9fRN@(nHTNBXfRN&(nHTNXfRN N0 N^NuNNVB9fB9fB9fB9fN^NCON:PRN:AUX:Enter 'in' filename > Enter 'out' filename > NV?<NN*=EN^NuNV?.?. ?. ?.?.B/.?<NN*=EN^NuNV?.?. ?. ?.?.B/.?< NN*=EN^NuNV?.//^Nf,oNsNVB'?<?9j/< NO ?< NT`N^NuNVJffN^NuJff#ffN #ffjIf* #f3jjIf LIf"LNN^NuNVB9jB9j?< NTN^NuNNV/<rIf* /HxHyfBN\OBfBfBfB9jN^N`\h\\h$h\"Drive ASidesTracksSectors/Track___________Label : ________.___fSideTrack Status... 80 91Drive BGoSides1Tracks80Sectors/Track 9___________Label : ________.___fSideTrack Status... ABFormatter 1991 G. Hungerford $,-.456=>?MNO[p rwxy    !5679:;ef*!. h        , Hd    (D`|  $! @+\NVUa6Jg HnaX`N^NuNV(yk:. E&n&PN^NuNV(n:. -tP (n-T(n?<dHT(n?<dHTaDO N^NuNV(yk:. 9P N^NuNV3?N^NupN@NV?< ?<aX?<?<aX?< ?<aX?< ?<aX?<?<aX?< ?<axX?<?<ajX?<?<a\X?<?<aNX?<?<a@X?<?<a2X?< ?<a$XN^NupN@NV?< BgaX?<BgaX?< BgaX?< BgaX?<BgaX?< BgaX?<BgaX?<BgaX?<BgaX?<BgaX?<BgaX?< BgaXN^NupN@NV?<?<afX?<?<aXX?<?<aJX?<?<aI8. IP:.I@PRn n fRn nSfRn nfN^NupN@NV:. REgREHЅN@(n-O&OSEQ(m?<dHl4?. (nHTa^O (m?<dHl4a\/9Ў?< (m/,\aO /9Ў?< Bg?9k?9k?9k?9ka.ON^NupN@NV?< HyaHa6\(mz:,/?< B'(m?<dHlhHnaO(m l d(m&mlhi(m| h(mB,j/9Ў?< (m/,Ta0O /9Ў?< Bg?9k?9k?9k?9karO(m| (mJlf(m|0N (m|1(mB,/9Ў?< (m/,XaO /9Ў?< Bg?9k?9k?9k?9kaON^NupN@NVJy?fn y ?f>(m lb(m lf(m l f|N^NuN B.N^NuN$(m lc|N^NuN B.N^NuNf(mJlf$(mJlc|N^NuN B.N^NuN8(mJlb(mJlf(m lc|N^NuN B.N^Nup(N@NV/-+N=|(m:.EI=tPJng`N(mRl(m&m:+>I&m8+ IP:.I@B4PUaJgnz:./?< B'?< HnHna&O?< HyaT?< Hn?< HnapO?< Hnah\Rn(m:.EI=tPN"?<Hyaba<\(mB,S+_N^Nu`"+_N^NupN@NV?<Hyala\(m/,/<:9?RE?BgazO :9???(ml(m9EU(m?,aT(m_U(m?,alT(m_U?9?aT(m_U?9?a@T(m_=|(m:.INPRn nf=|(m:.INPRn n(m:.>I8. IP:.I@J4Pfa0.WdRn`T0.WdRn`T0.WdRn`pTUa_+_N^Nu < N@NV/9Ў?<(mHl`a4O U(m?<dHla\=_Jnf |N^Nu y?fBn=|N =|Bn y ?f =|N=|UI* /?9??.?.?.?<aOJ_l?<Hyaa\B.N^NuBn:.nb(m:.I8.GP@N:.I PRn n f| UI* /?9??.?.?.?<aݚOJ_l?<HybaT\B.N^Nu|N^NupN@NVUaJg2UaJg(UapJg?< Hyba\?<a TN ?<aT(m| h(mB,i/9Ў?< (m/,Ta.O /9Ў?< Bg?9k?9k?9k?9kapO(m| (mB,/9Ў?< (m/,XaO /9Ў?< Bg?9k?9k?9k?9kaON^Nu <4@N@NV/-+NJ9!f`NaBn:9?SE?0.İWcNRBn:9?SE?0.°WcN&J.Sg`N a~Jng nd y?fBnN=|BnRnU/.?9??9??.?.?9??.aO=_JnfNJnfH nf@U?<?<Hyb"aNP3k ykf?< HybBa&\B.S=|Jng ng`h nl8 nf?<aTaN ?<aT?<HybPa\B.S0.°WdRn`T0.İWdRn`TJ.Sga\!`n+_N^NupN@NV(n:. -tP (n-T(n?<dHT(n?<dHTaO N^Nup N@NV(n:. IPGz&Q-n(n-T&n(S?<dHT(n?<dHTaҞO N^NupN@NV(mI4* (m)E(mI* (m)E(mIh* (m)E(mI* (m)E?<Hybba\(mBln(m|(mIj* (m)Ef(mIj* (m)EbBnBn=|(m:.>Ip8. IP:.I@PRn n fRn nSfRn nfN^NupN@NV:. REgREHЅN@(n-O&OSEQ(m?<dHl4?. (nHTaJO (m?<dHl4a\/9Ў?<(m/,aO /9Ў?<Bg?9k?9k?9k?9kaON^NupN@NV?< Hybja6\(mz:,^/?< B'(m?<dHlHnaˆO(m l ^d(m&ml(m| (mB,/9Ў?<(m/,a0O /9Ў?<Bg?9k?9k?9k?9ka^O(m| h(mJl\f(m|0iN (m|1i(mB,j/9Ў?<(m/,aO /9Ў?<Bg?9k?9k?9k?9kaON^NupN@NVJy?fn y ?f>(m l^b(m l^f(m l f|N^NuN B.N^NuN$(m l^c|N^NuN B.N^NuNf(mJl\f$(mJl^c|N^NuN B.N^NuN8(mJl^b(mJl^f(m lc|N^NuN B.N^Nup(N@NV/-+N=|(m:.EIh=tPJng`N(mRln(m&m:+\>Ip&m8+^ IP:.I@B4PUaJgnz:./?< B'?< HnHnaO?< Hybv?< Hn?< Hna\O?< Hnah\Rn(m:.EIh=tPN"?<Hyba<\(mB,+_N^Nu`"+_N^NupN@NV?<Hyba\(m/,b/<:9?RE?BgafO :9???(mln(m9EZU(m?,ZaT(m_}U(m?,ZaXT(m_~U?9?aֺT(m_˂U?9?a,T(m_˃=|(m:.IjNPRn nf=|(m:.IjNPRn n(m:.>Ip8. IP:.I@J4Pfa0.WdRn`T0.WdRn`T0.WdRn`pTUa_+_N^Nu < N@NV/9Ў?<(mHla4O U(m?<dHl4a\=_Jnf |N^Nu y?fBn=|N =|Bn y ?f =|N=|UI* /?9??.?.?.?<aOJ_l?<Hyc a\B.N^NuBn:.nb(m:.I48.GP@N:.I PRn n f| UI* /?9??.?.?.?<adžOJ_l?<Hyc$aT\B.N^Nu|N^NupN@NVUaJg2UaJg(UapJg?< Hyc8a\?<aTN ?<aT(m| (mB,/9Ў?<(m/,a.O /9Ў?<Bg?9k?9k?9k?9ka\O(m| h(mB,i/9Ў?<(m/,aO /9Ў?<Bg?9k?9k?9k?9kaON^Nu <4N@NVZ/-+NJ9"f`NaBn^:9?SE?0.^WcNRBn\:9?SE?0.\WcN&J.g`N a~Jn^g n^d y?fBn`N=|`BnlRnlU/.f?9??9??.^?.\?9??.`aO=_jJn\fNJn^fH njf@U?<?<HycDa:P3k ykf?< Hycda&\B.=|lJnjg nlg`h njl8 njf?<aTaN ?<aT?<Hycra\B.0.\WdRn\`T0.^WdRn^`TJ.ga\"`n+_N^NupN@NV/9Ў?9k/9ЊaІO /9Ў?9kBg?9k?9k?9k?9kaO?<BgaLXN^NupN@NV?.BgalX/. ?.Bg?9k?9k?9k?9kaON^NupN@NVBgz/aL\/9ЎHykHykHykHykaOBgBgBgBgBg?9k?9k?9k?9kaO/9ЎBg?< ?9k?9k?9k?9kaOa,J9g 3kN&J9 gJ9f 3kN 3kU/9Ў?9kaX\3k/9Ў?9ka\:9kH N  y?f3?2$N3?1$B9%aN y?f8 y?f3?2$N3?1$B9%aNz8$z:9? N P`3Q?1%NJ3R?2%N63S?3%N"3P?0%NN 4HB9&a4N y?f`N8$z:9? N P`3Q?1%NJ3R?2%N63S?3%N"3P?0%NN 4HB9&aNNz:9? N H3 ?1$0%N&3 ? $9%N N (B9&a,N y?ffz:9? N H3 ?1$0%N&3 ? $9%N N (B9&aNpJ9gB9a̲NaZ/9Ў?<?< ?9k?9k?9k?9kaO?<BgaXN y?f\J9 gB9 a͠N a`/9Ў?<?< ?9k?9k?9k?9kaDO?<BgaXNJ9fJ9 g^?<aNT?<z/a\?<2Bga`XJ9gB9!J9 gB9"J9!gJ9"f`Bgz/a\N4N0 bH$ y kg`v?<aT?<BgBgBgBg?9k?9k?9k?9ka"OajaN^NupN@NVUaBJ_fB.N^NuI$* #Њ?<Hy?<HycaO  !"By?3?3?3 ?3P?3?3?3?3 ?3P?*< #k#kkByk(yk:9kE(< شP(yk:9kE)PXkRyk ykf*< h#k#kk Byk(yk :9kIP*< ڔ(*< ڬ)E*< ڬ)ERyk ykf*< \#k#kkByk(yk:9kIP lg& lg lg lg*< ڬ )E / /9k?9ka\(_Ryk y"kfBgBgHyЎadPB9$/9Ў?</9ЊadO /9Ў?</9ЊaLO |N^NuN 4NV*<(/aXJy?c`NUaxJg`NY/<XR?rC""AN@N<`N^ _NNVpNB | r | zN@N=@ | N@N;N<=@r2. /?< Hn/</<HnN9j?+0+ 2+1A?4+6+C?A//</<N$t?+0+ 2+6A?4+6+C?Hy /</<N$tQ/.NzQ/. NpN>r | zN@N=@ | N@N;N<=@r2. /?< Hn/</<HnN9j?+0+ 2+>A?4+6+C?A//</<N$t?+0+ 2+CA?4+6+C?Hy /</<N$t?+0+ 2+AA?4+6+C? n//./.N$tN^ _NNV=|?+0+ k?2+k?Hy /<A/<BN$tr09H @m??=@4.H B(fJgf2.|AHo/</<?.:.(H EA$/0.(H @A,/NORn02R@Qx=k 0+2+Avz:+(4B=@0+ kS@=@=n?+?<Hn/</<N$ yH g&3H ?<?+ ?+?+?+NB` H` @(g @)g`H`#IN^ _XNNVBHBHHy"\/</<Nrp??=@2.H AB(f02R@QA`/ GI&N&_Nu /N2Jkdf.?<Hy"z/<8/<9N,=@3H `8?<Hy"/<S/<TN, @f ByH ` 3H BN2Z'@=|r09H @m??=@ nf kdg ng/+rnpNAJg|0.R@?HnN04.(H BA 4.(H BAX 4.(H BAP 4.(H BA .".ND6".ND6<.(H FA .".ND6".ND6<.(H FA 6.(H CA (*.ظc4.(H BA-P 9H8.(H DA"Ё#H 9H8.(H DA"Ё#H2.H A|f02R@Q@ d 7|`P"</"< .ND"ND7@r 6+SCHCBCHC$RB 7BJkf7| r2+-A"</"< 9HND"ND7@r 6+SCHCBCHC$RB 7B k d7| r2+-Ar09H @mB??=@4.H B(fJg0+2.AT@8.(H DA"00+8.(H DA"2AU@2.(H AA&00+ 2+A8.(H DA 08.(H DA"/|<+*//<0/.NB2.(H$AC 2AS@6.(H CA$04.(H BA":.(H"EC24.(H BA :.(H"EC24.(H BA&:.(H"EC28.(H DA"0.(H @A*/p0+//<0/.N&8.(H DA2AS@2.(H AA0Rn02R@Q0+2.TAAT@7@B0+kBU@7@D0+ 2+A7@@/9Ht4+"//<2/.Nk@S@7@F7kBJ7k@H7kDL"9HH/v6+$//<2/.NJkHS@7@N9# ?<?<?<<?<?<?<?<<?<?<?<?<Hn/<HnHnHnHnHnHnN-@.rApNAJg HnNL.rApNAJg?.?.N9HJgL?+ N)7@?+ N)d7@N^NuNVN.7@ kf(?<Hy# /</<N,7@p` |#(Cz""""?+HkzN+7@HkHkHkHkN+7@r p??7@2+AH A1|02R@Q7|Hk/< /<HkHk/<9/<tN#4?</=n<.:@=@=n8=n6=n4=n2.0@=@=n.=n,=n*=n( . "<ND=@"< . ND=@/Nv p?Nv p@NvpANvpBNvpCNvpENvpFN~vpGNvvpHNnvpINfv pJN^ _6 "$// ////??<KNAO,_&_NuvpLN.v $?//pNNvpONv pVN vpWN(_?NATN(_?NA@TN _02// /???<NMO,_&_Nu _2// /??<NMO,_&_Nu _2// /??< NMO,_&_Nu _2// /??<NMO,_&_Nu#O#O?<NMO&yO yON#O#O?<NMO&yO yON#O#O?<NMO&yO yON#O#O?<NMO&yO yON#O#O?<NMO&yO yON#O#O?<NMO&yO yON#O#O?< NMO&yO yON#O#O?< NMO&yO yON#O#O?<NNO &yO yON?<NNTNu?<NNTNu?<NNTNu _$_// / ?<&NNO&_Nu#O#O?<NNO &yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?< NNO&yO yON#O#O?< NNO&yO yON#O#O?< NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO &yO yON#O#O?< NNO&yO yON#O#O?<!NNO&yO yON#O#O?<"NNO&yO yON#O#O?<#NNO&yO yON#O#O?<$NNO&yO yON#O#O?<%NNO&yO yONNBNBRnRnNBNBRkRkRkNVpNB/ GOBk0+$. 2Ab( n|<+*Cp@gRk`0+`&_N^ _ NNVpNB/ GOBk0+$.2AbT6+*.8DbD np0+Fp@g& nt4+""nz:+(Rk`7k.Jg>".0+@e&??7@ nt4+" 02R@Q".RA7A0+$.2Ab nt4+"B0+`&_N^ _NNVpNB/ GO n//./././. /.<N7@&_N^ _NNBNBNBNBNBNBRkSkNBNB\:/NV/ GO .7@r2. .ND'@ ./v6. "+ND6"*'E kH"n6+H$-kSkJgJkl".k n0r0+@n(D??7@ n4+H" 02S@Q&_N^ _NRRBOP0/lOP2@3PAA?A0/l 9O2@3PAA?ANu E`lJ E@mE@$BBN E m E $"B EmE4HB2HAB@H@SEm QNuBBBNuCJf "BCexJf BCejJgf(fCeVH@HAHB02BB(HDDg(LCi2Df`f` CegCe HCBCNuBBNu0/ @g @?@Nu /N0/ @g0/fN$AC""Nah09P @gA "&(:9PyPg0l(49P3PP3PDECD9O9PMavJ9Of҄уN0l( 9PDfDN _HyHpNF69PBaiJ9PgJg _O//N _HyH"pNL"_BO 0l D@OBB&<A0a0//J9Og/ NNB9O /m:H@6C@H@C2<C Am Al _ONNxpN _HyHypN _OB//Na09Pg09Pg0/ 2/4//6/ ރd Rd'6/ރd Rd'6/ރd Rd'v6HCԃdRdRHF&HG6҃dRB6Ѓ69PC?89PD?Di$C@i m,aJ9Og _O//Nl _HyH8pNBBN _HyHjpN|0/@g2/ Aga /"/$/ &/B~=B| HFNfR/Be ⑈QNfR/BցՀeQ09P69PAHQ@ C@l.C?i(m4$" aiJ9Og _O//N _HyHQpNBBON0/4/ J@gJBg2AQd@B _O@NgB@BrBgdDrN@ /"/$/ &/gBCfBNrH@@gr _O NNu _ONNC 0/:@fB0E@@H@0/"/E6<3E Cmp C5l:ap`B _O/N _pHyHyN _ BBOJl DO&<A0aJ9Og//N _ BBOJ&<A0aX//NB9OB"_0N"W./N"_ NNuNuHNu>p02@0Nu0/lD@?@ _TN _0@NS@gVf JAgmJ`JNuNu _ am znNH@B@H@Nu>p02@0NuNFQN(NQNNQNNFQN @g,NVf _.IN! R _.IFfSNNfRN Am~>G@l7xARA'drNr _gRNДA _N RAQN Am$~>懾@l??0<`7x02Nup _HyHNgRACSNuACSNu @lpNu"_.HN PN Am~>懾@l??0<`F7x02Nug @0(` @ ("P$_gR (OgS!Q NO HgNz @oJ$//?< NAOHyI?< NAO N:HyI ?< NAO2<0<QQ2 _?<LNA _p HyHN/H@N NNu?@N 0NNuN NNu l0NW??<NAONu /lD/@ _XN//Nf"N "ANu//Nz"N*"ANu.HA/HGBGЇ.HGHAHGBGЇNu.HA/HGBGЇ.HGHAHGBGЇNu lD lD`NDNu lD`HA AfHA.B@H@H@HG>HG0NuHAe8B?<eRF`ЁeQ`eQ< SNupNu#P"(gT} g" gDopHyH |N "_.@!@/ //?<?<JNAO N"_.@/ Nu o0 @f #HNL @f#HN8 @f !yHN& @f0( WN"yH#H3@ iN _ON _ @NпPn _p HyHN N _> N _> N _ B@H@N _ H@B@H@NA" <NB _ONA"psNB _ONAGP#I <V.@p"<X(NDN pANC 0123456789ABCDEFTRNC - real too largeMULR - floating overflowDIVR - floating overflowDivide by zeroTrunc of negative valueADDR/SUBR - floating overflownot enough memory to runOut of rangeSet element out of rangestack overflow near  2*""2f*  F 4  ":.<"<,<*,<*64 8"<4*B *,,,,000T(:". N$ <> 6 $ D  >p ( b""HTJ:*\ \  <"B68, 8<>*>*L**$ R "R ": : @ BX " $: : 2 B: @ "8  T2 V>\:  L   H ~"X".j.H(   LATIVEMANIPULATORYMANNERLINESSMANOEUVRABLEMANSLAUGHTERMANUFACTURALMANUFACTUREDMANUFACTURERMANUFACTURESMARRIAGEABLEMARSEILLAISEMARVELLOUSLYMASTURBATION`HNE7yBNuNV"< .ND=@ ."<NC=@?.N@0 |N@@NA?4+ 6+C?A//</<N$h?+0+ 2+CA?4+ 6+C?Hy 2/</<N$h?+0+ 2+AA?4+ 6+C? n//./.N$hN^ _NNV=|?+0+ k?2+ k?Hy 4/<A/<BN$hr09H @m??=@4.H B(DJgf2.|AHo/</<?.:.(H EA$/0.(H @A,/NORn02R@Qx=k 0+ 2+Avz:+(4B=@0+ kS@=@=n?+?<Hn/</<N$0RnHy /</<?./9H/9HNjN^NuNVpNBV?+0+ 2+A?4+ 6+ C? n//./.N$h/.?< Hn/</<HnN8?+0+ 2+&A?4+ 6+ C?A//</<N$hN^ _NNV?+0+ 2+A?4+ k?Hy x/</< N$h?+0+ 2+A?4+ 6+C?Hy /</<N$h29H |A?+4+ 6++C?8+ :+E?Ho/</<N$hOHy /</<?< k>2HABAHA /NhHy /</< ?< k>T2HABAHA /NX2HABAHA /NHy!/</< ?< k>\2HABAHA /NHy!&/</< ?< k>P2HABAHA /NHy!H/<&/<'?< k> 2HABAHA /NHy!p/<&/<'?< k> 2HABAHA /NXHy!/</< ?< k>2HABAHA /N(Hy!/< /< ?< k>2HABAHA /N?+0+ 2+A?4+ 6+C?Hy!/</<N$hHy!/</<?<69H (H CAX /NHy!/< /<?<69H (H CA /NVN^NuNV?<N+$7@?<N+$7@?</?<?+ ?+ ?+?+Nd02R@QN^ _XNNV?<N+$7@?<N+$7@?</ yH g&3H ?<?+ ?+ ?+?+NB` H`#IN^ _XNNVHy"/</<N*A`/ GI&N:&_Nu /N2lrp??=@2.H AB(D02R@QJkBf.?<Hy"/<8/<9N,f=@3H `8?<Hy"X/<S/<TN,f @f ByH ` 3H BN1'@=|r09H @m??=@ nf kBg ng/+rnpNAnJg|0.R@?HnN/4.(H BA 4.(H BAX 4.(H BAP 4.(H BA .".NC".NC<.(H FA .".NC".NC<.(H FA 6.(H CA (*.ظc4.(H BA-P 9H8.(H DA"Ё#H 9H8.(H DA"Ё#H2.H A|D02R@Q@ d 7|`P"</"< .ND"ND7@r 6+SCHCBCHC$RB 7BJkf7| r2+-A"</"< 9HND"ND7@r 6+SCHCBCHC$RB 7B k d7| r2+-Ar09H @mB??=@4.H B(DJg0+ 2.AT@8.(H DA"00+8.(H DA"2AU@2.(H AA&00+ 2+A8.(H DA 08.(H DA"/|<+*//<0/.Nj2.(H$AC 2AS@6.(H CA$04.(H BA":.(H"EC24.(H BA :.(H"EC24.(H BA&:.(H"EC28.(H DA"0.(H @A*/p0+//<0/.NN8.(H DA2AS@2.(H AA0Rn02R@Q0+ 2.TAAT@7@00+k0U@7@20+ 2+A7@./9Ht4+"//<2/.Nk.S@7@47k087k.67k2:"9HH/v6+$//<2/.Nrk6S@7@<9"?<?<?<<?<?<?<?<<?<?<?<?<Hn/<HnHnHnHnHnHnN,@.rApNAnJg HnNt.rApNAnJg?.?.ND9HJgL?+N(7@?+N)X7@N^NuNVN.7@ kf(?<Hy"/</<N,f7@p`HkHkHkHkN+7@r p??7@0+@7x02R@Q7|Hkx/< /<HkHk/<9/<tN#?</=n<.:@=@=n8=n6=n4=n2.0@=@=n.=n,=n*=n( . "<NC=@"< . ND=@/Nv p?Nv p@NvpANvpBNvpCNvpENvpFN~vpGNvvpHNnvpINfv pJN^ _6 "$// ////??<KNAO,_&_NuvpLN.v $?//pNNvpONv pVN vpWN(_?NATN(_?NA@TN _02// /???<NMO,_&_Nu _2// /??<NMO,_&_Nu _2// /??< NMO,_&_Nu _2// /??<NMO,_&_Nu#O#O?<NMO&yO yON#O#O?<NMO&yO yON#O#O?<NMO&yO yON#O#O?<NMO&yO yON#O#O?<NMO&yO yON#O#O?<NMO&yO yON#O#O?< NMO&yO yON#O#O?< NMO&yO yON#O#O?<NNO &yO yON?<NNTNu?<NNTNu?<NNTNu _$_// / ?<&NNO&_Nu#O#O?<NNO &yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?< NNO&yO yON#O#O?< NNO&yO yON#O#O?< NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO&yO yON#O#O?<NNO &yO yON#O#O?< NNO&yO yON#O#O?<!NNO&yO yON#O#O?<"NNO&yO yON#O#O?<#NNO&yO yON#O#O?<$NNO&yO yON#O#O?<%NNO&yO yONNBVNBVRnRnNBVNBVRkRkRkNVpNBV/ GOBk0+$. 2Ab( n|<+*Cp@gRk`0+`&_N^ _ NNVpNBV/ GOBk0+$.2AbT6+*.8DbD np0+Fp@g& nt4+""nz:+(Rk`7k.Jg>".0+@e&??7@ nt4+" 02R@Q".RA7A0+$.2Ab nt4+"B0+`&_N^ _NNVpNBV/ GO n//./././. /.<N7@&_N^ _NNBVNBVNBVNBVNBVNBVRkSkNBVNBV\:/NV/ GO .7@r2. .ND'@ ./v6. "+NC"*'E kH"n6+H$-kSkJgJkl".k n0r0+@n(D??7@ n4+H" 02S@Q&_N^ _NRRBOO0/lOO2@3OAA?A0/l 9O2@3OAA?ANu E`lJ E@mE@$BBN E m E $"B EmE4HB2HAB@H@SEm QNuBBBNuCJf "BCexJf BCejJgf(fCeVH@HAHB02BB(HDDg(LCi2Df`f` CegCe HCBCNuBBNu0/ @g @?@Nu /N0/ @g0/fN$AC""Nah09O @gA "&(:9OyOg0l(49O3OO3ODECD9Oݵ9OMavJ9Of҄уN0l( 9ODfDN _HyHpNF69OBaiJ9OgJg _O//N _HyH"pNL"_BO 0l D@OBB&<A0a0//J9Og/ NNB9O /m:H@6C@H@C2<C Am Al _ONNxpN _HyHypN _OB//Na09Og09Og0/ 2/4//6/ ރd Rd'6/ރd Rd'6/ރd Rd'v6HCԃdRdRHF&HG6҃dRB6Ѓ69OC?89OD?Di$C@i m,aJ9Og _O//Nl _HyH8pNBBN _HyHjpN|0/@g2/ Aga /"/$/ &/B~=B| HFNfR/Be ⑈QNfR/BցՀeQ09O69OAHQ@ C@l.C?i(m4$" aiJ9Og _O//N _HyHQpNBBON0/4/ J@gJBg2AQd@B _O@NgB@BrBgdDrN@ /"/$/ &/gBCfBNrH@@gr _O NNu _ONNB0/:@fB0E@@H@0/"/E6<3E Cmp C5l:ap`B _O/N _pHyHyN _ BBOJl DO&<A0aJ9Og//N _ BBOJ&<A0aX//NB9OB"_0N"W./N"_ NNuNuHNu>p02@0Nu0/lD@?@ _TN _0@NS@gVf JAgmJ`JNuNu _ am znNH@B@H@Nu>p02@0NuNFQN(NQNNQNNFQN @g,NVf _.IN! R _.IFfSNNfRN Am~>G@l7xARA'drNr _gRNДA _N RAQN Am$~>懾@l??0<`7x02Nup _HyHNgRACSNuACSNu @lpNu"_.HN PN Am~>懾@l??0<`F7x02Nug @0(` @ ("P$_gR (OgS!Q NO HgNz @oJ$//?< NAOHyI?< NAO N:HyI ?< NAO2<0<QQ2 _?<LNA _p HyHN/H@N NNu?@N 0NNuN NNu l0NW??<NAONu /lD/@ _XN//Nf"N "ANu//Nz"N*"ANu.HA/HGBGЇ.HGHAHGBGЇNu.HA/HGBGЇ.HGHAHGBGЇNu lD lD`NDNu lD`HA AfHA.B@H@H@HG>HG0NuHAe8B?<eRF`ЁeQ`eQ< SNupNu#O"(gT} g" gDopHyH |N "_.@!@/ //?<?<JNAO N"_.@/ Nu o0 @f #HNL @f#HN8 @f !yHN& @f0( WN"yH#H3@ iN _ON _ @NпOn _p HyHN N _> N _> N _ B@H@N _ H@B@H@NA" <NB _ONA"psNB _ONAF#I <V("<PNDjNpANB0123456789ABCDEFTRNC - real too largeMULR - floating overflowDIVR - floating overflowDivide by zeroTrunc of negative valueADDR/SUBR - floating overflownot enough memory to runOut of rangeSet element out of rangestack overflow near  2*""2f*  F 4  ":.<"<,<*,<*64 8"<4*B *,,,,000T(:". N$ <> 6 $  6  >p ( b""HTJ:*\  V&<""B68, 8<>*>*L**$ R "R ": : @ BX " $: 2 B: @ " T2  2 d>\:  L   H ~"X".j.H(  IFFERENTLYINDISCERNIBLEINDISCERNIBLYINDISPENSABLEINDISPENSABLYINDISPOSITIONINDISTINCTIVEINDIVIDUALISEINDIVIDUALISMINDIVIDUALISTINDIVIDUALITYINDIVIDUATIONIN DISKSPC v1.07 By Mark Brinkworth DISKSPC is a program designed to graphically show on screen disk usage. While designed primarily for Hard Drives it is capable of including the statistics for floppy drives connected to the system. If you only have one floppy drive, the program will list only Drive A: as being available. The program will show graphically the size of the hard drive and the amount of space in use on that graph by the use of bar graphs. The graphs are overlaid in such a way to allow you to see the percentage of free space available on the drive. Clicking on any bar will reveal the detail about the drive derived from the BIOS parameter block. Clicking on the totals bar will give the individual drive statistics in numerical form. The program is supplied in two forms, as a stand-alone program and as a desk accessory. They are not interchangeable by changing the extension of the file. The programs may be freely distributed along with this documenta- tion file. Diskspc was written in FTL-Modula/2. If you would like the source code please send $10 Australian to Mark Brinkworth, PO Box 424, Bassendean Western Australia, 6054. In return you will receive the source code on disk. But be warned, it is horrific code!! NVOLUNTARILYIRRATIONALITYIRRECLAIMABLEIRRECLAIMABLYIRRECOVERABLEIRRECOVERABLYIRRELIGIOUSLYIRREPLACEABLEIRREPRESSIBLEIRREPRESSIBLYIRREPROCHABLEIRREPROCHABLYIRRESPONSIBLEIRRESPONSIBLYIRRETRIEVABLEIRRETRIEVABLYIRRITABLENESSJOLLIFICATIONJUDICIOUSNESSJURISPRUDENCEJUSTIFICATIONJUSTIFICATIVEJUSTIFICATORYJUXTAPOSITIONKALEIDOSCOPICKAPELLMEISTERKINEMATOGRAPHKNOWLEDGEABLEKNUCKLEDUSTERLABORIOUSNESSLACKADAISICALLAMELLIBRANCHLANGUISHINGLYLAUGHABLENESSLECHEROUSNESSLEISURELINESSLEPIDOPTEROUSLETHARGICALLYLEXICOGRAPHERLEXICOGRAPHICLIBRARIANSHIPLIGHTSOMENESSLIGNIFICATIONLITHESOMENESSLITIGIOUSNESSLOATHSOMENESSLOGARITHMICALLUDICROUSNESSLUXURIOUSNESSMACHIAVELLIANMACHICOLATIONMAGISTERI. 1!F.. AUTO60 PRG GAUTO60 TXT Ha``CzA"A"A"A"Ax"Nu=@Az"psNBNuCA"A"B BBBB"A@"A`"An"Av"Nu=@@ A62< ` 2< BTB6a&SJ QNqNqNqmvNu DNuSABBf DQNuY % X5 Ah()I@  JzrrBP3 B    ąPS ) 9` `$ `,fpECd `6Ua:>Ep@ tPp@tH( *&!^FPth0HW*#AGDlH1 a I 0&A04 Z```o G*H d]D b0H2/c8EKH,$=05$C{Px !, ` $8$ Ha!ʀ4 \! r  @@ʑ K QD`^ @xCv pc x4 y B @,+<  2@ !h" F0@> lhPKh  p'ӐY"XB$5w@%hSD0 X.)D (#0Yk ?4x@pi(@G3 !3zXBAOL8 0 r:b! +"ހv Ȑ7p?" L@_0jP- 6fDlP55H\KxH(@ܳ V <` a E S׉U (Mxpd!` 9@*}/un(@ @% wq9쐂 P@۸86P0`+.MX0E) VA-rCH0 n{ W {B H@AȧA@jHl@#O`ƨB&LPp@t5ff`2D0  ``βhة?" pwЊo@H4)4bpGa@"3`10Li 45pW 3p7 7pw p4 (2@BMD  8aPC0 cBB@B-lHYCGP(? @ nA@̒])u*ă@_@ @e@@:@\@X?5)4x8Xh(HHDLBJFNAIEM@Îj^ bjF"H$H"H&H!H%H#H( 4aYt2&D@I GҐD/"CӠ O IFS(;,$WAƀ hA[]$0A0U @9A9( R aBT za ,TA0:P4@$`,Y B(O$@p^872$78 6pP H:.B!<  |0>^8727O8 >pP H:.B!<?```?acUUUUcFbcUUUUFa`5``?~`B`~`?@ @ ????```?acUUUUcFbcUUUUFa`5``?~`B`~`??@ @ ???????```?acUUUUcFbcUUUUFa`5``?~`B`~`?@ @ ????```?acUUUUcFbcUUUUFa`5``?~`B`~`??@ @ ?????? @ @4 C# ~! ! 3   &0',נ`\ @ @4 A# x! `! 3   &0',נ`\  |0>^`3:- `p~ H:0. B!<      ?=== $($/$(@?2HIJ\]^(+("; <?a"de|}""' !(000(4100(0)00$+000 d D0)00 +000T 0 0t" 0( 0('0$ +  %00$@   \ x   A 00.00 P00!! !<X!t!r00, 0&' 070#'  /04 =$b  0RSTSENTIMENTALITYSEPTUAGENARIANSERVICEABILITYSESQUIPEDALIANSESQUIPEDALITYSHAMEFACEDNESSSIMPLIFICATIONSIMULTANEOUSLYSLANDEROUSNESSSL` H?<NNT/$@?<NNT2<<g2<gBQC\|<<f|(HzF?< NA\B?< NA\/?8@AL"H/(a,_1߂@?< NA\G*"K kK^ JgёBJAg<f``+k +k+k  -"- Ҁ+A -Ҁ+A м$@*@t_CQ"KA$HNM@,$$$$ٵoC&i")n"<BBBBSlLBNHaaKa.(I,I&N%aLNurQNua.d&NqNqra$dCv !a"H@@Vҩ%QnNuf%Nurf%AQNuCtaTxr1 Hka1 Ag"CvtaTr1 HaBq jD`rptadpt?aBC@!!Q`N   jY JAM Packer Decrunch V4.0kIce! `uVK|*O‘ !L!"ҍ¼.A// J12Lga" & Fo x u -SBQ( )M0^*IN/KHkHX :ֹaAA6ܖmfJbNqp [OA쳯0$׌nk96<:P*H+cv;F 0 ,U(20TIh-9@6!J PE`"-+0sPXJ@Ls&.PT @b4tPO`$obf<dF3]VfFJų P+0{r( VYpp/HXKTRGH*H-|X4Xp]2z"0kPR.Fbc^ fи7P-(wKi7bfWX <\$ 2WF y 9^f2YHl6;9թ b F7[) pY (sB`1Ó 3 BlTZ*Ui0SFbruL m]Ed9e*a&M |% <`ڙP#5LԒht T{n̔gOނbG6 nKH -+ P U9~֙ 4ӵsRng2Īs.>鉀̰cK/HNA])@-P ly֘h s\X Pq'xa㬩fduhb =`]:}/bF8;͙YY0eX?,ҟzE\/fl M~eUtYAm2LhєвToe/T jDFf,W>gyh02OWO lK0(A1@$&P(* *+6 1a\X][>"H@LU=NHYV@BHl~ :ӐՋI~ 0 M'5 P.T HeXCp# l@TH_xrUTGLZ \=@r~ā,4/)tT40[B?54V ?VBgJgŭVrZ; )I)J"/duNB"P$lL8 p2mGjA5TmMfm@*am !$Gi< @F2dIX q xBQ :R (UTh+vÓmA" A-H =Rr5PR2|ZNH0DkQ/.zRؙjU72T@V(us\'8f9*P+P:`+҃H"=؊`+҃/r<@k2B jexHdM6&V3\cC4k3lT@B<0DgeجfnB5 otļs%{  8phBlx ؤ0,> snX >4^ BL+NGdź ]&H`7ѡ* A1ҙ!dmI+D0r=1 XJ,9jfsR&_*H;Sff.͈gV2Bv. ugV Nh>x/^zy fԌ@k#0 S* o0MD@H+i0P'ӻ&Bk0LcIlL"Lf'L mn H%Y`VĬBF0Y u$ uѓ5`!g]FbioHzlc/ytcBgΘi P BAc S]1g ` `df M?`/I7Y<>tC1`&sR0gXsFf.BP^LqmS¹>B=|0'T"HSPgXHf0(8>Q :N{dyA`/,HO)I)J;)_H4" | sNB"fP$lL) MЌZ)@;dz B$9PL 0a88X@d,D)H<9)e-9TX"4vV  ^:*`@ <` RF?Xx S8 !=NVH0&ć $KA-H䏔K#4LrU:`K . nf/ p\=&--KBTJ@!THL fY#|8ofUS AF'/DN G @GtRFtd `R之ne d 6CƼzCnЃ$@ C-@/P?.?<@N6 9@Hg0<`0,nBl҄0.L N^Cܘ {xIP7s"/2b6x9|Nu [Cnot fdXPAND.RSC | Abandon thqp gram.  [3] [Maj Error!|Fichier resource bugg .][Warning!]6CON4AUX&PRT: dSTORIOGRAPHERHOMOGENEOUSNESSHUMANITARIANISMHYPERCRITICALLYIGNOMINIOUSNESSILLIMITABLENESSILLUSTRIOUSNESSIMAGINATIVENESSIMITATATIVENESSIMPASSABLENESSSIMPENETR *************** EXPANDER 2.03 *************** This version of Expander is Freeware. That means that it may be freely copied and distributed as required. I do not ask for any payment at all for it. Please make sure that this text file accompanies any copies. I retain the copyright on this version of Expander and actively encourage you to improve it. All I ask is that if you do, you send me a copy of the improved file. My address is at the end of this file. This is an old French program that has been translated using K- Resource and Knife ST. I take no credit for the writing of the program itself, just for the translation and making it available to a new generation of ST Review readers. With the disappearance (more or less) of the single sided drive, more and more people will have single sided disks with information on them. So now, without having to go through the laborious routine of formatting a new disk, copying all the files across and then re- formatting the original disk, you can do it all in one operation, using the one disk! The program runs in high/ medium resolution only on all STs and is very simple to use. Just place a disk in your drive and select A or B to tell the program which drive it's in. Then just click on "Expand". If the disk is already double sided or if it's write protected, you'll get an error message so it really is foolproof. However, I would not suggest you try and expand a protected disk. Leave these well alone! ######## WARNING! ######## Although this program is safe and should not damage your disks or machine in any way, no responsibility can be accepted by the author, translator or ST Review magazine for any damage caused directly or indirectly by the use of this program. Live long and prosper, Gandalf. THECANTHROPUSPLENIPOTENTIARYPRACTICABLENESSPRECIPITABILITYPRECIPITOUSNESSP. C!\.. MEGA_DPKPRG ]: MEGA_DPKS f0M`nSH?<NNT/$@?<NNT2<<g2<gBQC\|<<f|(HzF?< NA\B?< NA\/?8@AL"H/(a,_1߂@?< NA\G*"K kK^ JgёBJAg<f``+k +k+k  -"- Ҁ+A -Ҁ+A м$@*@t_CQ"KA$HNM@,$$$$ٵoC&i")n"<BBBBSlLBNHaaKa.(I,I&N%aLNurQNua.d&NqNqra$dCv !a"H@@Vҩ%QnNuf%Nurf%AQNuCtaTxr1 Hka1 Ag"CvtaTr1 HaBq jD`rptadpt?aBC@!!Q`N   jY JAM Packer Decrunch V4.0kIce!n3A` xS0NN8fTSD TB.-2f?&f*o#ƀ -`YBORoZH@|(129uj@e|d[ mZ:)P"r#Wxe#(pZ`6 :1g#UNApJ`@G(A)#林I)Cf$cjg061 b. VD`V۫.z'o ^B ЭwHUp J )a (k /QH4 0,+5L6$GplapE@*pgJ|8N^&O'"rNBnJy)a `-HT&p>!g"_gZ*fB!&k;f03$Ip@BQ5@Af:EERJGBW0o0r3[aJgSH\>&f/gB*z06Vs=uk.\VtHBR!?kb`n֑`*/Laa`QΡBgHz/{XOJ@jPh2٘ {M !c.a}uHQl3 \OjY?ZN$ X#n/4L/H=t nNuBmAU2MYf,#l5R+3T zh GFIRE0ƩRqR.6L92< ٺ*UCE!:LFAM%'Jx.Yĩ\FK   d.LIce!ȏ>HlZW (@V3rGN.51S9(,$E*@TM2R+C IDf֐AU5]PL~d@ ~@0M|Hr"W,zG B@)Squi(= hNPzu $QP޲tf#,\TP:A8,W%< #<81*TZ1|mh%j#CPե DXXC8.Xx`3UvHj[h\PC6:Ae@,(H&IKy r Ё9?/f> 嗱T0<23%,H)N 0'P?Muw AO LSD!g'wƘe`XD)ƕSP(oXyC,;uG%,TxBZx%(j,^`@*RTF` mCD8"H(  "@XI Q7UI`# Clp<p#d^s Pf03h@kTE0A@vqp/ By##"_CH IL5 BڇG*K'‘,-I*pdq,C`$2+.3:~ # 4sq(k>AD@@N'l\ E<P~H@tJX>hbg#ʹkuM#K$#/#*S3 nLZm*#dVLM8`gs+Tt&pW$,nbnfJG k ATM5\OC$iE&H>&ـnNROBDKQL~{,HBj}f p5@]HQg:HTHUyy:{UGgdCDO?^g 0V7ɇDxbC84L'`@11$$gI\\ 3zJX .a2I;ʺ<mQhºEA`/2P:$jg^*nQ?ȁCsE}W0zABC@DީEf`KQN.؀' @dA>MY(/Gh  My]<4 ``X|!"Czt$|&F\v>g | a,E?f:b|m4TO]En(MmXLFa4P<>BEڃ E=JEhIr84@HaDt@ןPbd$| z ]`XTλ`eF`|߬gPEVE`GHHE|aPVSEkV&hjf"<[aBp~L &3;2Aa``y 7E6` M ,`%P nFIREf^adO^nd:|HFzl_Ld ВFd Jv H#.FL'z{)NX2gϱR`fB 0gTvgX/dBadZ`bWj߀Ķ!a҅ǀSAkN7>AL aAa0L7_pap`,> f.Ň3.-ᏢoW'p@ÇgpK ְ"ؼprְ20νLl@a[N5[xA #3,2NSHIx,LapICE!f`afKa`."N 2YP&N&X*Kad*><|8#z@prQ`H}RHrbn@fr'@90_TD8f<kH@ X*'*A l"-$" # BSd/!|*"Ә3a"&r/1[a (Nn;Zș|,><(zdb0)=Q|qdT@01'Gm'G8+kE󜠵JedfOlL`Sj&8*}ZgYRR81a41x3'G1 320fHlm-t)bBjMTFkg, `&a |,`g]?S%-QF*D?j|0JK @r2kYNc_//?/ws 31d<"H F2,I٣Ɗ*N(( :<&N~ÿ$~~qd $RESn`.,H$ED@@Ar$TApA?nڀnto~`X(H*БlJ`jS}2YĝAı6vA0 (MxlFDSBe<|8#z@UDCsZejHQLpw#0N[AҀj*d"va$ds| !a"H@@Vҩ%n'(`Y%A% .a܍ 6kM\Ag"CЊaTʘר1 HaBq jD`rptadpt?aC@>FJR<ŒȬ  U( *  &J#} (JYfgax2`64Nvvf\4gabd0a^daZeS2ARB`aHex6S%aJf0X?iv`"a.et࿱gXAa>a"J!XߞdRx2RAI8Jy B!a=t`y `$M0|g4tvx~}kg4 g iT@`B{sifP@O J`; r@H7EL)7ƍmWֻN"M{R"*$I}8 Cre2vhfeLrBDajDrq#RI7`8x`rFm/8ra60@ ` k BTB6a"SJ Q7mJjq.X2SABBf D㒏u`>`¯q #n`VUnzj,` /H,m>H,| m,,KA xX,OK?rBVD@T, 奔іT~*J$zI> &Vc. Pg a토RD`2  J``/6T.C Q>XN*!9vШ!@~.VL -O xagBbU# rPNU/-aе' _X8RV1V*??`aTd V0/'0WrBBaJ@g?SAf1(0< JPSbgz~R."P I"h$I (Μs"RRR!SfqG"H2" "@#$ǠI*l E6GCꃠHk a`DFRFAef@eANF^C}><TB@<_ 2Id2z$2Q 0@3a5C" @I@ ȿ(@/ a*pم*(_#}BKC1p9!QB#21d~g"]A7zԎ:6l8<`xP`.?Jm Rق¤ȰEgHD@RSDSfJDnHa LQM0|JWH N(G2KAx~`0| 1 pJZ`BG` L"N0TTRG|mNuy UB* edeUSe ctIn'E savvtoP!ZE (8)0p*.*w S0cBdATO73 FIRMAy@ nry<:3(0"SpXWlL ^Ѕ突'GICEn3/Hx<_ywL%k 4x* LZW4tho) 25}c[n 0"$0`@:@Zdn"!, ~ 6 J<*X2( RONATM5M#! AzG}1.1Zb MZXgWE8=~qTgΛ,Ɛ.=//~Wahu戱F_"wYB6.1tu`,My1n O!V|˙RMӗi0<}.Cwع!x$E} \J5\@okue*Ia\1BS%Io1g(-LstrG3 cDxkN 5Nn;B"27,+!IEԤSM ?8t!\C݁<Qqd,4mxrAީNKdfirbZ`GSNv m"(O,%XZ 5X'H0gy*O3@sQb ]I$MI:sczlh7ESZ4+ks0ztBN)Fl<'#c\wt=5b,fmDnva${ތ!;WX/ i `nt2Tl,$>ꊞZω[y'`#?qH! ú45;\4Q-ݮQvksI 15*.d&y*9 G,r/s,libBJ)yDbq,XfdL(CeӕIg=Xos;{g uk:Ğa=*8iQj@2_=Q՟$5D,"@e&J%Uճ4dnlɋMoK,E\ DQ+K;cQ$S3 |nRo(f FHFS^w^[4Z FJtq! F_wGfCTLzp| mKCt ~j?#c3jyчTp˵ʇUƥiyi 9b>#^6qR$2lkGxh%Ү0ZL[BENnC4r^9DL;iiFiK#Sc"IDMZ$2l6V&zrS3F)7? )U 2X2K<QVP᢭qKmBvDU_.iahy''3sXf ,EcUOna"N7"C18ЦP cuB*r$\R74"DQ {6r>Ѳ]CF4)?7se+fy7e3E"act,t!ǏR"l߂+o0=Ssʷ0/cyd[7(:cj$A0/ʭ/}Do?f)/m^ ,D *-6yVGMIvc96Cʓ@h_EyZ_pÛtӯa/Zzap_ir( ДMǭ(zblak;H!^y7bnK=m6l .fa־GowQD%+PGl,}_VtP^ĽQh,y$aVcү"cLZeM5-$aVe @FERG4G` TŜr/D P@9c ٴ9`>r l= zidiX0cnaulH,cJU2HYģ7配3V\*B.-oĐ9x.q @ )"jemIntre:\L䡖}k('VV 9{~26ڼg}q%HdWf9fN9 V ޗqiu0j=J̰ͬUԖ9ץ p|X, ɔ 49fDŽzqLIJe.\4rI%HH"JQZf;GRo#AY#0g/ 4 ءb3L>e?,Pv/H>_1,¹Ei^EuRY223\CuF@1󎉗`Z +AU5pԓRTfՏhEj#nHr@Xr1@ܸا_<Y+WZ;7,f(jf+P mVr heN\2c7a-/##y@%-?8V1.Is]rʷvu5!ON-ߤ暲E#i^2f9,DJ9D9%z*G AYrE{GiȢXeǮqm.'IHW<7$jO2!.ENE#)5bBH 9IyB @\YUFg q;4P-^v'.VI0;{f'P&Y\_/I$ PC1 85ދn;X㧑C>-U6Oq?mal(E"'FyxʳCr4aY&GgA`tBq8psт|4)n<賕W)^K$SXdžW 8"=% tYE6~[adDQ@qr[")$_#`L qߝ-G==RǽI&;_+jb1Fw7䐢VuvpC D:|OQ#lI|3O倓j3Z3(R3&B#pH%Kv뎀 I)IY4AXN :qR D8)VĤ|j 8B#snBJAM4_^EHAR4e5N fyjB v)tvHD0b$HL@ l;_82vļPCK]tx%#]lFG=IlFI@G;54LhW}q?uU'$SKx#v(̕w`຦ !B\  U$cx6JѬ1B{t|bz$B5dp_AT F4]xwL$5q^YDiΞө=96|jڊ3:.Q~ʔGn_Y%G^r{v#_size񗱮ZI&Id5q*ƨqȩީG6yRPO(KIf E( p Gq\rC4( S0)LPȕ :3)%$)`o,ff9F'BA@Dllڟ&Ņv`xV^( ?>Wż1ڨf)hVQk;3r_OaS_qVV)4tIOǚؾ!"4 Yz=cyԎtr\c?aehnewRo&b fĄbAD 8@%m"! v;ǒPR%ato1Kam sal 8vq- C-17ni Sʣ!eщÇNJWx7"ܸu# 1(Dygb+^!`9#(C4Kv_2Cgo_Ϡ-L|֫6kebG3)bQWJ?Ir`דUN#s 0Fu|,c'Kh>M[(V(SDw iae24d#r9*$^+˸y1aʏ,6&K < .i4C&aeaBiֺz0@B ݹTuT*C\ of P3ju Cʚ_4Hc֠!DY bSB⛣`l,6822hL:$U242݌GKR\\BՇ 7+ojLI r5v&)1O0'aՍr; pN]0!Aы-\WK$% withZW#T>2`_@hȡH I$K9gfZH4,#- Oa'c4]$raC|0-egx& aѻ!mx . BkBB)X!4p:rAS=[zAbB8Y.|u&t!$FeL";ye 4o P4Rjm54O>ODTmEED(hz4E(+lR&wkUλ?H4F)Dl@'1[sėgвwQW|BO <Ec9a>z4#u+XR3DҸkf u{XLDKt\}[ QA/Y_O~8ad"9F$Re-$v&щ(.kԃgE)'4BQHbʜy./ + ZTHFz]"" uZN,İ="͌7F90mjLvCi6q̸XAz9 erQ{7I KlD3SHdɄ/f[Y-%~J T4V&9@~88Ҙm [#xDOYvxӜbBNt*9ƖYUPpU#iZlؐr?"{f"Q, 8)+saQ.mTtH4{D*fK:(,Hu)d[_uk(sC :1i@ռ2"JId>١bp "֩8$c1*V0^}XÑsNnV`1LD12hc :hx3V)܉i4:ў5.DauY4I (G bRDQ_ćYZ@=:řssyrUD&U+# Y讝iQm4EbWp6Zmߗbu rgi@:C_MARE~6"cޖD&y)Ho5hIREet2G.Z $gLR[&5ԑ&)ތ<CT2rGM*;jG=Jؓ=-/ɫtjI v=À{,?ڞ)l@wpLJQJJdI_x"Ip,/@CE^/["VHV_(E8ZldDT^+%瘙 RXhOGpCpZ7,\!5$9+YrQrA :-Vc `Xs/"! EcǺKzO%)U x"@eif9e2daU=&f5H&Sb#%˖>%˦?16lB"iHn?29F& V^g̓6_}I_nJE 0 R2هCPKj6h 2,Ci@((5_r/&lu@:r&; &cjCʴa@W/Uljt'2\dzhX<ޫ"k.t$kPLq5X d`9(,!0>}} bk&8A,4~6+:: UOQ yu:rHd7txW `.8 8T` `1$f); Aч@.#b{o'}8Hj@*R.X2,s; \Q>uajٟGsk#Zg+V$'zzՁ$?lRoX; ^v|~`ff9ʦ#FwKd;?8" ÈQ MC##` 9EITtY cz>Q+[ќ_41Ě 27ZKhQ.6̞݊[(8?h$09ēXܹH1|+keD# _-L%m&bǦXpf4ᤉ]'bR-fMS5c@fyZ6p(a"::4YV}s"/fBnd<>: VWHF^9n*$ཿqp"yr YD%R̒ka#_)A:@uI&)e*\_raKH"D[zIv(p*cV*1U5~SL$qJzLLj+WRTk+ /f6#kT"Tm#1r#|P7z3M؋p2s_>e[06ivl s&rILwD eHEiƇma4lbi:kt̀1 7 eJ7t0`H9&WRa\}08 x C,_t#bq9& e8G(p;.D:=ofG,blY/ff(aaO93 \ (SdoLX1@4\bIj1Ǎ9J1@$.@:KD[y&mezL!B1(zC$T1u@ Lc~ yL=DB:2LN/Ȕ;HyHt 2K@3n5"L ! E2.aDEf8DB2葩.(X pd3F e vc4joJraؓGE_!_)TX6aCM7㘡y{O{7FtQ]Bƽ7クdDn&Ӻ)DT{GDIH cVg8.aCNdY( {W13Rv496+z??B|fx! 3z4˙4BNC ci1Ө9B>7DAbN.h?ޛ@.CwI4pwPDH (jam4qt-UOguGfxs.p,/\2IW];ޣVqyNlRm9U'qM˘'P; W,THK5DhwKTn.#"-/'nF0ݶU5uL͋TmSx-%FfZjG7 MAE`)Kj~øH Ie;*u\[_EdD2Z周1iQ5Uy50M+27G;-KwݒCY#hUWyڎYQ)ʧ=Pf/cDRSA4XB>4zI"Y X|*XDiXᨴ̟1)CT~US  &]2J%P%a>Y¯B.:>1}$kN3&]VDGCVFeM;0K,ᰌE`$4ʽAm!`4zh5=67Z(͑k%pJe7?P Kl|6 LVڽn)G[~P[9b(VCw=W<`B6mVlҫJ$2Ac3R!4ϖzj>х=U"0Z\>%"Dt]CҔ內hh5r0x1sڳ !DtP0j0C&e*=&) Bv+h{_P} 6]#W70trOnY8▤BL -u{EM}N瞻6NP(P 9>1owCq8~H!ZEO nU4Qf,ݬ|iEm+A` C=R/CKAXqV 0q-$QYjoR x&iqQ;5FTq}R66@-2PHϘ!87D`SA;:e,P~VQ)U|2B(%QDgTN|#"{nIe4h"hRn懅+ǏVP3P/4VXz]]dpISANϷ=:9bݒgxR GTE1'}B rg[Fd64%tOތMI0#:*'ӵ8G?D">1r0<hֈ35`nt8i6Y"SITIDR?ZQA"VER>P]T )d%̢ G+xڝ "/,U#@)$OD(CmzD} DO:7bX#o"; j;NG9 DsyܒWVѓ]e>>HCVYqA;BEW }PD'#:D-F3Fj젙TATAh_ م +d3$8g$kK׉tLN4N8> riPiy//u!}~p_#C"* DH"8}5+!ql)}(NLjla DOߜIeEI}|ڣ'sG|{QHgFj6kxУFjyoʷnlTE鞓IBF?HrߴVKVd dɅ0n54Ӯc3Pl:W'O{TUv / 'VJI3r_9mtT0_ O;R{|DIt5|[cm'0JiSmTR,*BDKHHf{5ISQ@^[>䑕$8H} wo Q4U۽'|┋hB | %jzI>vn4J$4Xh:(eiKh[K3Y傕m[OMW"SX%Ҋ]qB%AF6%+Ģ=}hN Y,%[F&b@WT͊Rv18 qgQNKF'D0!2}XzX LlnIQa6TE3w6xs"34,Z >G/2PZC-z@ P5MD|s QW/1|RGF95D|G2Q3+Ĩ6aFKs4N&8Ί bݖo3#2\;aT&EOWYN!xS!x^Կ| %ftBʨ|"X,gx8Oh+G>8:DVC۷rcZj0pc͒hd nFKco#PDęn/7|Ja#=7 Tύ5kX7 ȓkvDD3@̏ƺd3Kc6<-DTxՍu64 Z9\1 BH }SD90Bi}f7m-brOd !matan Fat?a1!z,D#Cp Vfĕ [iCcb\ǣZnZ2wd(kAdjjLiiq+i:B9- \ &z,Yr_$F92U.F-r4CaX arq3,o$VvA|W2gbu7@DcGeȄBOr^n$ &! 1a(b6$/k#=|jIلx7afK:Ѫ8.Q3TP+>I2e\1ĩk5[^^ф!~O=m!!3B$\@ ID~4ax'5Ig8 Etn%Ј.D2~jW.n7d,":% k[O1QPO)Kv}bcHFy&ZLz!駑lWfԳbi8bƏ56v98!- H;#lGZy.No42\GUK|$aK "#f$S3(`}q #k%.T}bN֧"MXdټ1 !+p>FǑUgh4n7B8!7&ԁ4J/jc^*0_TF(OXW[b`=B1#cOzAU=G#B0ClWnǪjKaTNj+\P$ey |H`sԋO"lL!xI^(֑Q(G1?]ʃ8 |\c\c5CDkҤ7 }m cDXv..DԤYhy"p--?B$4|qmCcfFI~Ee|<曗r;CR3E=6%xox>Ѯ]nBMT{՞h_z! o6*>zI5EZ(ԉ#&p;䮢.ɑ*O86 A!*X(cl\9cCp?K%8<d ϸPZIMxs{!U5U29Z6RA$8tV7uAnS3ek~^$,oܐT+)R$e$vml)\wDZ(.L1rgQ(%+.WNfBjHZ_ZmdBFCKkyoFdݛK*wtapW$$ЦԊ1`PDHԉ3`1MCI':k[KK UNLԉrR:V*cQ8 PH@ReVIREXIT(VFA; GO#,"O-jd@ Q+]^"A޲ ?\fpYdpkqH2C8"gK"+xh$6#ū=s&`8?ep(')Y@PTD+  t/\D%7T3)eFsWΡˌvR` 1@WR)&5%i7Ǔ@ :UiXi(<7J|Onq.'c7Zlt|1 ! Տ!ę-Aa +GL;aaʠ」ڥ&H>> m򛽄X/,@w" wu1g 崇cvalufdz@SPNwn{(JI j8bu9!mf f*PI>. O&>Ig K[`wtEgH]T--sK |yw'oyad.117 ŭE '!52ȈRq`Z(^#[N@{fD^ H1lߖKVU1c&\@9G rM%.%V*Jf:2ʎCi4t('m+qapi#uQ!ApF_siz oKnu1}=pIƦjS y誙WSTuxCvռw[iI!:c#EI/6WN@1ϫ)]uoRY%X>ih*35EJN}4ʣrJ$}4{eG20mcX53CJОZS$DJ) 0EIfbeDRUxO()/"*J0|RE:;ʬHBh@NN,P K!߅Y?걹-߈CDoUF3+1WCqz0J-Gud19ߨF:(`d ټtPE(w O m)jǪIgKv8RBo#(qꧏ5)&:U¸F%k%ABF0i(eU:q$dR^gsev\P(qFlC3j̊?L]'t AB5ڊ1j |**k2~xSL:yft$xICOĻ6:Hօ.~$JXӌܱQ;V*4gL "7q=*'19Cj"DjPk;8%Np @3ښ0A_6/DO-;);5C*a2A7BB2CEF-\59\C˟>? t(8BgU2Ft~,FqYP6]ɢS#dm,-GEu-R2ÕLP;lo3DBi$ M@85”+M݁!B8]r9&JT7B h$F1[lo%+PS(niڡSd9jhdϜU2eAH B$AJk1w&zYMBG*Sb!>PD66ddѸ1Crx? -V5Dthݦ#DD/JEDVf+J>J3XFqeRwY-rCT!a7 ilQP.l|(PCȐ;jEhKC&:j.2 y,O;5Ȍ?G>APOW Ker]xŌS÷PP\)PDd, fb)YO}{#)L51&%Dِh!90e-$7Cz- 2i髒H(2K9i9eإk"O#rS23Z<ԗ\gMrd-eLs|*l fEcX-e$ZnQ[5G0% QŚ%s_G hc㜑y~`SQ4Z%" D6v̆;7L,qc*;ĒdbL)d8SF Sd9D[c7L,ݳH`%gSJ$Tc9QfD&Xi-c25Ӣ鸄U$4X2JSv"tq~c莍%nd*JCDhcr+"N6NâƘ 6]dC (a)9dBG#aKq(.B 79p$qr d7alt..ġ6.~{ &/G*Kǰ uY|h&W 7晕G&R)9;X3@x8B~AidP2"TSȀ+tQW$"__RZSJw,q&,nEZZ_)t!RP43n9L=p05a$`,߄a381ye]FaA d3HA$-$l׻bN%4Ө-!oti>%-nl5Qm%Pt~KetenTbH PߚHfo'O䲈# /xr# YAyp3QX.`V,pIRΗWptfyɺ nN(#蔪k>>4қ%ddp; _1;ɨ٧vjCzj m!3ձ3$+DqK)P/E'gH$' Hu\ <~4_l pd 4s_LWgtoFjH$3f#FB=DyFg:WFQP`POq[kԼ<_H!la@vu5ݖ@'!=D$=aB2:YFn SD0#bK/JAM v1Y!wSpu9P_Ib!z9btDusA5B/CSDsZ_@b4@kQ't.@_#hmγnco> glp0܂r]relp8d3d p}mx2/_HH(F\V*vxWU3b /m[ޖ'cf|puXgra ,hNA}TbTJ[ZaPb X(n%P*3B-%OyeT*7;wn͆rHZ?4_ 2bt2';G_xu]O?6:?G#8g;ibP F؏[;nXgiYFՐfI)ƶnJB'ȁ6i~#e}֒; sa ti of(C de ph jam3mby ckA 2Ȕ0F$buerq(4:c2IƎJ!wD_υl1pat eu $8 o ,dres d0s.l 0X \TIMEDATMOUSLOG'EAPENVIRONGETCOOKIE?HISOFT__ Y8/Runtimgerrort lMwmodui6file on #*ER~vA9,BL~$m'X:Hk;07g:ї? qA1°fHG`d RB~9t` t`t`tagJC#fCBN D ,!qSu91vhE6 085J0G௘DY_FV0f("Jp!6.SCN0  fSO`%Nq9`8 ST,J 2.Ъ}R3A[^a,h@0@<+P>"s+_n t5j*X )K (eЩiĢesg үV $~V h3{*r`"expdJg"hw `Շu6pb.pa m2ptTwNMP/RnNs]5K6`ƷdNJgJ_D]Ww @bJg>%$(`?8(H oIg`Zڴ0Ada]2 nf*0=1g 3 j]0ۄ{ e]tuHHACtUǞHB#"kJԑ?f33ۂ. I!z.. PINHEAD PRG {PINHEAD TXT ~2W``rXBRAPINH OJxgJXfNh]H hKf~Jhg hfpHClB0:gPS@ h $HJfg \fRH$HG"KJgf`JfJjL2` C$"` G JQLA)P z`NAJ(fNu KJb KJeBh oD*h"h$o.b ff *E Rmng Nu" ҨҲf/|KJ`AJ(fNu /Jf"x"ib"ie&@ HfBh$o@E*j"j WfJgb$b.b ff *0gNu `f/KJ$:f`Me,@" |p`Qrtvxz|~0@2@4@6@8@`HHHHHbNu oAC"Hzi?< NA\OA akK4:/ /<??<?NAO B5a` PH13fIjAdBP  o ;g *f4 -.fv -*fn  oh  f  gJ%a6E$`J L  g  o`g4)|`B  gJ%a)@IARP P mp`  nSMJg  oJ%`VA0Hz?<&NN\OA PlH?</NATOA A&axBgHz?<NNAPOJ@fA,CfAa`k:aBSEa> zaDHz?<&NN\O0:gBgNABg0:A.CЈ/?<1NA??<>NAXONu/?<NA\ONuBg/?<=NAPOJNup 9b 0eH"HЁ¼Ё`Nu xC2Nu>:|fC2 bV x0<: P FfB f8 Xf. X f$ mfSHC"AC"C\"`$THU@fC"C"C:"08T xVXHU@JgQHz?< NA\OAZ0NuC""zLE GIn&G ISK" QCj|eCғ! C!Nu*.*PINHEAD.DAT No vblank slots left... PinHead 2.1 installation cancelled! p PinHead 2.1 q 1989,90,91,92 Charles F. Johnson All Rights Reserved. Programming by Charles F. Johnson w/ help from John Eidsvoog Shareware from Little Green Footballs Please support shareware authors! ENDPXSS ֬Z.Иk2g1 pf3zQkgtaKɡ̤hPzl3XdB6 d웄*6\m>g ͧV~@XׯNaB6wh.zrb3bd`/Qn(R:]"g,ѥ6H@* 6ۓ04 +0*a"[W C`b^VL:flu1p{.MRS"b Q>Y>z JlPfbQ"r3nV?;C,\ދ bbx)tp_beSr9?2Pfm|`-dVnF,8gfd @>aFR19.HA+ pX"LbѕB6B4`0+2}г!b9A`Ԍs ?d2@mdRA%01kXgf`]^NMXf -]p;ճZ%VpMf濂gtH @_UVS`G\t`jpD[x*&I[ VK gPg*6g$&gڦgJgҺ'FR,mSJg/rCrr.h&_`"w;}?p 2|hYnmW8pNULHnl(  42 S I j-V PINHEAD ------- Version 2.1 Shareware by Charles F. Johnson Copyright 1989,90,92 Little Green Footballs Software All Rights Reserved. Release Date: Sunday, January 26, 1992 Introduction ------------ PinHead is a *very* tiny program (it uses less than 1K when installed!) that should be run from your AUTO folder. PinHead will drastically reduce the amount of time it takes to boot your computer, especially if you have several AUTO programs and desk accessories installed. Every program that runs after PinHead will load into the computer faster than you ever thought possible! And this speedup is not only evident at bootup time; programs will load much faster even when they are run from the GEM desktop or a shell such as CodeHead Software's HotWire. PinHead gives you a lot of bang for your memory buck! PinHead 2.1 works with all ROM versions of TOS. There is no speed improvement in version 2.1 over earlier versions; the only new feature is compatibility with all versions of TOS. Even though versions of TOS equal to or later than 1.4 contain a built-in "fastload" feature, I decided to make PinHead support these TOS versions as well, because in some cases PinHead's fastload is more compatible with improperly written ST applications. (Two very popular programs that don't work correctly with the TOS fastload, but do work with PinHead, are ARC.TTP [the original version] and the GFA Basic 2.x Interpreter. Desk accessories may also work better with PinHead, because of its default memory clear feature.) If You've Already Read This Document ------------------------------------ ...then skip ahead to the section at the end titled "New Stuff." Here you will find the revision history of PinHead, with any new features (hopefully) clearly described. If you haven't read this document before, please take a few minutes to read it through. Your enjoyment of PinHead will be much increased if you do; there's information here that will help you through the most common trouble spots, to the fastest ST bootup you've ever seen. Yow! Yet Another Shareware Plea -------------------------- The first three versions of PinHead (1.0, 1.1/1.1a, and 1.2) were released as freeware. However the response to PinHead on the major networks has been so enormous that I've found myself spending more and more time answering questions, looking for solutions, working on the code and the documentation, etc. Therefore, starting with PinHead 1.3, PinHead and the accompanying documentation are now being distributed as shareware...which means that if you use and enjoy the program, you're expected to pay a small registration fee. (After you've used it a few times I suspect you may find it difficult to do without!) I'm asking only $15 for PinHead. Please pay the registration fee if you end up using PinHead regularly; if there's no shareware response to PinHead, I'll be unable to keep enhancing and supporting the program. If you decide to continue using PinHead, please send a check or money order for $15.00 to: Charles F. Johnson P.O. Box 1250 Pacific Palisades, CA 90272 and indicate on your check that this is a registration payment for PinHead. This will enable me to enter your name properly in my shareware data base. If you have a specific question to ask about PinHead, the best way is to contact me through one of the following online services: GEnie: C.F.JOHNSON CIS: 76004,2232 Delphi: CFJ Installation ------------ For best results, PinHead should be as close to the beginning of your AUTO folder programs as possible. If you already have an AUTO folder with several programs in it, you can use CodeHead Software's "AUTO Organizer" (one of the programs on our 'CodeHead Utilities' disk) to make sure PinHead runs before most of the other AUTO programs. If you don't yet own a copy of CodeHead Utilities, you should make a backup copy of your AUTO folder, delete the original folder on your bootup disk, create a new folder named AUTO, and copy all the programs back, in the order in which you want them to run. If you have a hard disk driver in your AUTO folder, it should run before PinHead. If you use the public domain program FATSPEED (which speeds up the directory search routines in GEMDOS, and is not needed in TOS versions after 1.0), this too should run before PinHead in the AUTO folder. Why? Well, FATSPEED insists on being the very first thing in the trap #1 vector; and PinHead also needs to intercept this vector. But every other program designed for AUTO folder usage can run after PinHead...which is just the way you want it. When you boot up with PinHead active, your AUTO folder programs and accessories will just FLY across the screen, especially if you have a hard disk. When PinHead first runs, it tries to read a file called PINHEAD.DAT in the root directory of the boot drive. See below in the section titled "Configuring PinHead" for details on how to "custom tailor" PinHead for each program you run, to get the most compatible system possible. Disabling PinHead for One Program --------------------------------- It should be a very rare occurrence to find a program that needs to have PinHead disabled in order to run. However, if a certain program does act strangely or crashes with PinHead active, you can turn off the "fastload" feature before running that program, with a special "hot key" sequence. To disable PinHead, hold down the Alternate, Left Shift, and Control keys while you type '0' (zero) on the numeric keypad, before running the program. This will disable PinHead, but only for the very next program you run. After quitting that program, PinHead will be active again. Turning PinHead On and Off -------------------------- PinHead also lets you turn it "on" and "off." This is different from the disabling method explained above; when you turn PinHead off, it will be disabled until you turn it back on, not just for the very next program that runs. To turn PinHead off, hold down the Alternate, Left Shift, and Control keys and type '-' (minus) on the numeric keypad. To turn PinHead on, hold Alternate, SHift, and Control, and type '+' (plus) on the keypad. This feature is in PinHead in case you find yourself running several programs in a row that don't work properly when PinHead is active. In that case, it will be easier to just turn PinHead off for the duration, and re-enable it when you're through with the "problem" programs. See "Configuring PinHead" below for a way to automatically tell PinHead when to disable itself. Configuring PinHead (the PINHEAD.DAT file) ------------------------------------------ Since it's hard sometimes to remember when you're supposed to disable PinHead to run a certain program, and a system crash seems like a rather harsh penalty to pay for a moment of forgetfulness, PinHead has a configuration option which lets you tell it to automatically disable itself when certain programs are run. You can also tell PinHead to clear a little bit of extra memory for certain programs; this enables "problem" programs to be fastloaded. As mentioned above, you can create a special "configuration file" which will be read when PinHead is first run. This file should be called PINHEAD.DAT, and kept in the root directory of your boot disk. PINHEAD.DAT is a standard ASCII text file which can be created and edited with just about any ST word processor or text editor (as long as your editor has an option to 'Save as ASCII'). This file contains information about programs that need "special treatment" in order to live harmoniously in the same system with PinHead. The PINHEAD.DAT file must follow some simple rules of organization to be properly used by PinHead. All lines should be flush with the left screen margin...do not insert spaces from the left. The first line of the file should contain the letters 'PH13', followed by Return. This is the special identifier that tells PinHead this is a valid PINHEAD.DAT file. PLEASE NOTE: The 'PH13' identifier should be used even though you may not be running PinHead 1.3. It has nothing to do with the current version number of PinHead itself; it simply signifies that this feature was added in version 1.3. On the lines following the identifier, you can list each program or desk accessory that needs to be specially treated. All filenames should be in upper case, with no path information -- only the name of the file itself. PinHead allows you to list up to 32 programs in the PINHEAD.DAT file. If a line contains only a program filename, followed by a Return, PinHead assumes this to mean that it should deactivate itself during the loading of that program. This frees you from having to remember to disable PinHead manually. If a line contains a program filename followed by one or more spaces, followed by a number, PinHead assumes this number to be the number of kilobytes of "extra" memory it should clear when that program runs. (One "K" or kilobyte is 1024 bytes.) By experimenting with different sizes of "extra" memory, you should be able to "fastload" many programs that would otherwise be incompatible with PinHead. (The same programs that are incompatible with TOS 1.4's fastload feature.) For example, the GFA Basic Interpreter apparently needs only 8K of "extra" memory cleared when it runs in order to be fastloaded like any other program. (See "How PinHead Works" for more details about clearing this extra memory.) Here's a sample PINHEAD.DAT file: PH13 <---------------\ GFABASIC.PRG 8 <------\ \ USCRIPT.PRG <---\ \ \ ARC.TTP 16 <-- \ \ \ TURBOST.ACC | \ \ Mandatory "identifier" (must be 1st line). | \ \ ^ | \ Clear 8K of extra memory when GFABASIC.PRG runs. | \ \ | \ Disable PinHead when USCRIPT.PRG runs. \ \ \ Clear 16K of extra memory when ARC.TTP runs. \ Disable PinHead when the Turbo ST desk accessory loads. Please note that unless a program's name is listed in the PINHEAD.DAT file with a number after it, versions 1.4 and higher of PinHead will not clear any "extra" memory at all when the program runs. This differs from PinHead 1.2 -- version 1.2 would always clear an arbitrary 16K of extra memory for all programs. How PinHead Works ----------------- PinHead is based on a public domain program called NULLFILL, originally written by Leo de Wit, and circulated on the Bitnet system. When it appeared on GEnie, I got curious about it and took a look. The original program worked only with TOS 1.0, which didn't do me much good since I have a Mega ST4 with TOS 1.2. I added compatibility with TOS 1.2 and 1.4 (which turned out to involve a bit more than just changing a few addresses!), and had it check to see which version of the ROMs it was running under. I also added a "hot key disable" feature, optimized the code to work almost twice as fast, reduced its memory usage by quite a bit, and made it compatible with the popular FATSPEED program (the original stopped working if FATSPEED was installed). Then I found a way to make it even more compatible with certain programs (programs like Microsoft Write, the GFA Basic Interpreter, and ARC.TTP) than the new "fastload" feature in TOS 1.4. Leo, if you see this, I hope you don't mind what I've done with your idea! So how does it work? Ordinarily, when TOS runs a program all free memory (from the beginning of the program to the end of the TPA, or Transient Program Area) is cleared. PinHead sits and watches for that memory clearing routine to occur, and when it does, substitutes a much faster clearing routine. In addition to being faster, the PinHead routine only clears one (usually small) part of the program's memory area (the BSS) instead of clearing all memory in the computer. This means that programs start up much faster. (This is the exact same method that TOS 1.4 uses to implement its fastload feature.) But a few programs don't get along with TOS 1.4's fastload method; these "problem" programs expect all memory to be clear (set to zeros) when they run. (The ST documentation does not guarantee that anything except a program's BSS area will be clear when it runs, but some programmers have made that assumption in their code.) To get around this problem, PinHead allows you to specify (in the PINHEAD.DAT file) an amount of "extra" memory to clear beyond a program's BSS; this extra clearing is usually imperceptible unless you specify a very large amount, yet it enables PinHead to work properly with many applications that fail when used with TOS 1.4's fastload tec. F`.. RDD3INSTPRG )W ICE_2_40 R`RDD PRG )`JRDD TXT 1`US` %<`Pack-IceI *L,La*oMGLA "grѓg f``GP$]t***Ԋ**EL ;H ;C&NN&&Sj&n".扑&&SjN%a*d"ra$dCv !a"H@@Vҩ%QnNuf%Nurf%AQNuCtaTxr1 Hka1 Ag"CvtaTr1 HaBq jD`rptadpt?aBC@!!Q`R   ICE!`.nHsfAO@dI>$sF̢U:SƙOp~*tqNRhr=f=l|"h}pt.G&Ȃ:Fy f0;"[s%6^| 1w` 1ƞ %<a%:g^2";r@>;f9g\ %0 00`10x64;3;c0d\dSm%3LAF,*@ `0,>bfRbHs"gp,F.W܈'3k@$oBA:g fp|Dp#:r)!f `4ݑ9Tpz$/dc-ly f. jkg#j`BR`:+՘櫶#J5*2-w+°gQe9@WbzVw3 9La B(.t8+xdhx)MUF.@"H3>h~ cI*I`&VpWf0-GJBgkB-dn7,8s7,8vs8$f08b08Vݰ72nX8(a-777) 7p*Z>ݰ7vr"0'7ZpR(v7($Sa1F3_ g(NfZaՈhj7$ـ7:gP HmN 6 m 's5` Jua'p`wlq2nw6j2^ZїND|T4]*\V`26 ]<+ZYڠܮ] ,p {kRjޕ!@6+@nLpּj9f5J9(֐f5.:chp{|13?l]f /&K%JVRޟgs.]Wxv "R+H`Ȳ"Š,(-vt6֓|W\ujնWj]ZwULīֆ]mkp.ƪuhW`4sȪuJW\uj,նW]^4uֶW]ZwUЫ]mkpzҪu^oj\Ԡؖr D~cvrd3Vdu6ڸ\nU3gm.v֫r?2\Ȝ\EXar#Nro 2B&g~"qVGn +@U+| ,D"@|zC;lkgxAY[ y2fRyi zof]Ci8W(T+,;3f^2ÆRZ3'!`A-i^< 092<;SWa>."N+@,bMЭ nqR h`v&wPvgv mv opȠB4R`"% Naܼ!5F$f`>'q'3 ll?6k 8hH!HXRm(i 0-koY[Bm'~TZ*-ĖJKȴ6& D Л h m Mִ6&D؛h [M޴6;Qo#:~A%Qpٚ|p\7SgnWu S"x[h~.zU6] < eX~^6n  m6Z -#f$&F @(P?^+@b`KJ-g F5j:`pa ug%>0-<3O?l_00֋$o,A.0=-Dg8k2 bZ u uRBIЀDƵfRy( k~r<J@ft8@[U,T{HnpE PgP=H`LoJg&B.Ca8aD:fap-I~p4έ*Rg Ed>pEk]F(Iv uNs%' $\P'҄Erro}+EBReturn]? ص 6g g>J.`A: Hjr-D@+dۣH; rH_03O W [1][GSEfoLsŠ "_KxMmZ V>,@IUV5HQs$d-H,,cDCx7I`BY+"JrsW"QS7gf_(f$ AfA`ZT-J(&20<rX0]E-Jr,1Hu.rҠJo4" $`L\U& f@AH<>x+H{buBX?` KO`C9 agfpNe+3l,55̩bڢ )@U!5,#|`O Hʑ Pw : w]`U0ELf>$H$&"BA -KaXEB$f B &nGl><dgpVd3tN M ( vj@(@Pe!xn׊"8F`:~`H P]ီpwpW@+pL=H C=L||o.NpqXLNA`q`,Kzހg%ut~y"-Hpp alpMahgN8fTTIx)r p0w5`pdr 9NXT p,Ap 2:bU\`(+Xpea>pZd&෋ZHμB=AHd0.20h#=B0sփrpsCqt e$8b00PË3 r22~".|aNBW@\"JJӘA>gJ(` Nz uY9yg"kW.)Y0 UԨ> ( T Z+KfB 4\ Bu@ e0C&0DG*C A4(*B,?$<,>2::(  0 F..26WZk"?8Q"PQ1E_!P1P!0P@oG  q#/ap0a O:Z,Noc)c' rdAd6g,BB(rHo< toBt8`dmI+`ZnZvtIjTOUF5A Rg,afA`Hpj=Լfޝ$>E/$qgrMgr>6Ԭf?Sfgڭ@Zgp<:6J@ `v:gl`܁p*g{@p=!wːA$`B,B@] .kz0-qD'ngz=, v?Yj WBgE<0$Fk:H~d. _0k$ ^rcvgOrW۫2 p1m(p0ƪTAC_ I7^BYpp=h2BXފR.LST:AUX:C:MIKB:VID:oֆ+ Q{E[ ʺ&&YY5X 0$ C QzgmȜ /P0 C/G%I 4%_mL:HE:+4VHHUzrЁЀ`z@#L@0ˈzdia^*Aܐ2j=d=".""NFB,f6C !U! "dE\$2teʶ[f"t$A9 V%XA(B;N5 DgOR8/.TNA\*@Hz H1i1;} ~3_^z,N@ZIb wbĖ)HAR ,d Z޲G{/ V]byQǂ/ g>4Aev}v,0 :R@kBZ$r hr~[ *zƍq4SAk8JA΀ \0ufkJ9$Iƛ0 Uq46qY$0[J,ӊso~N: ) Afshrrag`af`ae `accm^Zd4I P4@m4? Vffth`tpa ".t{2dhP Rrkrf|rg|5v0,:pMݑOVGZpok(~*mvvt)`tٿ tr`$t@-A#=BrjNz5f| e`r6 @I2o A|*/rΘp|e`rEpx`6؝$X4f3? [d8'pd8 n B2et2o~X3BpZXyΒ;Whb] zڋa""HJfS g̅8usL3O|'a "46-V0(0BTcBw[v0 [O\pܝYaH`0< G2 Za2`l6cCJ"pHza8+"J rap FAR@RJn , M=|7 kVbpp y9 -BqUG,x{BpHl1b0XPۀ!F$ 9:M0LJ, 24<:_ 0gb"X ]_M\UGk*<(D𥾳`p`>T p`pJPg~ZV!E؄1݇zsҚa 00N*D~`x$I"t QIk"RGef~x` T ]fSG`IjZ\FkBJ}*gd-PHS&I.xdY`#֬"י r\9gwr&i66fS?.Bn>L=_h{͕rcDbQ_HQHPb6BRo K0*9i$R;Ӊ e`{ .`"Z{P7.aӚ@#jy \ _& &6񇶵3zj$g gq+8 q;0$j8'@A.$D!^@"fXծr(`rap`xBo68H42$8"x>g"P2|DAH"2gZA^Oe2 %#{-V1@A2<XJX[j]`pCta.m$d\?bN5F?jw21/R"6Y7s{C gs&@0v\Aܐ3֘d`# AL<H9 ̢̜L[tnv$m f(#72ebJ6gzmâ#Ha)9n` 4gU>b`Ty96@!2;d89"ь`rְd-ÂPIW2\"IdoفdX`3WK/JAnFiW4(Z7Ae4ްB8\R\0$w W P"X|0g"r~ RAfon_?1rD`JG0#f jVk" C gTf&#o}"C\Pv6"cgRCC(D#8`E?W̼hydf"_&B[NpZ@ r Op"Pv2JH`!f6MBcGCPc7J [& rm$ Lc4gg4vGBo2}x S$vD@BqQp N@BjC2`a&8fgX*ڃ͟d07D5gfր= ?W0QB ]md&ht_' ޘE?%2QHdA "`\_HzXoP`P(cg؀4n6jgD@v;Zv6^b{2"kSd"U8JH_mf\ j 07\@`ȮUga<0=^d|]@@< Ip?~`0Z0R@f|0-HnFq{"~povRHS`7&I>[\SG?CNMXP Q _t0&_"^g `af*apjp5`h'`ɐO` &Cֻ`Jhf XJfuRRRRRRHP? @H~8~G~#P[<2 `f$83]f`"RA~Tr`&L "Ѐedp)fJfgRe6?gЁ`A"G28$H :CJE`%YEjT"_$P"2trDD0.Hd\ QQGpjaa D;2a^ K"8g42 gk2&HgS$f de $`]=, AgeAǬ`DkTxMX&(^Ox`x$&րo($E^$"^@V@ K@ S`g:ak#&Ac(bbrk%ؑ2+,_SAI3 Q&f-I$&. zTL 6rPHH`4̦\d:"[fnf/a n40(Y~kjYJQf 瀀R:LP|PC&A֛(HDDBg/Cpvہ/P9 L6C[RCF8:GFWfT? t-K u$I\|c$YbfBjQ C0FpkA' 0G @`*؄|AHO؅X̋$_ IYHR"H .1`e'` ~;2$o !Qs XA a@5?BA݂10/t`tt@t|t >ttttta ())a @v-00HNur`r`r`r`r `_`r`r`r`#FHи L` Mfr9r>R[r$aHy=Np?o?<?NAOJkpY':/a `ٲ$e`K;[GUDDB”iIkq@' `, % pF%ŗC C4ه8ZxgJm<Pj ʇxHe( 9DC -s` -s| -sjW<!O`m Ue ĤFF\ȩJ1R!*9 G U sAM%kXV:јØ`9"9$+Հ*@*l?jcxf6ʑe*%B 2 W;R6CosasOo 3K 2sWx?LR[>X|X2%v()X [+bjg\?+q'XӃk]j͸a\\;@&n|%K:WgqޭIe /Yu AmI#'a'=y[޴[J;X15g ApX/0+x)xnbxf3qu y͈zm) 1cq]taxi{Č !Dq5'nw 9ۈhQlHodBM_p$zvFgyݦl'mϺ$CYwpb/3̿qѺ :J7;ou7݌>yfHo%9'R1.97ݮJ285ODZq0cXNIL3[&v51LˈcC]x6C3BFebrz|3a!Z86$y fvnqۡ,IqIJf桀˄xMwW.7BF`hI0n+*g/o21kù9}; 14gRRKunwp4A~ycO[`pI 6c&oosêqp@dVAqonI'bXKDfugVn5-1͢>;,gդSTuV[gA߰No-H`5W30pr,27rSep6U͇$6: I3eˆgbCu\1΂2,Ve,5agffձkr ąDem14b!5 ylnc{|sZ "շ.b*J(uL199֊Vdw׎J<fm&_Y1[U,Ew'^kisx.xzn3dJKi]mBh,r[rx+r, lUgUUru۶O~Fy,+YyaOAӾum fxsj)xGj(g` 3dsqމik(I3ȵfdTk ֘)E5xM|rvPnBNeoᖡGhb=7D y'37sqwo|:aLLclnl 6j;78i:fV6=(6gʉl..)枀a5l-ffmSjYGEMDOS Pv=muk`lO]H g^2ޟ\3x[0.M 1 zBwtRGV7P$BܜxY3YQW6y& MtQ>)V%lmulti<OT %f쪭<}3X2000}V<`G\clt-;UeA+ĜPev, \\e:6{mNaif{^qwrlHiduҺh `2ӜdsqxVuGZ3Sp*eA|Y4t^UxgB*.TXT4+5 }dȉtru[QƑ8}-&ҹ햮cif0f:88g%o2c3ld3i* aMIlyXCw"5qi%b  P8k-I#q2.40}g㍋]NQ}i̊d jQhu[Va{s[AxWF^c`oɍogt Qfݸpbd\+ӃY]ab0 ,P>,bY#sVKrᜆX5ΝZIPC,ZOO,ARJ,LZH%sp-Z馊75X,stciSݘV%b68/Yteˮlc:i`MNf4o=ercZ̰i^8hhVk}uޕxm2E =Degݪ ?川ݐmpY,pSecombOߐtolubֹT/fn9yG,[ 'PICFILE_-<+na>' usV3a%pix旪X+) i <؀`< yXy\SQgeg/n"mexg~B c93b.OZg^tq,MFAW' rJwRaLdB{Ŕc\0 `b3vkokFd dS 4VsMwoQw^Acrow̍BtE"e<n\BwBG;҅m!G^q,5#'=B^ 41GΙl& n va݇goVh Fwdֺ5F-1byi*36baFG3fupCa -O7gEb_Vkc:zoG3NP.MNV7fKآ,wccoZ`kE\LMYb xxghbl0mP \21/3x4ks~ß u:&/öҥwXtVk }k6Q̹Y8PfC kW|~N [1EGk^CŔ cx#`& gB&k#sz[/kehr̕:x -x.cviׁG+)n]:6cglk.9|WwAڰ#`-ao]mM-F1YzYU3@11-20:GgRK@ [dr(TEhL7X==abnfw|;s4v՚2x QIl#Pt~OCm%#qerfOW[?8Y=>/YBx/2ٙ/dMɹ fGS68Ex_lYLyji5<̇F HN¡Pزb<&y'QkLnWv-q¢GCpb%r& A<bE;*1agv~ymҡ[b~4]=JN|a KIٻ/c%e=y<;$CIŲ62xTISizd0']#=˱տT|cau7qɹMG&25ysn!c\T*3ObcoA{#"6Y'gM'w+ 50/60HzuefBKV,Keyp*F'`ذjtL{DF-fsup۞fxvmrnipND7.(C&]fi c O99#t6Gf_aw)W Off0Λրc,qVdKS6D2\ۧ sڷP&=q[pbWk$oyO-Uۂ,Kߞ*u* bm,dc. dylRWXE]$`:YÙqZ&_WB eDN+]SM,u6 Vr9. 7Ff$̶1uIup8XeaZxsn@lrY~3xrwfBtÚaCg΍<:ݸ(z*R̴Qs)Y.5Ɗ'<ʂ<ȐIDy-#cx#Offl 'B<3\\?W`C<'@'$ 1.82oUįkqq{Ua*IXx svqQ~[C>/ xqaL{cw0SJ-o(MݪCg԰+Reqya^1o&k=u.߮=H &pc d~k+]nx+arxmul-$KzufeU[n?|K#=; 1f]ntMcՏX,9&RhHG48MBxeKW 157N<^M124Eo?r[DzFql`J.ColauInfoBXMwG -|EjYngwi}2lm9NF$BJ6& KVo k|Meg@CD|G^3[L+exo&m7i҂5f:n6< ZӛKg[Y 1΂P蜕N뙅?7h(p'tޔ4_gͫ=; 8XgS :D3)A9:Wu\am{f66 T~ rBWay Le7LE5lLXLEngxd.K8ƐMyx xp(po) |sR@Yz.KZvco.ukK:w!ch8jv.7ZwY1[*'expЬJgFhͰ 50?<\ 1090skɭn6/f$x,"d(^^aN3!zey(cn)A5xQs,JeiT <h%\OalsAffTB&} bfcGbFrxgG,Y*ּ(<ݢ"2l@جJ-b( US$4)y^L̹Uh&DT@43Eb:PLibr.g#X:BBSm"f-3dlvS; YO5%+M,cq늋rOmp|E0Rna,!7,Lak:Tm; DBAx`agazԪ03YUX,f(uVp m/ sdLfbysqa;p+9EЙ'EV` -`ZIc;\WhgY2.I'mOdUpu0|*i(i^cL%ac%#Y2w2h .{I/Kf0NO)Lg^4%5ueiCa(h3/M02g.>`:Vn-SذBF0EF\/Tfnqmo3xVam0t aigh[suMRboarNGtjqɵi46BNeōW fӥFfnky$:8l% bÎe3plaVpictures?DSMTOStQF: / G;ev ʑbackgx0u pr`ndocumen,Ett,.B; JFlHsupp/0 for 030/040_nclud?` DSPjusUimag "scrolling sp0acthiwoul+b ,gZ<NMPO?<LNAJ =fJt 0m Bn&pҁ҃҂`@@gug+|#v RNJg)A$ /u$Vr2,e Ѐ)XH x \2(I^BNu ,99hL̴lf-H;4~[ }C 촉 6S B.*hjm<5^aKPLiq . $l`2wH倸ܸjp@m ͗` ߍq|RF FGpe~@<[)(rPt̋RtNGAB=vg=p<bxf)D=6?y`vPC@`"f^" p6ɑsD9@fyibW,cR [jS>d\Ii vC pfp kp, kl6Hɷ@ r K"o{da` M>AhfS +/QCh,=rFpmBNTOU@g 9Y=Bldj(HzNZXOhF05l.QpjF>t,xF>|"Qj#TՈF$5%Qj&T%>FQ>QjTըF5QjTոF/5Qj-TȨF,=>` fF"5&Qj*T.F25*6 j:T w>)} B` >1Gs>f%]=p@mܵKgv:py.P-x@hxMi._aXvnfNF TABzET𑼸EX`ODr@qhE!P_OF_E"8$NG8)WIDTLEFT_RGINSMALL~bIBM_FONcGE_NUMBERSAUS&NREDrOR?UTILITYgwEZC+!;y0ܠx3~|͸*ۮjE5@r*?[z^RDR#Heps15 ca \2d. *Hp\B-`SG.n2zzjpC^|`.aLK_+.j 9p,OYQ4 Jxz` d~zf(`RE E냸@90<@/ l׈Co0^Ů]yata t BW1l-j̧[f ۝D+bN1a/}TP&@V.[^BgpNOPg &.H~[/ pK_Js8Q' r "M ~>f~sYdvwYgȸjw|zBGf_b;f `ڞa`aw4a5Ξb&Jwr&p ?=MX6w9@^nL WS&^^TVt fPsrЁrߺWHnGْ̦vN*YҀ&7f ց=6^m )||t:\x<'y:< h g(ձOW'Jff|ø/1 (Z ^,4.Z`UHլfT M`Ts97x^y8`7d`)`WVrJ!6L6s2I2Bks!B1['3\<όrόfs1t S@f AߜuUo$"J`GSdJG:Cnԍ 9R_*>xc8Sg J"k3HH)l͗a!Hd[.赖tG1=C< l=Vt "s&R*3>P,.<#685(؉:M>>!(BrWB2)J<)C=9D=)A=A[C=s y\*.*}rb\SCRAP.TXTaZx Clipbx~@HfiϭOӝsxD12R3PFILEE 37B 9r7c&HWFHzHn}mnRw*,O~Jr[X-F؇$ .t f t fRMoځ hdr f&7n?@ap2,=R@k0/$*A`} zGRpdڀ⿜m$ /NxRe"^F%TNXXF-@J,.>wrA4)rЀ7Ϙ %m>T,.J-Mq Kh@ g3S-H<<)n=p~)@=Bl= ,N^BRDD3 -matting,OxLFilampPercentag_Bdone> Vy(S bytes) | _] Docs Lo*H0Gf:RFp@m[ #uBf#NX3Le_/? NA\" {Z}qqV 6kIbw?#}»()76 |`$܃:gAX)javu8:bD Ū'˟ez) *eGt=02FPBcQf[|" Hp2 }\ftAXC$T?"7$F|`(K$&UQA/!RX2$ I(K.mΪ&KV^FVxT:Kwfn?f 9iTg\$L~M N8v"XE6C2 C>`R(J6``NqpNx I *p`Px`죢$=.٣#d̺tfEzGf(rpg.@ H:s) PU,@T]0R`1wEݎ 6Cxf`vH瀀~nP 3}?BQL.V,Zn^Т4}xA ^P8 x^Hb&z/ LW*oppv_o. C`0nޒ8k߹w'P]3ۋYetE=9n~v r[9L~741[=EzL/,nftDJsp: qNxsƂ! t_,uqR<8f|0Nd<tܡlqIt? {99+Yn:lnOzT |ge2 3J9ԩPhFi:r4|ncdc pmq[\>p{m)nnfv>s>f\Q62.LWv\8D:vKb܈b`]al-~2猢n"{(%f~n6W w~=|4 *&``*8p8ض[ؘ|?j~qOr\>|lDlsF8\ yF<5Pp;.fx H#0HυvxH*+]\P"Fw. U6;4;q:)pn..nJSD) 9o^\ x tExpOn/@3$"2b707xksvnYc( fo) 6x:*)?88t a.6@V9,A xhu:`$9O7l-_TbMFk[pv~opQ8Ś)n 5ٖfS@mv@np;@yˆ U20`(kÆ6n֟;ńXadCl66l۳xP!8v@2ضw G 4XfpùOizz >~ý~[_UQo65<$yTSi@|9m  (iYnUK<6-Ňz>bKn{E9 !tEC+=4J j |V}>W2~\p$fv166 N7Ƃ,_tvv|k{fb`{Hf0f"XƈC~< $6xU8TT8| |>p`~`p1 *~4  B <Ձ.~2Ll8|87Po.p0Flh8l0|7x 8 x + " 3``5ias &wlS{GsQ-)Aܨn :%)89:*mf>`GTeܦ*G@G`cv׌B LQreD8D(e@ s90xxs'w/L /qSY%cpOqE%s_ >;݌b@9~f)@ %+$,7*H&IƷHfWnBr>"Jx?fHf#ॱ$5fƲ(ˁ &VC)\/@ pΨ^*g$ԁ#XRʲ3-*筨2!Q"tF'/Ad 2>V<p8 ^ ZO_PDЁ}RA>>0 B .p;.JGo*5^Z$)CGlBhmXElTpB2po" M͹lmPBBҀ (AAdp >0%mJ"K?c6:=W"tlV4.6txaL^6I05fR=,a xF )0r &'K( f'<"̕xY' < '$@ f &` R3wR/HzLHn5OcUV~ {^2^ "&gFJ ޳̽Wf+p9+dȔHPVz LF9 < mŦeH*$ex62'bB!\/ReUC3 8h{+-=6,)νJ\|0ejCiN0DvҀS)A_@ No/$\2USL}-sP#j4h*p-)@#$0Lʲo;g@3 6="uPxZ?dwJVh%20=blGh~wtL@!(*(`o;1J"LFr@6]Y(RwgXVHp6f >[x8K((rEފ|lŎKędP- 6m 2܁}x. \h)prA ǏY-H 0d"GG'"L`RE Em܏I f.:`~9@TW;vp J@kBl@|˥p$X֙)*E!rA1"`9QfrہoLHjQ> <%+Jjr|A)nz~# 761K,)uHx ,6fk<.Lg$= TYMV3IB&RJ?vC'9 ^܉{nu>8HT~+z : DӘ 1:o% &upgiMI$Hg˙^ nIlg KpoO *H.Y{.D.&o(Rjx)D[^.8{XPD*DZ3Rq#GMf -b-/(&> d4fVXQZr/\nL [ h<^fx&NRs ( S@g$`H`BV֊\$b `&}0nxxʔ` dUu`fQB$8ve^-[2|A @<,!ƳE%@WO8P^ Xi7uU< h (% ]0VWFp6>Z"$lEl"w/nJ`0ЭأpMzKjp.yzx>*Ek9E ~wkvt(Jf`p *?PLhTp@ :TVG86IdJ2 bm52+sUCWT9C o&y[`(6|\:tod As@wEsň1Vu^Yalz`T(H儘?,*Hy"n=@JH2{+gD/Z-D y)REp @m:vxf؍jPm;8D v8mGJmN 0+Ca fJg@A"i&!YYQh|0$ /Rn|f`#JV5 0'"(3H9.=n mG5AH"owt)@FШuL"#3 X(I0|Ӭ/JngT]S_%KzfeI&O̙xwݸS݆0x";s((ޤ3݀r.dʨ6$WR,,S{`{Q)YpIdf%`>]`:6")ovES@ͤeҞЦi>*Vdޡ6n  ~, m|pOgQB+VpP@g `ZFk.7 0`d[ `Rp"^RJ`XfZ`.m=n_$`GRdݶۨRҀm=?raA#4*H~&MB-@ K`Sd0C3\./ҁ<< l=$PJFo*`$p f_GnⵞR@"G.RJ`RGFmB5`o,rt̴޲؀4(x]xx]^\!mx-xATg NȂ/ >DK䚪Fvnam6=Sizeٱby8sLՅ`mPriܓ?agespl_W~V3:P!@Emous3[.Sxpn *HZ>\2T7pn΀]kTC *_?8m"#Lk1! Y-Z9h?0{v?r‹BRGp@m@w@ {q\W0| P+&IjGBg 倷2wRØe;JX{ $< "AXpyTOȠ´fpJ..fpr2ANU3 |Bp!2<H AP= րr ?NAp `#N\Ol+0<zlB`t` f=f,u/wcrgĈtg o91 `|l=$o9@wS=<71 tRs8sk9=&"=݋)p&={V[av=3_odo)A Ȣ+rjB==("[JUVRJT*U>Jy.kO*U&JU(R:FTBg Ab e *U7 >Tp"r<6cc2G 9/\H>brYU/C"N*H"u~/Al Z"Ut&JgR8R@"wR///-/B5Yh2Kƹ ~HHG`.H.@֨.ެQfgdYU+$)·''{*rdҁځ`B9𖺀lJGf~o T@rՆ37Y$Jgq,.HQjPTMg K盞aɘ] JlT B. dC 10(paȴI=f> cH͈!NH2025=3W 3 f#+#ɘto0zJAgȉn`fJ@g\`V,GPxOC Pw8d.6=8#:N >CnB_= -{",<$˂hcqwˬ1ϖBlX׎fZNˮ ^ݥFdb_ ^ ރ!£`n$2 ]y:H(stmDRof t d'6p1 DicHon)DCUns ^i2CG*\(ALT-G): 2ɨBackrdؓY&_,ISoUytglobal vЀH`># Ao"Hr\l[im]Ied`Srplease wait~:Doc6ent number: %d hNo match found, Press any key. |-Z ̼xOBpxER{ +k< ׳ڗk)JWȢ5! e`NΥTfa ۇ51,//uGS.^"027=m"*v: lbh|قJrvՌ*f*wwEfsǺ=xj2m0t3?&*Hx6,>P'R=l>T-I}AZ&< f!KnV6$@ f O Pf:`e:X ` ^]M@H-AFttb xF@˴eO2<>~ n y㰻+BO0|TxTʼv\Ţ;_ρ<(#-@,lN\09Wtb%B6E"C21}hJˑ1Xϝ1T(REp@mST@5YpFXu^Z@n~l84B3PJPJC: Mt͹"V0/$|AbM VL:돌JX9CR9>T:"A| Jf`qX9ӆJƈ gÉV/y+Or vf3·!"fS \rNsFk1됉THҀp3p<.U0OVsxc5hr,SF5BVss zs B:z@[)8.`&o8:yԼ^pL|x  :/ 4N>^!=7@9@B?HzdHʗzRv[ 44&R1RP,5Q8.6C=!I:~>!hRxyC]I'n pnfk$_!_(2( v|:Eا Ez)>`6Ef|0 rF?9E>X3rw!2|El>Vmģg)NJx|f$s̴ge` )^ pr ˆ3`NMXO'q!_##C.XXRF fmMato~<]`J;h.`SFJFjpfM`f[,o1!m}$e%ТZXpVNZ,l _j `2aBr-]gr+fR2܀`$.gSJj, Iզl)}puV4B.?8pr%`CٿTOJ@k~p& pmnp@nhRGg`9G*&BYoFAH$H ,= "R+,`l )M)K`& M88 KN2%F5Q ]< %l=\)F=,sfyn:\=")Nxl'WkEg>6glOxv<pT#ۮ` ֨F5ت03.d//"T @A葞] 4.,H/8߈(;$//B?<NO _:"ESSf@af̍CE!g Ice!fPaTKaN.(I,I&NBaL,Katd4><aldpap>|8#zQ@"BDCQQHQL ]a*d"a$dv !a"H@@VҩJ%Qyn'("|f%ANuetaܐx2gkauAg"vtaT1 HaBq jD`rtadpt?aBC@g?!Q;|R=Œc f EA\ lA NVH*H&Ik,CpRu&.dN.dd.dz.d޺ Vo]ȾV>!2.qt&٘[ 0. tօlzB6*\u![u![u!-sj7 kU1Nj~r-sflpUZ1GNƠ\Bs6jU*1WGjq*Z0 U@?~2,=6PN0PTOŏc#dZDхp ,< \l|+ *8B+N!5:1[H-ub:Etʤ :en2HtR9h"SXN5H:.8Tcov|G^#xj u50v:2/Tc-S% d&qxjݣ\2%˚N{]@L2"G(2&`b*a;B`p*&L(?-. Vd[xYF^lOReNxlUOex^0 x x1 x x0h>11]a/ SMxpf<fvEU7h( WzA`OBHM~ViewIictuאݰV_v X LL ];lg]g,^p t6 <+ sXl.U1ZWܩƄ\sXcN| ec,R9X  jJt= hTc\RFJP5x*D՘8Tc,RJ 5Ʈ> Tn.4 ( sdclRJ5*E *՘# qV1'z\nszbdcHVRXJJj >`AxCp "Q2B1W)_ȤV)q_ȬvԹJ=TcR2J58*CD^. g^LCP` ;%B|HHF`p?NMXZ`HPF5K MQ>HgJGfrLN^Nu~3X)Odgs2 7< oEgkDuy4rpIM_xtVdI(ƸLNhw.CurswaUp/;BoE aS~ebnMn-XwJHfHidx3Pa~f'XS7$b1ѬDϥ`ka-Efk0V.#7\TALwRm i+հNˆuAMuRipbo@%έa~trԝiCYke2Fx>cBN44京>n$qoog٧:}N`!$n[Cx1kCon;>mf4p^V6P^@fa3(ms,GG,rbexbv[cpÅxNPx(me$Ȅ<8iSe6qEyrMDqui2EBbÀU mn`I!|i6ep  hCftw^WeH9׌] @ X@10)yc qP@ ;!! ᜕ɺ\hh#萅-'mՌ.x66rL*Wr%Le3tkLE5LX1xEnglU.K!T2e` fxD`h[LeYM&d*IJ(6VnobSĕid}! Ygazֆ#ztwi+/ؓrmf..AbS*fڰs.ul $ݖ1ٓauyAP v.]cL}Ģ' qs addOD. څ7c)u.HelpBu F>1,&to1 x"Mor"9+bQ33 413443oOnqTim2I07:{GMTkpd2P1g961$c+I6lD[sB@fsY).m\.co.uk ntXdC0,26Fid52:255/320_˸FpZ90:G0/101UAN2C,51:6/4.42_LȀLrsoff c bob .fr thfllow\(our}:.)supp*RИtemT BBS Sysop,Mt#ܸ;;2 (zUS$4) +}k~'regi-DD' )mati9 for detQV ЁpZ@M- G4ATARIPROU ?Most goo.~PDuari@d on-l services. 2YY~}3^u"4n:\ %0e*&]Bs"sд|\Bg~ q>Fg(h gW`(\`LN`Yl\|@x]`N dd4@0;?N>xZ:Ȗu\RPj&br?or9@ϙ!"B32B.p>V[Q64vTwJFk ygl9ێH`lZwS\ZVb`T[{NDBA>c`dai&&M;s*Ӷ5hmb^YVW96 BetweZIoFȰuZ4\ ng`%WidthqLef/MLginParSerial Pl31tLJ;3Un|cP< Availab>>:zW[X,- Ug2>*-113|ɘH!9Gh 0 ☜%4*H-IWB>ҘĂND>М&HpSf%l.}jΡ:0e0 +[urEe`RJp g&J`|:Nh.RKJf7KcrlW&e,kor6}go5rY3ib`oK4ڂaECo0<6&:\0,8GjR@@*_El :j"?/i7XTSȭ7, / ` J60pP>^g$ Fȼ|y\9=)M<)K=)=k]Ynam[UXLPRNci^^^;rLTe3d< dkڌag)%dJuTPr3 (u7u&PausedHf碂EscapeaQuf[[5`H Ľ\;7:l{QвCrV6Yv'YX4/KB rKޒnQejUnw{ +|*InT FRtnx zqxIDql @Oa ꞇavE\U4.isaڞaZwi 7.*`C^e$\Wv˻0ΰ)ز! pKktXR 8H.+Ga9*HSel t!>#ee*Tp.GTm Commd:lEExecu-`f83 Press any key aL1 |HHF-Kp[.³0rG+=bmaB[qj%.@ArJ^mxrcf|Oi2EYhgep G.(iq`Y9ciC~9V\`0,r-gFYg޲MQ KlVH!4x8{ds5W JffaoL+CTڰpG i;w f/\E 3iC2 ugٓZPuжq4*.Vپ2U: ZgZtn*LUtL\f~>^0v')#H?` F2Ae8>fPu*Pb5BcZd>dH>Jm2,vHl7̠~`&=A@>8Jg/?g켰/ Y p@m3U"`{g h̍B&pgY#FNp[ ,xQa Con @f  v3.00_Ed0/of8hKis n)suppY. rI F!ćd-*6A'TABET=TEXOD!Qq!E$=`HP_OF_SCRENGdNCWIDwlLEFT_q~INxSMALL<1IBM_FON dGE_NUMBERS?qGUSEbRT/cEDbUTILITY%rErf/r 1ώEeKLoca.PRGW\"~C2Can,LBoNot enough memoryr-] Invalid program owbf!*H#4|NȐϵ(zB,#/I@iˡ<VnHzG CcC<lIk)W|1 ,f*`mTY/k:F6ȭJbv/<`Pǩ i62?n*ªjlkƽUp/f/@L*Bg ,POu{,C}=p Юֲ~K B r=@k+> "y>Ҵ3&M.]`p ˄Wni:J@f|Y`KSJnpN[&Iƫؕ0lACrp˪ Jf>'j>d`. Drv"D0PDsm lNPH=5pPĕoDAdy=謜&rK( f D "3f^ٰq/zZ$@ f mlb &_7$ r[K<`Kp|f3C*ɱmBhŨe`"+c UJ-H-DmڻtWA+D6BJAg8E 8vB`s `Vp7FQH@7XeXBd/q"򂌆XȮo$UVCvw檆8b*J\I& θ͇/xG:ÈWe8w vYQ[Ob^ZxxWـREXMCOFsOك &"NYk8 Ά xVzCiaIY8/ ?s$_{ܙTjUK1feo2s-A :˧Cr~H Jf SD`W=| ,\Tv`JxZJDoD64RClv=C57xp*=ͮ @X$wTd{x:؀8)T6 >d4dxd\ҲT M9&[䬻0s̘aߪfafSE;3El7ܪ|YSAAlDVBj`#D&lEo&cDq=@$Ͱ(Ʊz-Bp[ ;aaS4;a0{xi0lsI؀|灚"qβ;8yC:%cBoۓ0x x;?* (5fZ slf r=#>FdF5 g t9/f!bp9@=X̺CV|dm:;@S@@oSSwR- QDKgҭ׼ x\ˀg~Sx96JDjRD=DxS@zÛ"Tϴjբu F1(b1/2SHzW,:P2rEܴ.(Uд~(঵`,ڔ4@#֒;:CfE`gERC5r8\n~Tc{S0ME@ X\%{Jw)sexv5Ԍ l7v\и(G<-9xY|/]h90s+R]`+`[#DdRW{XBZΓ"^P aV_vyNir Bloc\wziw existsWARNING: ~홡 alrody con?psȴverwG"ApWEndQk`OyJSavyO,Н[w%s #ERR Wris EV */Nl,*H:XR:ܙ bZLx Bd(PelX*YΨn`-KIc)3܇R0df2` JEr,:śr:aȂc ġ0ZJ!|SR\=.hafɞaRf0d(x4HQΑ ĖJkx=n~G1uV4J6B\eEځ{e6r 5ЖJi^>)K$2ڎ0|Y2r|Ɂ@!V 86-A[BZ,G2RA}|ۧzAw=zfʬfr]T : datahEc qs0s9jя|` z7awAvaabl5n;܈*M<><*.PGD3 - xcYxKKoYou've not defed thiOty.ZClipbnrd:\CLIPBRD\ORAP.TXT Execuoj}s >ELoad %s. deZĄ*"`x[Pܛ| rЁ?==sBg;:&of&NP1i=b0W`Se%0nIr<3&< )xftF[fHk*m댙 eՌzb/ ]Rf-B5;JGk9| >np(L(jplrl=fp@Pg B,ktH-*t0n* TתPzq{Zhf#Xlhg/*pnfG~U {{^LfJ}q $B2[6ng ȶ~#C` qJ[-y!)Rs=2ld!ze\H#$}|HH5_,k%H倛@fD8?r`pn@M^, ,`g,>gFM5 Kg`<ہ&K؅v[HpU+Cg.+fJp0'2<FH A4jr ?B$V20<bA)J)H@lN.#0vbHgvb$:zSqpJOS 3fc"0+K@kp.TOIR@;ZrG1`3/;8j{J(gH@A>r.jutIQ+.@B=gg'DVPO> bc Uv8)UVM)[`B.B¿P/BgpK?>o?p$XOp;?A\O4NՂ>WC$X kNX^G4y< dJ2#˜ڠ /$2=a!YWx62 e<8Yl8B9$*:ekMi&TbՔ,v`v*(`*ſrF$ p"q(;Jo*RDҺGgBRGp@mʿ$ ~YSortingUZPase Wait | nH~Kϑ ˫AHJ.`RF Fm Lcpa/ *H֟ rd{dI3cx<+P/Ajmͬ [ `xax`, "MYIdfff !`?*_NuJa'FeXA AprMayBnJulugSe>Octo9Dec2QIPDLZHZOOhARJv|bs EO+j@^61F.g"Һy"P9ܗ;ݍYJkL3c&1"v#.:X`R}Mp-( }FFUю@8o ^$r4Ԭ!Ze@C??>DgHnn0@mJf5x>[΂3 #-,+dso*o$-D xZ *ĭ0x/1J$J /X[9wGmH,1;8ҫ;1~<;#.bXPN*ʳ(<t.h< .7sxVT=dbv KPjҚ\j(kXUn'͞"]$6 5ơ$ZZϠsk=ZϢra,v9+~C!qaϨ-|k=ZϪ(rsTDnJg?XO?4-X/kﶶ T2ʺVU޽ͺW9Sw~W,8X|R o.`YԲjf]pSX?ܾѬ3Kp0&p@ޢL(G31L*3@,r͜<(/g\:9:区9,ؘm)N/9 8rlq֜µrNrΪsdŜ[2Y15N¢3+nBѻ1g9oQtҀ4](W-yz𳙳?.gn+<+ ̕3j8~Z9rsΚݜx~BbAtd͜,unxޜqI{@rnݜ,q~)xd)P~ tUjB`RDP6&* u\g^Yt%s j^reV0D!ffBp7@*B6$zͻؚ**ΜPe* E䪒hAv%0ʡ$Z"Ъ tc@t\-Z{bEls|6粲ʹBrH-t2w"ƞmOR@H*-g8F @Dr|6/&t/-Vt-B^` t\fAprxm,A2ր2B80z2`g @x H4rB4FpJ4g#>67ƶ8Ƭ9Ƣ:Ƙ;Ǝn Ef>Ԅ>hD` >@Bc >vB@`yFh[>FAepIN@]gHr22~5\-pJ0<Z3FsH=@H6PvbwP|UmT.V*T\XrWD60wXn:X\ ~RF*ep)g",C,Wf|R{FŰ7WK B)G/1:x.3/r 0~FZ:JZ+-B+2:2W?JYyFeJ+gK"qK]`rc"2DfwAC3BBVҫGHתPn?J?rN/C7THn AfO/J?*JֈdIҁЁcS ae VsC4RG{TpЮ_.PYr~Sgo>= g Jg.ଠNPOJWuAn"AKrdϒ K3{ ?//?Hz\/d L,"HJꉓ d-βlIFPH2xPA@07s0 P  H "Z(Ypr. M"K> ݹW@2^WA4\B6,\C>M??֋k޺"` )M@l)K@p)@tD"ճ0@Ʈ'(̭A O"P./" NBm0Nu P  ՀP *TLJ<R=`P*U !U"#l$U% &U'(T)*F+,E -./ODh12U3 |4567j 8$":T; uj=B>jo@ABPC*DTEJFGSHIQJKLMNՍO>P*QT)R*STT UUVBWXYPZ:[\b] ^U_BqabPcjd@efBguhi6jklm[nՂ4g@q\@xs(tTmvVwYyvz{*}`k*eryCԴd%bHUIcp3|P0@(/zIحz!^R +Qm`?4+4<5n@nֹffZuRF`p 5Fkps@ro`t 9@B0Lg"V@A@9B@'n"l(pM FtOhpao >%: 5PBBg+~rdWDO"k 0L[`=^,8\,S܆jզFB p]`Jt*;i#běkNJp4zsgBXRf,3f{ {~ 2.ض@/ /a?sT+Gx`BJM)_4H8JH3V/He?<_qN+KtjGf"p TO̧HJj}1x`prAЁ=Li@y:A?GPXz+J F/ "QS| az¸U@c |gSA _ -_2@t jf(Cf`дW7WpMCQQ $-\# 8JXh/rC V$ejAgV /d5߸[vH$aqZ,aٶk:$̎s-*Hfb(̤d}ݶ>E0Ƶ<*wX"dgLƍZ`jzaf&oFЅr 5SHT`=1'$҅ gR@gm[^Xߒځf?V]/J,LFi̛f u)>aMJ8g@G2aŀ Nq!gw">XOlj< <yx|ean˛ UR.e^(,l O ",}&A`:Hx?;tovm$ Ѐc?x <m(`rJgnp uKufؓ=+2~cH-IW`B0 "yTn6F"՗f&WBXUj.U9^π'ے윁M`$*X/; ,nq,amO*p1n7FbnZ\9A!*,g&U}Qr (uJ,.Vk\xVM,s72(JDg,2,[ ٧i^e#rܭ*f:"[[Q;:Z *fR{M/ ޛ B&bPO]0g-וb`ӝ`Z|>$0YOJbp%yYFRÈdgF6< gWgd$*Xs`J(zJEkSM%r>SXOB.`̯8Hr ?V`KYFx`rXO@%Q#Px >RFSrmdClR%N+k>"H9",,Сo`2;T!)fJfgA _l9Bm;;-}9փ"4?ޡ9x-M~ "n,mpd}Kc]\1ρVI]m21u>0beS aV3&U R@ >\`4%h0<f< \ʆ` kӋ.g0BۉDh4NH I`|̓gvr`n&'f"I`履F^E, N *Tu8 gCR%S,,p -fu* dJFqlJ{S+9^ZG@\wV<*r+VX;V[9 r9)J ?GK!Rf/Uemٛp&Mg\c%7v3w`j2ґ<rSF >r fS`UOs?TrC#PXOEgr Lހ`0/垀 ޒR%"70+ @myDB k%=@ V& X`ºPOJn_gHrtCh@[%)b,{Fq]/&KnDQovE)fJvG-_N kMe pLg4Y@g\^},XNXG`תJe /;Q fW hY<0Vn&,^W$ n^$i&J Lx_1JRkʛ87Ho8,+ap\g> [d2pYYX|"M$減-Oh܄(Vλ\lfU1vŲbJ[0Rw.V4z]XAl~8c ^0 (9Gצ\5x\xCDTHr./xr/,Or\ce-m `T< vDHBp@ЀϘ jJ|6ܻx&|rXOu[: KRK⵼uJUBlJ0,H`+8 Twf${i<^VlfUð %eLu"BHAQ W,KWef'$ff]:*Sd*!֖ xjTE,-5ge,z>;i6dKR N qrG +g Py0m- n 4BA@b0>@JjDA21/Bs }<<4rue \-I`ڍŇ$suCg@znb\%rbF(&@ץFg*SKfA&v8?`p x/RhK[/\I&lݏ-D8JkxCt_"0123456789abcdef QOa`0"[XAPO7"=戜B@"Or A0¯VfQАoapRsqI.xdDg:zj;[0` 2R`&0X *8R`B5had$7YBHXuSR3[jڔ gJ6yDCp:gK1t"M"--1Lr7SFv"S fZ#*a&*@BϺq.$5xٵ GfL{5[Arb60 F6?bV,V/H04¯2H@/@~!WWT` QQ 69n0[eL([o]`klՉɄ'~CJf OtHovp|zH60dĽoJNօ. jvV1p+HLu@DBz.g,V&g `vz r"`,:/g 4"floK%RFy.DJFjJ9-4c]Hœ*xESFo^xr :f9I2 FxEAoݖsp/2B>z*rw~MY2-C"g-e"`t<` rd`q;qIn .~Jg.7fD&,`Ng֫%8 Kn-3j`ۨ[&MJg[HGRK`?(fsd8k6 Hz{?<&NN\O)EDsjHp,o/ r*TO3H\r-W@=sII-A4H?Sr@fOB8,F m`"(A"JAjVAAE@k5AHWl !Ѐ<P20&ށRE` z5c8Ov8I-8-hHdHJRrVPn^ / x> ]hJU1g\*@;lA *_/q/l60-[ÊYO6+.q `)HAyaX/Yxc<0"Ov5"Ao$kRm"U`&(M bmg$Ct4 kԂւ|@`$@jǎAE&sփJDk:810؃(x'd55JXgLSDGHJkƟk*hRA>0pfڻ*,fu^ KP]gA&M*U`^piC*&pr>MY/ Ba\LY׃3H{:2NLx(/X M&VӒ+g>H65RhĘ<[r+9ʲJWzo `$x4_(nm " Tfz:W2^agygN.bNx%ba%P5ĨxF|x-FB@'jD@@@?,H?7' zԢy3)/>JD=><=~,JC]+ 2;F#~s;GjD@#Ndg(gD-W.z+Sg2*(Jg*(>F` U"Hp=f  `XM`ҌO@xZs*n5e 4Z^ެA~ * ݀Un! < #K` j$-7l4&gHHCJCоeԃ<$ԁek` P`JD"/r"ASH"" L \N~L$HA f \f*dJRr"9ATװs=l*I&}f~dqp2*;L,\<\5 PQʠuWyGj|Iz`]`M0HG@ b"Ml ~r_!*BA1h fr.xVdm B^0m`JwYfJg$rx2X-ip0lqK0S-miH+ N`,'FvDjo:˄*@Њ)no\˚f JB4<8f-Fy`І?=pg|JjUO=Z >+.Q:- $o@,~c,]"A{v[ƸJo"FЁ`=ݮ` .  '$*i,JYSqg:eMgp>V?ratle\n"g$[qِ `l[&-M,` pw&~/,JV-_S`r ' r '؂qw J]Zx#nKiupF?GA\OBa&ce,XWsfB 4lJpSF`6<4Ff`k,|.5A@p*2<l0՘r8sD RG` < %=l! r`kZJXr۲9 Ųqfs[aZFfnk^#!Vh8KȞ< RF@2 @9T=AgpܬfUWC"Z Wx`:j17:8qDcฑ^Ú#-I> g,h lV&Hpf4ۇDJ)I$E"h41g @,:B۸)n}A 㖰VX)W4HL8B/?CNAONֹ\*Hk0&Iss fJ;"jxLpVRSj [@73%3 Bc&…[)ρ E*zRMeBr,wEp/Ƌ(Jﲀf =|f7bU؜7M6.;Qnnrī "2.V:/` ~f2.JXr>h9AA:<9o< f4<|YDR9d- HH@J@fp`p@7JFoA0`#SF`윺S@@*H*BPF*JTN RUVZl*gE8^Ĉ*3kBVfZ ;/^rk~cFu@  4wE{0Cx20123456789abcdef j,;sWX;(ARGV=60ttosapgt;, [r Hd JaxFebhAprzBay,ԂJuGAug}epOc!~BNovDecFSF  P*T  SukMonueWeThuFriSat[TX\P`*dThGl}Ўg(Y H@^.؁zR[` L -G\pK]F\`Ll@@Vj247&\P<3L h):& L XD+DHx=V"Hle7xT* FLcvb{(J Zx  A N4<x h0  L q06;` 8@~(l 3-v3.XP/h:1\anUYoChoos38 -{xDPRG.TXTAnPExit..h?X 9rogram -*-Copyright (c) 1993d.J.MattsCck Mouse Or Press A Key!RDD3PATH&?<xxTOP+ *.*@ #:\gInstalling To NEWDESK.INF#G FF_4 0 x  @t"B$@T8 @@ 2p``.22zX$0b0. *~ f((@4|V(. R`.. F`ICE_2_4 PRG 8-ICE_UNP2S 8c ICE_UNPAS 8 READ_ME TXT ݢWB `F`Pack-Ice: The best packer on the ST. It is Public Domain. You may use it for packing anything you like. I don't want any donations. Greetings go to all people who use this packer. *O*m - ЭЭ// Bg?<JNA 3"3"$aaaa Faa a`& < a(3~R@gNu <aNu>??<LNAHAnBBBP (pf|A"0<NBp0:LNuxafx3 NuCArg8By $g*CJfSH ( g nBE f02yC#^NuAapJy gApa@0`(AaRa 3f"Aa@aAa4` 3fa`: 1gt gn 2fB9:Jy gAza@l|ngpy` A!aa^33 gZ ygP nf3`,3``8By Jy gAa|g`Aa~a<yf3 v3*Jy g?<NATIhA:BgHT?<GNAPJf|\*.*BaI " '$/?<HNA\Jn ADa `$@#" S"z I(ISja Rfp P@$@#&a z <'a(g 'da $zS@k f,Q 'g"zP$z" SSjAaa`Aaa`/: ?<INA\Nua 9:gARK R@#Z X`f$ԘԘ#b rx## xa kK <|ak*z R@,@akKB<|akak`*a*z,Kaka`Aa`Aa/:?<INA\JfZ?<ONATJj&Jy gA/a |g|g.A adA a\a ng`A 3aBaNuBgHz ?<=NAP38JNuHP/?:?<?NA JNu?<Hz b?<NAXJNuEJf "\g :fR\B*I ,:fpH@ a/NAXTHT?<;NA\JNu ztg#^/a Nu?<NATNu?<NATNu"zFJg,TH$g  gRHSjBH Ba( #^NuHP?< NA\Nu/< NMXNu/?< NA\NuHz ?<&NN\Nu 8#,#0NuHA aa :H@B@H@0 a0 a0 ap:a  @0aH@@0aLNuC :tr€| oA'A0QA aGpAat+gZTxvSBkp#0k o0 W o oph؀XCQ <(e(|dx# Nu/ : # |#j x3 NueH :ѹ x" :B$::adaJ@gRHABAHAzVgD3 <99A H@A aagaf3ZL#H`LNuA a : 2":a2da* H@B@H@ 00a.H@a(A aNuH@HAJ@f JAfH@HANuH@HA`H??<NAXLNua( <43#a0?:a.p0Nu <3L|PIz@DADBDCDQ3QPIQ3NuҀ~΁f~΁ <o.SkA`A 9ax`Hy?<HNA\Jnp#Nu :3Jkg/?<INA\JNuBy\B <#az z :f"zE#H.I o(z&Hfm" U#P g&H`o&zZxIJyk/ ,z mT,H#$za(JKprt&:o6< &A4TS9(R@Cfa &zv(փ$K(Jr238p0Ўf 78&_Jyk (zrڷof|(fr`(gn`^f,LSN *H fbn" S$R < g.cԁ"l|c|b(3T3Vnl :|ol00:2 Ag Ag.`<RSyXjDpЈkH3X`4":3TpUf @?baPa`aFaaz0: :WjlR`a Ǔ ."z|XaNu c3\#HG:v8#D\DCG(Hr婂EzHSD`  G,vC830KD\DC6308Kri@D`b    @?b2 A?o A@x `:x`4G(0:z3PHD\D3PHri@ESD`   Q~|QNuNuIB\0<r((((((((QIK0<r &ATtQBd0<2T2T2T2T2T2T2T2TQNu``Pack-IceI *Lޭ,Lޭa*oMGLA "grѓg f``GP$]t***Ԋ**EL ;H ;C&NN&&Sj&n".扑&&SjN%a*d"ra$dCv !a"H@@Vҩ%QnNuf%Nurf%AQNuCtaTxr1 Hka1 Ag"CvtaTr1 HaBq jD`rptadpt?aBC@!!Q`R   NSHIx,La ICE!fpatKan."Npw!Q&N%af*Kad8><adpa>|8#zD@DADBDCQQHQLSfpw#QLN[NurQNua*d"ra$dCv !a"H@@Vҩ%QnNuf%Nurf%AQNuCtaTxr1 Hka1 Ag"CvtaTr1 HaBq jD`rptadpt?aBC@!!Q`R   0 Enter name of source file: Enter name of destination file: Could not allocate enough memory Working: P> Crunch another file (Y/n): Relocate program after depacking (Y/n): Additional picture compression (N/y): Please enter the offset (Default: $0000): $ 1) Crunch data file (Default) 2) Crunch executable file 3) Set Parameters Please select: No mem! Verify: OK! Error! [cancelled] Data cannot be packed! [cancelled] CCCCCCCCCCCCCCCCCCCCCCCCRemaining: 99% CCCCCCCCC-~ CCCCCCCCCCCCCCCCCCCCCCCCTime:  Rate: % [saving] was pressed. File is skipped. Larger than original! [cancelled]Ef ~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~ | Version 2.40 | { P A C K - I C E } | | { This packer was written by Axe of Superior for ST-NEWS } | First version: 14.02.1990 Final changes: 14.08.1991 | { } ~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~-~ [0][| What do you wish to pack? | - Data files | - Executable files | - Set Parameters ][ DATA | EXEC | SETUP ][0][| Relocate after decrunch? | ][ YES | NO ][2][| Do you wish to pack | another file?|][ YES | NO | ??? ][0][| Do you wish to use an | additional algorithm | for picture compression? |][ NO | YES ].\8L,,R  0("  6, \0RF422   &4Pn&2 n;********************************************* Unpacking routine of PACK-ICE ; a0 = Adress of packed data ; "bsr" or "jsr" to ice_decrunch_2 with register a0 prepared. ice_decrunch_2: link a3,#-120 movem.l d0-a6,-(sp) lea 120(a0),a4 move.l a4,a6 bsr .getinfo cmpi.l #'ICE!',d0 bne .not_packed bsr.s .getinfo lea.l -8(a0,d0.l),a5 bsr.s .getinfo move.l d0,(sp) adda.l d0,a6 move.l a6,a1 moveq #119,d0 .save: move.b -(a1),-(a3) dbf d0,.save move.l a6,a3 move.b -(a5),d7 bsr.s .normal_bytes move.l a3,a5 bsr .get_1_bit bcc.s .no_picture move.w #$0f9f,d7 bsr .get_1_bit bcc.s .ice_00 moveq #15,d0 bsr .get_d0_bits move.w d1,d7 .ice_00: moveq #3,d6 .ice_01: move.w -(a3),d4 moveq #3,d5 .ice_02: add.w d4,d4 addx.w d0,d0 add.w d4,d4 addx.w d1,d1 add.w d4,d4 addx.w d2,d2 add.w d4,d4 addx.w d3,d3 dbra d5,.ice_02 dbra d6,.ice_01 movem.w d0-d3,(a3) dbra d7,.ice_00 .no_picture movem.l (sp),d0-a3 .move move.b (a4)+,(a0)+ subq.l #1,d0 bne.s .move moveq #119,d0 .rest move.b -(a3),-(a5) dbf d0,.rest .not_packed: movem.l (sp)+,d0-a6 unlk a3 rts .getinfo: moveq #3,d1 .getbytes: lsl.l #8,d0 move.b (a0)+,d0 dbf d1,.getbytes rts .normal_bytes: bsr.s .get_1_bit bcc.s .test_if_end moveq.l #0,d1 bsr.s .get_1_bit bcc.s .copy_direkt lea.l .direkt_tab+20(pc),a1 moveq.l #4,d3 .nextgb: move.l -(a1),d0 bsr.s .get_d0_bits swap.w d0 cmp.w d0,d1 dbne d3,.nextgb .no_more: add.l 20(a1),d1 .copy_direkt: move.b -(a5),-(a6) dbf d1,.copy_direkt .test_if_end: cmpa.l a4,a6 bgt.s .strings rts .get_1_bit: add.b d7,d7 bne.s .bitfound move.b -(a5),d7 addx.b d7,d7 .bitfound: rts .get_d0_bits: moveq.l #0,d1 .hole_bit_loop: add.b d7,d7 bne.s .on_d0 move.b -(a5),d7 addx.b d7,d7 .on_d0: addx.w d1,d1 dbf d0,.hole_bit_loop rts .strings: lea.l .length_tab(pc),a1 moveq.l #3,d2 .get_length_bit: bsr.s .get_1_bit dbcc d2,.get_length_bit .no_length_bit: moveq.l #0,d4 moveq.l #0,d1 move.b 1(a1,d2.w),d0 ext.w d0 bmi.s .no_ber .get_ber: bsr.s .get_d0_bits .no_ber: move.b 6(a1,d2.w),d4 add.w d1,d4 beq.s .get_offset_2 lea.l .more_offset(pc),a1 moveq.l #1,d2 .getoffs: bsr.s .get_1_bit dbcc d2,.getoffs moveq.l #0,d1 move.b 1(a1,d2.w),d0 ext.w d0 bsr.s .get_d0_bits add.w d2,d2 add.w 6(a1,d2.w),d1 bpl.s .depack_bytes sub.w d4,d1 bra.s .depack_bytes .get_offset_2: moveq.l #0,d1 moveq.l #5,d0 moveq.l #-1,d2 bsr.s .get_1_bit bcc.s .less_40 moveq.l #8,d0 moveq.l #$3f,d2 .less_40: bsr.s .get_d0_bits add.w d2,d1 .depack_bytes: lea.l 2(a6,d4.w),a1 adda.w d1,a1 move.b -(a1),-(a6) .dep_b: move.b -(a1),-(a6) dbf d4,.dep_b bra .normal_bytes .direkt_tab: dc.l $7fff000e,$00ff0007,$00070002,$00030001,$00030001 dc.l 270-1, 15-1, 8-1, 5-1, 2-1 .length_tab: dc.b 9,1,0,-1,-1 dc.b 8,4,2,1,0 .more_offset: dc.b 11, 4, 7, 0 ; Bits lesen dc.w $11f, -1, $1f ; Standard Offset ende_ice_decrunch_2: ;************************************************** end of unpacking routine ;********************************************* unpacking routine of PACK-ICE ; a0 = Pointer to packed data ; a1 = Address to which the data is unpacked ; "bsr" of "jsr" to ice_decrunch with registers a0 and a1 prepared. ice_decrunch: movem.l d0-a6,-(sp) bsr.s getinfo cmpi.l #'ICE!',d0 bne not_packed bsr.s getinfo lea.l -8(a0,d0.l),a5 bsr.s getinfo move.l d0,(sp) move.l a1,a4 move.l a1,a6 adda.l d0,a6 move.l a6,a3 move.b -(a5),d7 bsr normal_bytes move.l a3,a6 bsr get_1_bit bcc.s not_packed move.w #$0f9f,d7 bsr get_1_bit bcc.s ice_00 moveq #15,d0 bsr get_d0_bits move.w d1,d7 ice_00: moveq #3,d6 ice_01: move.w -(a3),d4 moveq #3,d5 ice_02: add.w d4,d4 addx.w d0,d0 add.w d4,d4 addx.w d1,d1 add.w d4,d4 addx.w d2,d2 add.w d4,d4 addx.w d3,d3 dbra d5,ice_02 dbra d6,ice_01 movem.w d0-d3,(a3) dbra d7,ice_00 not_packed: movem.l (sp)+,d0-a6 rts getinfo: moveq #3,d1 getbytes: lsl.l #8,d0 move.b (a0)+,d0 dbf d1,getbytes rts normal_bytes: bsr.s get_1_bit bcc.s test_if_end moveq.l #0,d1 bsr.s get_1_bit bcc.s copy_direkt lea.l direkt_tab+20(pc),a1 moveq.l #4,d3 nextgb: move.l -(a1),d0 bsr.s get_d0_bits swap.w d0 cmp.w d0,d1 dbne d3,nextgb no_more: add.l 20(a1),d1 copy_direkt: move.b -(a5),-(a6) dbf d1,copy_direkt test_if_end: cmpa.l a4,a6 bgt.s strings rts get_1_bit:add.b d7,d7 bne.s bitfound move.b -(a5),d7 addx.b d7,d7 bitfound: rts get_d0_bits: moveq.l #0,d1 hole_bit_loop: add.b d7,d7 bne.s on_d0 move.b -(a5),d7 addx.b d7,d7 on_d0: addx.w d1,d1 dbf d0,hole_bit_loop rts strings: lea.l length_tab(pc),a1 moveq.l #3,d2 get_length_bit: bsr.s get_1_bit dbcc d2,get_length_bit no_length_bit: moveq.l #0,d4 moveq.l #0,d1 move.b 1(a1,d2.w),d0 ext.w d0 bmi.s no_ber get_ber: bsr.s get_d0_bits no_ber: move.b 6(a1,d2.w),d4 add.w d1,d4 beq.s get_offset_2 lea.l more_offset(pc),a1 moveq.l #1,d2 getoffs: bsr.s get_1_bit dbcc d2,getoffs moveq.l #0,d1 move.b 1(a1,d2.w),d0 ext.w d0 bsr.s get_d0_bits add.w d2,d2 add.w 6(a1,d2.w),d1 bpl.s depack_bytes sub.w d4,d1 bra.s depack_bytes get_offset_2: moveq.l #0,d1 moveq.l #5,d0 moveq.l #-1,d2 bsr.s get_1_bit bcc.s less_40 moveq.l #8,d0 moveq.l #$3f,d2 less_40: bsr.s get_d0_bits add.w d2,d1 depack_bytes: lea.l 2(a6,d4.w),a1 adda.w d1,a1 move.b -(a1),-(a6) dep_b: move.b -(a1),-(a6) dbf d4,dep_b bra normal_bytes direkt_tab: dc.l $7fff000e,$00ff0007,$00070002,$00030001,$00030001 dc.l 270-1, 15-1, 8-1, 5-1, 2-1 length_tab: dc.b 9,1,0,-1,-1 dc.b 8,4,2,1,0 more_offset: dc.b 11, 4, 7, 0 dc.w $11f, -1, $1f ;************************************************* end of unpacking routine Here is the latest version of Pack-Ice (2.40). There have only been little changes: - The files that are packed executable are now 6 bytes smaller. Wow. Isn't that great. This might save up to 1 kB on your disk. If the file was 1030 bytes before and now it is 1024, then you gained 1kB of disk space... - The program is compatible to more programs. Try the programs that never worked when they were packed with any packer. It might work now. (No promises made...) - You can tell the program what to do with use of the command line. If you have the new TT or whatever Tos, then you can drag all executable files on Pack-Ice and they will be packed. I can't try this myself, because I have a smelly old 1040 with old Tos. Hey! My ST is not THAT bad. It is one of the few limited machines on which Nick of TCB has coded. I even have a document to prove that! Now, isn't that a tremendous gain of value? Ok, yes. Still the above mentioned feature does not work on my ST. Anyway, you can install a certain extension to be packed by the packer. You can find out how this is done if you look through your Atari ST owners manual where you can also find out how to format disks and to copy disks only after you formatted them and the like. - Chaos Inc. (and all others how need such a thing) can now type a command line that has a "$" in the beginning, followed by those characters that are equivalent to the keypresses made when using the packer. Example "$1yPICTURE.PI1" will pack the file PICTURE.PI1 as picture file. - You can also select the path using the text input!!! You don't need to use the alert boxes. This will also work with correct pathes. - This is the first new Pack-Ice version after a break of about half a year. But now, I got some motivation from other people who (I couldn't believe it) ARE still interested in new versions.... So, here is the first one. I didn't take much time to do this one, but wait what comes next. I probably would have done another version if not that beta test version had spread out without me wanting it. But after everybody had it, I didn't feel too much like making a newer version. Anyway, it did not happen on purpose, so there is nobody to blame. ~-~-~-~-~-~ Axe/Superior ~-~-~-~-~-~ . {!.. CAT_V2_1ACC pWCAT_V2_1PRG pWTXT_VIEWPRG pGCAT_V2_1DOC p `T&@<AON!a/^;@$0-$gRET\p a;&2-$a@;@&pa/pa52-&HWHH/pa5r(WHHgNx``Nxa%H?<NNT+@pg,a(ETfpQa:/ETpa:r"_ta1+Apf\6<0<tra0prda?APa3aS6vptra0vptra0BmpXAVa:Na(6pU~AaJfpU~AaJZpU~AaJdpU~AaJ^pU~A aJ6pU~AaJ*pU~AaJ4 <|zxvd0<tra-a6a'rpa/ pa/*pa/(pa/lpa/6pa/4pa/6a/>v#ptr a-ETpa94tra2v#ptr a-vpa/$pa.pa.pa.pa.pa.a.ETkpa8t2<a2<6<p tra-*6<^pt 2<a-pa.pa.pa.a.pa.6<p t2<a,AhETpa+rgvptra.vptra.`4AhETpa+Fg"&<0<$<&ra.v(ptra.A\ (- m/0H("maGa -rҭa>A퀀a -r ҭa>EUBpa.aA(- m/0H( mAH 24aBaA(- m/0H( mAHa*ѭ`A\ A a"A8a#lA a "pAna-p\ag0-rHSAna,Cta%<^|2:<x 6<pxtr(apa pa pa pa a ETpa*tr-a#pa tpa rpa ta |pa 6<p tr(apa zpa pa pa 6<0<t22<apapapa6<0<t82<a~papapa6<0<tL2<aZpa papap aaEUVpa)tH2<a#,papapaaEUfpa)tT2<a#EUpa)t]2<a"EUpa)te2<a"EUpa)ntm2<a"EUpa)Xtu2<a"EUp!a)Bt}2<a"EVp$a),4<2<a"zEV%p a)4<2<a"bEVEpa(4<2<a"Jp#a8ja;g><^|2:<x 6<pxtr(aa&:`p]HH/ ]HHg -&<:<a a&<:<a Ba+@ -&<:<ava/aa+@"-pҭoBBm6 -"-ҭmR(-ح m/0H("ma@Cza!(-ح m/0H("m a@|a8gN(-ح m/0H("ma@Zp.a/(-ح m/0H("m a@6"_afCza!pAza).p*a/p]HHg\A00B00-~HSAza):Cta! ˀ^HH/ ]HHg (-"ma>L -(- m!H(-"ma>h(-"ma>"(- mAH 24(- mAH 00RpUl ^HH/ @]HHglA00B0 < ag( < a"< a4 <60HZAba%N`& < a"< a4j <50HZAba%& ހ^HH/ ]HHgBA00B0AhETpagETpAha`ETpAha ^HH/ m]HHg ^HH/ mB <r4<AaFgA0B0Aaa!`>  ^HH/ 'mB <r4<AagA0B0Aaza!j` %^HH/ ?mB <r4<AagA0B0Aa(a!` >^HH/ UmB <r4<AaPgA0B0Aaa `H T^HH/ mmB <r4<AagA0B0p a |p\Ana"A00B0pa2R <r4<A0a/ <r4<A0aȀgaa5UfpaAa:Aa: Aa:Aa9A a9Aa9Aa9><|zxvd0<traxAPanaJNua ?HnJ?<6NAP0.TXLNu 24&8:BfJBg f DfpNuJEgpNu 24&8:JBgfDf EfpNuJEgpNuDExa*`bDEa"`ZaR11!Nua11!Nu 24&8:DE`6 24&8:DB`&a&8:DE`DEx`a` 24&8:HnghDBHngXDE~<En g6@ABDFGcGcGb8(vHDl`G8BCHC` GHD8HD쬵k&Dуd QRB BbJjDBNu DENupN֓DjdDA@ cAр[SBoJjDBNurptNuH@g0J`Ѐ[rGoJjDBNu0ftNu@[rB oH@JjDBNu $HkBk Bj*DBNupNuDBBkBjDBDNuf gp` 246jDCCe0 C/jC C@j C jr0H@{0>H@Nur{0Nu{0NutNu 246j(:<DCaf AfBfNu` a 00Nur$o, b4< J@k @[H@NuH@RBNu4<Ѐ[NuDg8k2 b4< J@k @[H@DBNuH@RBDBNu4<Ѐ[DBNu4H@Ѓdh`^HCH@:">H@`H2g&HCH@:<HC>H@Ѓd(`HCH@:H@r` gDBgkDE`HDBDEaBDBNugDBa8DBNutNua 11!Nux`xa`a` 24&8:HoHoEBJAgJDfr:g,|HC҅H@:ۆ<HC>H@Ѓd`vHCH@:H@`fgDBgkDE` DBDEaDBNugDBaDBNutNuHoHoEBz:g|HC҅H@:ۆ҄ۆ<HC>H@ЃdHA@B@H@хk HAҁHAрSB BbNuJBj^tNuk(g.JBjDBAр[SBDBjNutNuAр[SBkNuJlNu0gH@rJBkB JkЀ[`DBЀ[`J.=gP0rHGGdHGGdSWDуdi?<>0rHGGdHGGdSWDуdi2?<>0rHGGdHGGdSWDуd&2 H@kփAр[SBkփejRAd RdQRBJjDBNutNuCEdSW`?<,>CEdGeH@0r`fJCgz?<0rÐdSWЃdi?<0rÐdSWЃdid?<0ÐdSWЃd&2 H@kփAр[SBkփejRAd RdQRBJjDBNutNu?<0riP?0i?`?<`VdapEWWgPW`LJg&B.C`a8aD*9Wfap-I4=|p4aHz*9Wg ENp9W` _a &nO:NMWI"KVf$<Nu[1][Error +111][Return]EVd g g>Jf`Ar Hjr-D@Hd0H@H 0H@0CNuAJ"H [1][fSEfNu`HQ?< NA\Nu"_KVfMW V,@I"O:HQ <-H,,`N, d d3 d# d# # d# # # # d ALH dAL H LH d AL`H L|0H>L|H>d~# # # # A`@ALH L|H>L|H>L|PH>L| H>L|H>L|H>L|H>L|`H>L|0H>L|H>QL|Nu$H$&"BA -K aXA$f B &n NuH>dd2d"d""d""""d LHC dLHLH C@d LHL|H| L|H|PCd~""""C`:LHL|H| L|H|PL|H|L|H|L|H|L|H|L|H|@L|H|pL|H|L|H|CQL|Nua`p?a a?<LNA``NuNu`aza`aaaHA"-Hpp alpMah=@N?<NNTT@A0r p0Q`pdr ta0.N=@=@ ACp,2QAp 2Qa a`\`Xpea>pCZ2Ad0A2r22a"<'0<NBL Nurt=@B=AH=BDa"<'psNB0.Nu=@0=@=B0=@aj"<'psNBNuC2 @ e$ @bA0AP2r22aP"<'0<NBLJNup"AJӘQNuA> NuHz(` N'Hz ?<&NN\Nu9@gNuW@Nuf  Zf 4\B&0D4(*<B$,>2::(   F..26"8@"PQ1!P1P!0PP`0  q#aaaa O: n,NNuNuNuNuHz `Hz"` <Hz&?<&NN\Nup CNup C0Nu C NuJBgVB&8TTDуdQRBNuDAр&AdRAрAрDуNu <r4<NuQnHR$n4Jjg$_NuH LNuPnJ.ng0HR$n4Jjf$_NuHC/*%I $n4%_LNu B?b4<rpAv JBlDBv-|JBg Bb Bk&H>aTaRFBd&8*L?a<aSF Be BgQRB`RAdR e <rRF&0xaCٱfEv+0JFjDFv-Hƌd0BFHF 0HF0ANuprt|`HQ2.l Aeg>r C 5e&!R 0c 9c0`<R"_`VC0 Ef"_Nuaa/ CJr  g 00VJAgB @ nN @mHJ@j0.4DBUBk0QSAg Q.`S@k 0`0BAJ "_Nu.WAkQA 0g` @$@JfS a"`QNu$Aa`QBNu?aHQA(B?<NNAP DJNu?<ONATNu?</NATNu/?<NA\NuHz Ta `Hz JaH `HPHQ0(ika $I _a~IUd4Id4Id$Id `$$$$Q _Jf,aNId4Id4Id$Id `$$$$Q @NuSa IdIdId`Q @Nup `/ a$I> _a޲G` VNuag`af`ae `ac` acpNuadpNu/ a$I> _a4Ae4v` VfANuHP0(R@kBa $I _ahIUd4Id4Id$Id `$$$$Q @JfNuNup `:a*SAfNuag`af`ae `ac` acpNuadpNuaSAkfJANuH HPhkJa $I _aIUd4Id4Id$Id `$$$$Q @JgSL`QNup `aAf` VNuag`af`ae `ac` acpNuadpNuaP4@m4v` Vf@Nu/HP0(X@kHa 6 $I _aIUd4Id4Id$Id `$$$$Q @Jf$Nu $Nup `a YAfNuag`af`ae `ac` acpNuadpNua SAkEJ$p VfWANuHAHBHCHDHEHFHG-HfAN-HH@-@Hp`rAN-@f-H `r6 @`0.jHNupNuAG` AI`AJH=@ `Tz`z `z8.fndDnd@Hp tr=EL`ndnf648HHdprt`ndnfndnf8HHdprt`"_A d4RB`"_A42LdA` L0GF11Q-pdprHQ`PBp'rtaB n4rt6(SC0(S@apaBdpapava0pa _a 4$FAJp_@[000][vx`* [g" ]g |g QSx` xQSrQ][vx`* [g" ]g |g QSx` xQStQ]BAJ0-H4=@p4a2HNu 24DBaDB11!Nu 24DBa DBNu 24x6o<Ce(FC BdЄeNu B/dHDDdRdQRBNu&<:<`g BbUC BcjNu BcHDDdSkg RBAрjNuNu0ftNuB H@"jNu Lx6oFCe0FC BdЄe!Nu B/dHDDdNAXOJkpNu0< aH`0< CJ2p`p a2`p CJp`a CJ"p`Hza`Hy7R"J`B.D=|HNua.DFpAR@C`n @H` @HHy7Raa"H`LHP?.l=hlN*=_l2 "@$Y4Ad2`0Q @NuH@&g( b⸃bLHaLC 8$Ir `Q"Jr0XDQD@CtEe PA`fRشf`e"J*c j|0"cRLJgR $I.f) 5e*0!.g -g  g 9f 0b`RB`1`p `@`r ??a"P02R@H`2Q Nu<>Hz?<&NN\`f n4LLJFj|@c<JGj~Ac>02 h|N n4HHNu80a|DHz ?<&NN\Nu| n4 h N n41@Nur ?HQa. _/ ?a$0 _4gSB@c:Ad,J@gB@BmS@,. RB6Vg(R F"GQpNufJ@fRB`fS@kVft0HNu=AaAD09BRyBH@@-HtBe2QB p#`a$ZXNuHzxlJj xo`xdJjxc, EJDD`DDD Dz$X Pf-K &e "&J$IpSNup`.L4 fd$R$&k(*ڄNdNjRofNu.#AHAȿe(*NdN$&Rgp$(؁*Ne*(NdN(*Ro2(NdS(So&*NdB*RRNf$f$SD`S(l//"a R"mxNupЂmlNu 24JBkCkNuCktNu 24JBoSBNugRBNuBnz`pBnz`p=| z|=Fx@=@l=nh|a,Ht=Ar~`:a JfBH@ RfF.p Kg" Mg sg tg Pg Hf~`xSGjtRGFcn>`jAJ gp gj g grffnnzenlfJ.pj6pRGFc$SG` J.pjpRGFcRF` Ff`> `?~ap a0p a*0Nu|``CpE`bf`FgRGJGgSGSFFgCpE`Yf`Nua@Jf gH@ fa(@ fza0 b @ Ee0NuagNu4.|f?HyaNM\Nu=|H`LtazEfpadppa`AJEg0PaEfaFRE`ܾEfp a@a8?nxnp a2RF`<a@nxoS@f nrfSnv=Ar=FxNup` papq4.|f?HyaHNM\Nu=|HHaVLNu|A0"P2(@e2<EJ`QHP=|HJ@g$abAJ$HpR@ 0 f _a`QNuHPp?ap a _2<|0`HP$ZXAB6<Q _NuHz`Hz*a$_HaC`2Hz`Hza$_HaXC`2E`EHaVCZA`E`EHa$C>A *FM3x?Fc>֞VSGk Vf>FNuTNuHpr,.܆އ܄ޅ܆އ(sh*sx<3h>3x?Fc>֞VSGk66Vf >FLNuTLNu,.܆އ܄ޅ܆އ*sh'xh'x:sh7xh7xNu,.*rh%xh%x܄ޅ܄ޅ*sh'xh'x:sh7xh7xNuE@`ExHaA`E(`E`HaAC *FNLxNuH <3Ho">3XoDFf,3XHf<3XsHL0Nug">3Xl Ff,3HXf<3HsXL0Nu>3XFGF`,.*sh'xh'x*sh'xh'xNu,.*rh%xh%x܆އ*sh'xh'x*sh'xh'xNuC&pHQ/Hy@NA NuC pa:NuHQ/Hy?NA Nu&g4 Fga0gJAga2< R@AdSf0Nu0ap Ce`&g4 FgaJBjagPAe CbRa R@Sf0Nu FgRag JBjaAeaJAg RP0 pNu`t Fg6atgJAga @ea~RP Nup NHѨB?<?/?<BNAO JkLLNu&8aJBja.JAg Df*ڃkd0Nu DfրBH??/?<BNAO LJk!@NuHBHh Hx??<?NAO LJo ѨLNuk:fp`^k: g ѨNuBHPHQ/??<?NAO _JoѨfNuBHPHQS/??<@NAXLfѨNuJkp%`Hz` Hz`Hz&$A?<&NN\NuNu4Nu$Nu(a؀.nfa츀jNu?a0` ?a2@@a` a Nu4.hAf n4LR@RANu4.hg S@SAHNutbpbr??papYa0a0`aNJANuag `af`apNuapNuC`C``C` C`C-K JhfJfRRRRRRRHP? @CJH~8:E#P&<2 `b$bYEf`"RAf rЁЀ`&Ѐe "ЀeЁdp`ԢJAkfgRer?DDЁaAa8$HX :CJE` YEjT"_$P"2trDDd0d d d` QjNu`aDa DNu na^ K"ng42 $`gk2&Hg Af deђ$`ebѐXf&n Nu AgebѐA``-K x$ n($n$"HgD" &Akc(bѐ S`g(" k#&Ac(bё2+SAI3 Q&f-I$&n Nu-K x$&ր n($n$"Hg^" k&Ac(b b S` S`g:" k#&Ac(bbrkX`ؑ2+SAI3 Q&f-I$&n NuaT n4L6(ndnfHHHNua4 n40(ndHNua" n40(nfHNua n40(HNu`a Nu-Hj=hBnnNua` nja2np0nnc`Nua/ ? nj"XnRnnSnkx _g !g &g. \g.a`RnnSnkN`0"_fC7pH`60"_`pR@RnnSnk \f2"_gAc@@H?a0`Bp?a>0H"_`Nup?a,Lv`Hv nj"XnRnnSnk _g,vxz| +g2 -g, *g $g& #g$a`RnnSnk`` `RCSnk _f Snj`h #g $g *g.g ^gH +g^ -gX.fXxRDSnkL #g ^g +g4 -g. _f.RSnj`RESnk ^g +g -fRSnn nj? JEf0DH2HgR@?=n~jDnL8v@a8a<z Ndz* I0`  fEQNdS|$Ne Jn~j|- nj XnRnn0nnc|.g8 _g>.g@ +gN -gR $f ,fHQ!aJRnn"_p$RHQa:"_`Rnn`)  g *fp `Jn~jp-`Jn~kp `=_nSnnRnNuHLv=B~jDBN)LxC*E0RJCfRCR@r2HAARACd ` Efr0Sb Eg4 5e.!A*e0R 9c0`R1R@0c JEr+J@jr-D@UEoJYEc0SEnHJEf0SEH@HdREf0SEH@H 0 0REfH@C* nj XnRnn0nncJ.g _g .g +g -g HQaL`Rnn`Jn~jp-`Jn~kp `=_nSnnRnNu"H YJQfNu YH瀀aLP|HPGT,C&֛֛֛֛֛(HDDCBg6Cv6C[RCF8[[[aL6C[RCF8:GT,FWfTL L-K A `8$I\bfBjQNu$YbfBjQNu؄*؄؅CH`ᄘ؅X`$_  IaYHR"H @`ʘ؄*؄؅AHNu؅X`$_ IaYHR"H` .,Nup`p-@Nu(  Catalog <- CATALOG V2.1 -> | (C) Jan93 Walayat Software | | Sorry Medium Rez Only OKAY NORMAL<*>GREENAbout Catalog V3<-(C) Jan93 Walayat Software->Screen:Disk: NAME SIZE TYPEA B C D HROOT DIRECTORYDISK FREE= FOLDER######BYTES USED=*.*<- CATALOG V3 ->New Catalog V3 options :- 1) File contents viewer. 2) Rename / Delete files. 3) Create folders. 4) Grab and print screens. 5) Works in medium and high rez.Just send cheques / P/Os for only 3made payable to Walayat SoftwareP.O. Box 486, Sheffield S9 5YY. H "Hd,>8,,|N  n(,d( *~ f`((@4.LZ$VxVA횠 00pNHNA 00NA 00NA 00NA 00NA 00NA 00NA8 00NA@ 00pNHNAH 00NAP 00NAX 00NAH 00NA 00pNHNA훈 00N`T&@<AON!a/^;@$0-$gRET\p a;&2-$a@;@&pa/pa52-&HWHH/pa5r(WHHgNx``Nxa%H?<NNT+@pg,a(ETfpQa:/ETpa:r"_ta1+Apf\6<0<tra0prda?APa3aS6vptra0vptra0BmpXAVa:Na(6pU~AaJfpU~AaJZpU~AaJdpU~AaJ^pU~A aJ6pU~AaJ*pU~AaJ4 <|zxvd0<tra-a6a'rpa/ pa/*pa/(pa/lpa/6pa/4pa/6a/>v#ptr a-ETpa94tra2v#ptr a-vpa/$pa.pa.pa.pa.pa.a.ETkpa8t2<a2<6<p tra-*6<^pt 2<a-pa.pa.pa.a.pa.6<p t2<a,AhETpa+rgvptra.vptra.`4AhETpa+Fg"&<0<$<&ra.v(ptra.A\ (- m/0H("maGa -rҭa>A퀀a -r ҭa>EUBpa.aA(- m/0H( mAH 24aBaA(- m/0H( mAHa*ѭ`A\ A a"A8a#lA a "pAna-p\ag0-rHSAna,Cta%<^|2:<x 6<pxtr(apa pa pa pa a ETpa*tr-a#pa tpa rpa ta |pa 6<p tr(apa zpa pa pa 6<0<t22<apapapa6<0<t82<a~papapa6<0<tL2<aZpa papap aaEUVpa)tH2<a#,papapaaEUfpa)tT2<a#EUpa)t]2<a"EUpa)te2<a"EUpa)ntm2<a"EUpa)Xtu2<a"EUp!a)Bt}2<a"EVp$a),4<2<a"zEV%p a)4<2<a"bEVEpa(4<2<a"Jp#a8ja;g><^|2:<x 6<pxtr(aa&:`p]HH/ ]HHg -&<:<a a&<:<a Ba+@ -&<:<ava/aa+@"-pҭoBBm6 -"-ҭmR(-ح m/0H("ma@Cza!(-ح m/0H("m a@|a8gN(-ح m/0H("ma@Zp.a/(-ح m/0H("m a@6"_afCza!pAza).p*a/p]HHg\A00B00-~HSAza):Cta! ˀ^HH/ ]HHg (-"ma>L -(- m!H(-"ma>h(-"ma>"(- mAH 24(- mAH 00RpUl ^HH/ @]HHglA00B0 < ag( < a"< a4 <60HZAba%N`& < a"< a4j <50HZAba%& ހ^HH/ ]HHgBA00B0AhETpagETpAha`ETpAha ^HH/ m]HHg ^HH/ mB <r4<AaFgA0B0Aaa!`>  ^HH/ 'mB <r4<AagA0B0Aaza!j` %^HH/ ?mB <r4<AagA0B0Aa(a!` >^HH/ UmB <r4<AaPgA0B0Aaa `H T^HH/ mmB <r4<AagA0B0p a |p\Ana"A00B0pa2R <r4<A0a/ <r4<A0aȀgaa5UfpaAa:Aa: Aa:Aa9A a9Aa9Aa9><|zxvd0<traxAPanaJNua ?HnJ?<6NAP0.TXLNu 24&8:BfJBg f DfpNuJEgpNu 24&8:JBgfDf EfpNuJEgpNuDExa*`bDEa"`ZaR11!Nua11!Nu 24&8:DE`6 24&8:DB`&a&8:DE`DEx`a` 24&8:HnghDBHngXDE~<En g6@ABDFGcGcGb8(vHDl`G8BCHC` GHD8HD쬵k&Dуd QRB BbJjDBNu DENupN֓DjdDA@ cAр[SBoJjDBNurptNuH@g0J`Ѐ[rGoJjDBNu0ftNu@[rB oH@JjDBNu $HkBk Bj*DBNupNuDBBkBjDBDNuf gp` 246jDCCe0 C/jC C@j C jr0H@{0>H@Nur{0Nu{0NutNu 246j(:<DCaf AfBfNu` a 00Nur$o, b4< J@k @[H@NuH@RBNu4<Ѐ[NuDg8k2 b4< J@k @[H@DBNuH@RBDBNu4<Ѐ[DBNu4H@Ѓdh`^HCH@:">H@`H2g&HCH@:<HC>H@Ѓd(`HCH@:H@r` gDBgkDE`HDBDEaBDBNugDBa8DBNutNua 11!Nux`xa`a` 24&8:HoHoEBJAgJDfr:g,|HC҅H@:ۆ<HC>H@Ѓd`vHCH@:H@`fgDBgkDE` DBDEaDBNugDBaDBNutNuHoHoEBz:g|HC҅H@:ۆ҄ۆ<HC>H@ЃdHA@B@H@хk HAҁHAрSB BbNuJBj^tNuk(g.JBjDBAр[SBDBjNutNuAр[SBkNuJlNu0gH@rJBkB JkЀ[`DBЀ[`J.=gP0rHGGdHGGdSWDуdi?<>0rHGGdHGGdSWDуdi2?<>0rHGGdHGGdSWDуd&2 H@kփAр[SBkփejRAd RdQRBJjDBNutNuCEdSW`?<,>CEdGeH@0r`fJCgz?<0rÐdSWЃdi?<0rÐdSWЃdid?<0ÐdSWЃd&2 H@kփAр[SBkփejRAd RdQRBJjDBNutNu?<0riP?0i?`?<`VdapEWWgPW`LJg&B.C`a8aD*9Wfap-I4=|p4aHz*9Wg ENp9W` _a &nO:NMWI"KVf$<Nu[1][Error +111][Return]EVd g g>Jf`Ar Hjr-D@Hd0H@H 0H@0CNuAJ"H [1][fSEfNu`HQ?< NA\Nu"_KVfMW V,@I"O:HQ <-H,,`N, d d3 d# d# # d# # # # d ALH dAL H LH d AL`H L|0H>L|H>d~# # # # A`@ALH L|H>L|H>L|PH>L| H>L|H>L|H>L|H>L|`H>L|0H>L|H>QL|Nu$H$&"BA -K aXA$f B &n NuH>dd2d"d""d""""d LHC dLHLH C@d LHL|H| L|H|PCd~""""C`:LHL|H| L|H|PL|H|L|H|L|H|L|H|L|H|@L|H|pL|H|L|H|CQL|Nua`p?a a?<LNA``NuNu`aza`aaaHA"-Hpp alpMah=@N?<NNTT@A0r p0Q`pdr ta0.N=@=@ ACp,2QAp 2Qa a`\`Xpea>pCZ2Ad0A2r22a"<'0<NBL Nurt=@B=AH=BDa"<'psNB0.Nu=@0=@=B0=@aj"<'psNBNuC2 @ e$ @bA0AP2r22aP"<'0<NBLJNup"AJӘQNuA> NuHz(` N'Hz ?<&NN\Nu9@gNuW@Nuf  Zf 4\B&0D4(*<B$,>2::(   F..26"8@"PQ1!P1P!0PP`0  q#aaaa O: n,NNuNuNuNuHz `Hz"` <Hz&?<&NN\Nup CNup C0Nu C NuJBgVB&8TTDуdQRBNuDAр&AdRAрAрDуNu <r4<NuQnHR$n4Jjg$_NuH LNuPnJ.ng0HR$n4Jjf$_NuHC/*%I $n4%_LNu B?b4<rpAv JBlDBv-|JBg Bb Bk&H>aTaRFBd&8*L?a<aSF Be BgQRB`RAdR e <rRF&0xaCٱfEv+0JFjDFv-Hƌd0BFHF 0HF0ANuprt|`HQ2.l Aeg>r C 5e&!R 0c 9c0`<R"_`VC0 Ef"_Nuaa/ CJr  g 00VJAgB @ nN @mHJ@j0.4DBUBk0QSAg Q.`S@k 0`0BAJ "_Nu.WAkQA 0g` @$@JfS a"`QNu$Aa`QBNu?aHQA(B?<NNAP DJNu?<ONATNu?</NATNu/?<NA\NuHz Ta `Hz JaH `HPHQ0(ika $I _a~IUd4Id4Id$Id `$$$$Q _Jf,aNId4Id4Id$Id `$$$$Q @NuSa IdIdId`Q @Nup `/ a$I> _a޲G` VNuag`af`ae `ac` acpNuadpNu/ a$I> _a4Ae4v` VfANuHP0(R@kBa $I _ahIUd4Id4Id$Id `$$$$Q @JfNuNup `:a*SAfNuag`af`ae `ac` acpNuadpNuaSAkfJANuH HPhkJa $I _aIUd4Id4Id$Id `$$$$Q @JgSL`QNup `aAf` VNuag`af`ae `ac` acpNuadpNuaP4@m4v` Vf@Nu/HP0(X@kHa 6 $I _aIUd4Id4Id$Id `$$$$Q @Jf$Nu $Nup `a YAfNuag`af`ae `ac` acpNuadpNua SAkEJ$p VfWANuHAHBHCHDHEHFHG-HfAN-HH@-@Hp`rAN-@f-H `r6 @`0.jHNupNuAG` AI`AJH=@ `Tz`z `z8.fndDnd@Hp tr=EL`ndnf648HHdprt`ndnfndnf8HHdprt`"_A d4RB`"_A42LdA` L0GF11Q-pdprHQ`PBp'rtaB n4rt6(SC0(S@apaBdpapava0pa _a 4$FAJp_@[000][vx`* [g" ]g |g QSx` xQSrQ][vx`* [g" ]g |g QSx` xQStQ]BAJ0-H4=@p4a2HNu 24DBaDB11!Nu 24DBa DBNu 24x6o<Ce(FC BdЄeNu B/dHDDdRdQRBNu&<:<`g BbUC BcjNu BcHDDdSkg RBAрjNuNu0ftNuB H@"jNu Lx6oFCe0FC BdЄe!Nu B/dHDDdNAXOJkpNu0< aH`0< CJ2p`p a2`p CJp`a CJ"p`Hza`Hy7R"J`B.D=|HNua.DFpAR@C`n @H` @HHy7Raa"H`LHP?.l=hlN*=_l2 "@$Y4Ad2`0Q @NuH@&g( b⸃bLHaLC 8$Ir `Q"Jr0XDQD@CtEe PA`fRشf`e"J*c j|0"cRLJgR $I.f) 5e*0!.g -g  g 9f 0b`RB`1`p `@`r ??a"P02R@H`2Q Nu<>Hz?<&NN\`f n4LLJFj|@c<JGj~Ac>02 h|N n4HHNu80a|DHz ?<&NN\Nu| n4 h N n41@Nur ?HQa. _/ ?a$0 _4gSB@c:Ad,J@gB@BmS@,. RB6Vg(R F"GQpNufJ@fRB`fS@kVft0HNu=AaAD09BRyBH@@-HtBe2QB p#`a$ZXNuHzxlJj xo`xdJjxc, EJDD`DDD Dz$X Pf-K &e "&J$IpSNup`.L4 fd$R$&k(*ڄNdNjRofNu.#AHAȿe(*NdN$&Rgp$(؁*Ne*(NdN(*Ro2(NdS(So&*NdB*RRNf$f$SD`S(l//"a R"mxNupЂmlNu 24JBkCkNuCktNu 24JBoSBNugRBNuBnz`pBnz`p=| z|=Fx@=@l=nh|a,Ht=Ar~`:a JfBH@ RfF.p Kg" Mg sg tg Pg Hf~`xSGjtRGFcn>`jAJ gp gj g grffnnzenlfJ.pj6pRGFc$SG` J.pjpRGFcRF` Ff`> `?~ap a0p a*0Nu|``CpE`bf`FgRGJGgSGSFFgCpE`Yf`Nua@Jf gH@ fa(@ fza0 b @ Ee0NuagNu4.|f?HyaNM\Nu=|H`LtazEfpadppa`AJEg0PaEfaFRE`ܾEfp a@a8?nxnp a2RF`<a@nxoS@f nrfSnv=Ar=FxNup` papq4.|f?HyaHNM\Nu=|HHaVLNu|A0"P2(@e2<EJ`QHP=|HJ@g$abAJ$HpR@ 0 f _a`QNuHPp?ap a _2<|0`HP$ZXAB6<Q _NuHz`Hz*a$_HaC`2Hz`Hza$_HaXC`2E`EHaVCZA`E`EHa$C>A *FM3x?Fc>֞VSGk Vf>FNuTNuHpr,.܆އ܄ޅ܆އ(sh*sx<3h>3x?Fc>֞VSGk66Vf >FLNuTLNu,.܆އ܄ޅ܆އ*sh'xh'x:sh7xh7xNu,.*rh%xh%x܄ޅ܄ޅ*sh'xh'x:sh7xh7xNuE@`ExHaA`E(`E`HaAC *FNLxNuH <3Ho">3XoDFf,3XHf<3XsHL0Nug">3Xl Ff,3HXf<3HsXL0Nu>3XFGF`,.*sh'xh'x*sh'xh'xNu,.*rh%xh%x܆އ*sh'xh'x*sh'xh'xNuC&pHQ/Hy@NA NuC pa:NuHQ/Hy?NA Nu&g4 Fga0gJAga2< R@AdSf0Nu0ap Ce`&g4 FgaJBjagPAe CbRa R@Sf0Nu FgRag JBjaAeaJAg RP0 pNu`t Fg6atgJAga @ea~RP Nup NHѨB?<?/?<BNAO JkLLNu&8aJBja.JAg Df*ڃkd0Nu DfրBH??/?<BNAO LJk!@NuHBHh Hx??<?NAO LJo ѨLNuk:fp`^k: g ѨNuBHPHQ/??<?NAO _JoѨfNuBHPHQS/??<@NAXLfѨNuJkp%`Hz` Hz`Hz&$A?<&NN\NuNu4Nu$Nu(a؀.nfa츀jNu?a0` ?a2@@a` a Nu4.hAf n4LR@RANu4.hg S@SAHNutbpbr??papYa0a0`aNJANuag `af`apNuapNuC`C``C` C`C-K JhfJfRRRRRRRHP? @CJH~8:E#P&<2 `b$bYEf`"RAf rЁЀ`&Ѐe "ЀeЁdp`ԢJAkfgRer?DDЁaAa8$HX :CJE` YEjT"_$P"2trDDd0d d d` QjNu`aDa DNu na^ K"ng42 $`gk2&Hg Af deђ$`ebѐXf&n Nu AgebѐA``-K x$ n($n$"HgD" &Akc(bѐ S`g(" k#&Ac(bё2+SAI3 Q&f-I$&n Nu-K x$&ր n($n$"Hg^" k&Ac(b b S` S`g:" k#&Ac(bbrkX`ؑ2+SAI3 Q&f-I$&n NuaT n4L6(ndnfHHHNua4 n40(ndHNua" n40(nfHNua n40(HNu`a Nu-Hj=hBnnNua` nja2np0nnc`Nua/ ? nj"XnRnnSnkx _g !g &g. \g.a`RnnSnkN`0"_fC7pH`60"_`pR@RnnSnk \f2"_gAc@@H?a0`Bp?a>0H"_`Nup?a,Lv`Hv nj"XnRnnSnk _g,vxz| +g2 -g, *g $g& #g$a`RnnSnk`` `RCSnk _f Snj`h #g $g *g.g ^gH +g^ -gX.fXxRDSnkL #g ^g +g4 -g. _f.RSnj`RESnk ^g +g -fRSnn nj? JEf0DH2HgR@?=n~jDnL8v@a8a<z Ndz* I0`  fEQNdS|$Ne Jn~j|- nj XnRnn0nnc|.g8 _g>.g@ +gN -gR $f ,fHQ!aJRnn"_p$RHQa:"_`Rnn`)  g *fp `Jn~jp-`Jn~kp `=_nSnnRnNuHLv=B~jDBN)LxC*E0RJCfRCR@r2HAARACd ` Efr0Sb Eg4 5e.!A*e0R 9c0`R1R@0c JEr+J@jr-D@UEoJYEc0SEnHJEf0SEH@HdREf0SEH@H 0 0REfH@C* nj XnRnn0nncJ.g _g .g +g -g HQaL`Rnn`Jn~jp-`Jn~kp `=_nSnnRnNu"H YJQfNu YH瀀aLP|HPGT,C&֛֛֛֛֛(HDDCBg6Cv6C[RCF8[[[aL6C[RCF8:GT,FWfTL L-K A `8$I\bfBjQNu$YbfBjQNu؄*؄؅CH`ᄘ؅X`$_  IaYHR"H @`ʘ؄*؄؅AHNu؅X`$_ IaYHR"H` .,Nup`p-@Nu(  Catalog <- CATALOG V2.1 -> | (C) Jan93 Walayat Software | | Sorry Medium Rez Only OKAY NORMAL<*>GREENAbout Catalog V3<-(C) Jan93 Walayat Software->Screen:Disk: NAME SIZE TYPEA B C D HROOT DIRECTORYDISK FREE= FOLDER######BYTES USED=*.*<- CATALOG V3 ->New Catalog V3 options :- 1) File contents viewer. 2) Rename / Delete files. 3) Create folders. 4) Grab and print screens. 5) Works in medium and high rez.Just send cheques / P/Os for only 3made payable to Walayat SoftwareP.O. Box 486, Sheffield S9 5YY. H "Hd,>8,,|N  n(,d( *~ f`((@4.LZ$VxV<0<t2<N6<30<t2<3NNBm~pNN+A+B ANNZgNZUgnNZSf.po "-pN(p"^HH/p^HHgAx0B00-BU@o0-BN2A 00ANAN"pA>N6p\NFgA`D,>AONa>ra=?<NNT+@ -f6EDpua,/EEkpa,r"_ta$~/ A퀰a & a*aD <'~A&aA$p ~AaA.p ~A aA"p ~AaApa#~pa#pa#6<0<tra"pa#\pa#fpa#d6<x0<tra"|pa#:pa#Dpa#B6<p0<tra"Zpa#vpa#@pa#>pa#pa!pa!pa!pa!a!><|zxv(0<tZ2<,a Bpa=+@ ȀWHH/ <r4<AagAa"N> ЀWHH/ACagAa#$N> ǀfA0B0N> fZpa pa pa a!A퀸a$><|(zxvpUtrapa pa pa 6<p}t(rapa |pa pa 6<pwt.r*apa \pa fpa d6<pqt4r6a~p a)paVp/aPpaJEEpata'JVHH/a?怟g><|(zxvpUtraA퀸a"pLWHH/plWHHgLEFpA퀾a#0ACa#2EFpa'/HmAC,*a5lAapa(0<$$a gN><|zxv(0<tZ2<,a4N>pEWHH/peWHHgAC""N>pf6EFp9a&x/EEkpa&jr"_tah/ A퀰a apPWHH/ppWHHgaEFp/a&/EGpa&r"_ta+Apfba <r4<AaarЁ+@pЭ+@+m -a`a#B(-"m&a=aR -o]N>pftaJa(RAa :pa(A 24a)EGp ah/A 24a("_at2<a pa <r4<AaPa rЁ+@pЭ+@Ap0B0+m -a`4-opa`pa^pa\paZabp+@ A퀨aa`f(- mAH// -a\8:&ag<(- m AHada(- mAHaNapapaaR - o]Apa"/(-"m&a<$ra <r4<ApaR -o]`&~a&x"m&a;C퀾a(a#x"m&a;0-H+@p+@Bm+m -a`A퀨aA퀨a/prҭA퀾a%a'( mAH 00A퀨aX/prҭA퀾a%~a'n( m AH 00A퀨a(/pr ҭA퀾a%Na'>( mAH 00p ѭ -oX]`%a 24&8:BgnpNu<ngfDcpNufAcpNu 24&8:JBgfDf EfpNuJEgpNupa JkpNupNua#AHPB?HQ?<NNAP _NuDExa*`bDEa"`ZaR11!Nua11!Nu 24&8:DE`6 24&8:DB`&a&8:DE`DEx`a` 24&8:HnghDBHngXDE~<En g6@ABDFGcGcGb8(vHDl`G8BCHC` GHD8HD쬵k&Dуd QRB BbJjDBNu DENupN֓DjdDA@ cAр[SBoJjDBNurptNuH@g0J`Ѐ[rGoJjDBNu0ftNu@[rB oH@JjDBNu $HkBk Bj*DBNupNuDBBkBjDBDNuf gp` 246jDCCe0 C/jC C@j C jr0H@{0>H@Nur{0Nu{0NutNu 246j(:<DCaf AfBfNu`Ba 00Nur$o, b4< J@k @[H@NuH@RBNu4<Ѐ[NuDg8k2 b4< J@k @[H@DBNuH@RBDBNu4<Ѐ[DBNu4H@Ѓdh`^HCH@:">H@`H2g&HCH@:<HC>H@Ѓd(`HCH@:H@r` gDBgkDE`HDBDEaBDBNugDBa8DBNutNua 11!Nux`xa`a` 24&8:HoHoEBJAgJDfr:g,|HC҅H@:ۆ<HC>H@Ѓd`vHCH@:H@`fgDBgkDE` DBDEaDBNugDBaDBNutNuHoHoEBz:g|HC҅H@:ۆ҄ۆ<HC>H@ЃdHA@B@H@хk HAҁHAрSB BbNuJBj^tNuk(g.JBjDBAр[SBDBjNutNuAр[SBkNuJlNu0gH@rJBkB JkЀ[`DBЀ[`J.=gP0rHGGdHGGdSWDуdi?<>0rHGGdHGGdSWDуdi2?<>0rHGGdHGGdSWDуd&2 H@kփAр[SBkփejRAd RdQRBJjDBNutNuCEdSW`?<,>CEdGeH@0r`fJCgz?<0rÐdSWЃdi?<0rÐdSWЃdid?<0ÐdSWЃd&2 H@kփAр[SBkփejRAd RdQRBJjDBNutNu?<0riP?0i?`?<`GapEHNHbgPHP`LJg&B.C`a8aD*9HZfap-I4=|p4aHz*9HZg ENp9HN` _a &nO:NMHbI KG$<Nu[1][Error +111][Return]EG g g>Jf`Ar Hjr-D@Hd0H@H 0H@0CNuAJ"H [1][fSEfNu`HQ?< NA\Nu"_KGMHb V,@I O:HQ <-H,,`N,d d3 d# d# # d# # # # d ALH dAL H LH d AL`H L|0H>L|H>d~# # # # A`@ALH L|H>L|H>L|PH>L| H>L|H>L|H>L|H>L|`H>L|0H>L|H>QL|Nu$H$&"BA -K aXA$f B &n NuH>dd2d"d""d""""d LHC dLHLH C@d LHL|H| L|H|PCd~""""C`:LHL|H| L|H|PL|H|L|H|L|H|L|H|L|H|@L|H|pL|H|L|H|CQL|Nua`Np?a a?<LNA``NuNu`aza`aaaHA"-Hpp alpMah=@N?<NNTT@A0r p0Q`pdr ta0.N=@=@ ACp,2QAp 2Qa ^a`\`Xpea>pCZ2Ad0A2r22a""<z0<NBL Nurt=@B=AH=BDa"<psNB0.Nu=@0=@=B0=@a"<fpsNBNuC2 @ e$ @bA0AP2r22a"<N0<NBLJNup"AJӘQNuA> NuHz(` NLHz ?<&NN\Nu9gNuWNuf  Zf 4\B&0D4(*<B$,>2::(   F..26"8@"PQ1!P1P!0PP`0  q#aaa a O: n,NNuNuNupc?a0QNurdAd6Ag,B(dB(dH Ao<atoBAp`NuNu?<OA`d?<IA`Z0<H Ia Lt Ig Og Ug Ag Rg,afNup`ap`L0afHRa>Er$Wgr STD:gr COM:g r LPT:f4FA$_0=@Hk"~CA0< BhaFB2"pNu$_AJ Ge><QBAJpNuafgzp=` aZgzpaTaRFBd&8*L?a<aSF Be BgQRB`RAdR e <rRF&0xaCٱfEv+0JFjDFv-Hƌd0BFHF 0HF0ANuprt|`HQ2.l Aeg>r C 5e&!R 0c 9c0`<R"_`VC0 Ef"_Nuaa/ CJr  g 00VJAgB @ nN @mHJ@j0.4DBUBk0QSAg Q.`S@k 0`0BAJ "_Nu.WAkQA 0g`prt|P=Q<  g +g -f .g40  b 0e 9b da6`RF` .f 0e 9b daSF` Eg efX +g -f 0e 9oSH`00  b&Hz0  b E Do`ZJjDDDS4<.aJFkSFk4arQar`&HaFFaZQ&8*L/a,H܆jDBJ. _a JG` VNuag`af`ae `ac` acpNuadpNu/ a $I> _a 4Ae4v` VfANuHP0(R@kBa $I _a IUd4Id4Id$Id `$$$$Q @JfNuNup `a SAfNuag`af`ae `ac` acpNuadpNua bSAkfJANuH HPhkJa T $I _a  _a :4$FAJp_@[000][vx`* [g" ]g |g QSx` xQSrQ][vx`* [g" ]g |g QSx` xQStQ]BAJ0-H4=@p4a2HNu 24DBaDB11!Nu 24DBa DBNu 24x6o<Ce(FC BdЄeNu B/dHDDdRdQRBNu&<:<`g BbUC BcjNu BcHDDdSkg RBAрjNuNu0ftNuB H@"jNu Lx6oFCe0FC BdЄe!Nu B/dHDDd`g BbUC Bc j!Nu0Nu BcHDDdSkg RBAрj`0fBNuB H@"j`E$ea$ep`&6NuE $e az$d&&6NuE$e a\$d66NuE$e a@$d666NuE$e a $d6Nu <}at$Ia `$XaH`aHR?<NNT @"_ <}Nuvndnf~Hal0 @xepw2AtE4*jDjHB t`0QTAtp =| L`xa`QNuHg"cc/ 0)a _$PS@kH2QNu2(g$PRAA4DBH%$Y2Pg 1AHRAA%NuBhNuao aШNupNuaJFoHPJhja?<?B?<BNAO _*kBg?/(?<BNAO Jk NuNafoazJBkAf`a|??/?<BNA.k \Hx?<BNAO [HHNux`x*0ao< 2fJjr`NAXOJkpNu0< aH`0< CJ2p`p a2`p CJp`a CJ"p`Hza`Hy)"J`B.D=|HNua.DFpAR@C`n B.D=|HNuB.Da=GHgNup`Jg$_a: HN$_a: HN$_aBHN$_a؄BpHN$_aB0HN$_axBpHN$_alN$_ab؄N$_aXN$_aPN$_aF 0HN$_a:؄00HHN$_a,p0HN$_a 24N$_a:p 0HgpN"X I"_(*UGk*<(؆QNp`p`p` p`pJPg`$_a!HN$_a؄1HN$_aHN$_a 00N.D<.HAx$I"t Q k"RGef~`SG * g *fSG`<.HjZ\FkBJnhg Fgd Fg^HS&I.aBQ`p???<NM\Qj&_NuHQ/?.H<jRGg>VGg:TGjp`\HPa0CJ$IpR@  f _aHd2Hd2`"QNu`<.HHSGJaAIg f< &_Nua`(Nu.nfaB1=nh|>.H<jRGg.H<jRGg*VGgTGjp`><.Ha*`" y1 faa` y1 f aaAJ "g pR@0 ,g  g  fHp`:pR@0  g  g "fR@0 ,g  g  fHpRU@"_  f#1$H _a`QNupR@0 ,g"  g  fa~ (fR~Nua ~ `a~NuaJkHQ ! gRf _NuXX~Nu0jx\@??<NMXJk .ngp Nu`<.HHSGJa ,g gAIf< &_Nu ."Jf +"g ,g`2(gbc  P"H`Nu/0HaX2  _ PSAvjx E(Wf* ae zb Q @NuBnz`pBnz`p=| z|=Fx@=@l=nh|a PHt=Ar~`:a JfBH@ RfF.p Kg" Mg sg tg Pg Hf~`xSGjtRGFcn>`jAJ gp gj g grffnnzenlfJ.pj6pRGFc$SG` J.pjpRGFcRF` Ff`> `?~ap a0p a*0Nu|``CpE`bf`FgRGJGgSGSFFgCpE`Yf`Nua@Jf gH@ fa(@ fza0 b @ Ee0NuagNu4.|f?HyafNM\Nu=|H`LtazEfpadppa`AJEg0PaEfaFRE`ܾEfp a@a8?nxnp a2RF`<adnxoS@f nrfSnv=Ar=FxNup` papq4.|f?HyaNM\Nu=|HHaPLNu|A0"P2(@e2<EJ`QHP=|HJ@g$abAJ$HpR@ 0 f _a`QNuHPp?ap a _2<|0`C&pHQ/Hy@NA NuC pa:NuHQ/Hy?NA Nu&g4 FgagJAga2< R@AdSf0Nu0ap Ce`&g4 FgaJBjagPAe CbRa R@Sf0Nu FgRarg JBjaAeaJAg RP0 pNu`؂ Fg6a:gJAga @eaDRP Nup NHѨB?<?/?<BNAO JkLLNu&8aJBjaJAg Df*ڃkd0Nu DfրBH??/?<BNAO LJk!@NuHBHh Hx??<?NAO LJo ѨLNuk:fp`^k: g ѨNuBHPHQ/??<?NAO _JoѨfNuBHPHQS/??<@NAXLfѨNuJkp%`*B9`$H EaA AerQBL@͉H Ia("H _/ aat _/ ?ajAJ-H AerQB2"_A*-H A e ` \gQBa9gaZe -|p[`pZaܮajAJ"H0.g "Hg \f`A*fS !.gR EJ _a`QNuHz?<&NN\ @Nu x NuADBh`ADa nD!|}Nu?/NT` pNuNHMHbAp f9HIkn n4!|;v ||9HH"XLv:g 4zg*Ag61 cg Jg ;e, ]b& Te` Db; g fg  bJg fg fg,HC#0j ` Hx Dg;0L=YBj@1BA gbШ nA gd BBnL@Nu wHHKMPPR g,g&yHH`pBy=XB@etAg1B# `\HCHSGvg*1B f  f&< # XB@etAf&_`A>LCgZ"HyNN#;.HH>"NN @A C#P B?< NA\#> /a?< NA\A0N @ NuA#? ?v x hg3&;AC`g#P Nu?<"NNT @ 9;g!@ HzT?<&NN\3Nu#>NuHz ?<&NN\NupACE>rJg" XX\QNuACr g"XQ!ACf NuHx`(Hx`"Hx`Hx`Hx`Hx` Hx`Hx !4VxH A3?t Ni LHMHbO:|1R/9> ?< NAO:pdz`/MHba,_NHHNu?a0` ?a2@@ar` a Nu4.hAf n4LR@RANu4.hg S@SAHNutbpbr??papYa0az0`t.nfNung"J9HIkfa4fp`\n`/9H^ng/9HRng/9HVNupA@t-H=@p4aFS@Nu[2][Programmstop?][Stop|Cont]D@v`v??NMXJNuJ@k??<NM"UAf J@fH@Nuadj0fpNu\@`aP`]@><CJ Ipa<0HNua4`]@><CJ Ipa Nu?|`?a0R@f|0aHJFkHPa\ _Nupo`BHSHP&I>g\SG??<NMXJk Q _t&_Nu&_`aJANuag `af`apNuapNuC`C``C` C`C-K JhfJfRRRRRRRHP? @CJH~8:E#P&<2 `b$bYEf`"RAf rЁЀ`&Ѐe "ЀeЁdp`VJAkfgRer?DDЁaAaѴ8$HX :CJE` YEjT"_$P"2trDDd0d d d` QjNu`aDa DNu na^ K"ng42 $`gk2&Hg Af deђ$`ebѐXf&n Nu AgebѐA``-K x$ n($n$"HgD" &Akc(bѐ S`g(" k#&Ac(bё2+SAI3 Q&f-I$&n Nu-K x$&ր n($n$"Hg^" k&Ac(b b S` S`g:" k#&Ac(bbrkX`ؑ2+SAI3 Q&f-I$&n NuaT n4L6(ndnfHHHNua4 n40(ndHNua" n40(nfHNua n40(HNu`aNu؄*؄؅CH`〘؅X`$_  IaYHR"H @`ʘ؄*؄؅AHNu؅X`$_ IaZYHR"H`p`p-@Nu, <- Text Viewer V1 -> | (C) Jan93 Walayat Software | P.O.BOX 486, Sheffield S9 5YY| Sorry No support for Low Rez OKAY V1 (C)Jan 93 Walayat Software, P.O. Box 486, Sheffield S9 5YYPress for Key Commands Total Pages=CAT_V2_1.DOC Arrow Keys to Jump pages E = Move to End of Doc File L = Load Doc File P = Print Current page Clr Home = Move to begining of Doc File Escape = Exit*.*<- Load Doc File -> <- BYE -> | Thankyou for using | Text Viewer V1<- PRINT CURRENT PAGE ->| | Print Page ? YES | NO Page=  02,z.h 0L4. *~ f`((@4d$B 8~|  $@& $x 00 -N/??ACN&<:<$$100051211610007111041002012104100421211610137121161015411104 View In Medium or Hi-Rez (Above line for use with Text Viewer) 15/1/93 <--- CATALOG V2.1 PD ---> (C) Jan 93 Walayat Software Catalog is a multi-purpose disk catalog desk accessory, which can also be run from the desktop as a PROGRAM by changing the file extension from .ACC to .PRG. Catalog runs on all ST's in Medium Rez. Catalog is completely mouse driven, use the left button to select options and the right button to exit. Folders are denoted by '*' and can be accessed just by clicking them. To move back towards the Root Directory click the box in the top left hand corner of the screen. What can Catalog V2.1PD do ? 1) Display upto 80 files/folders on screen at any time with the size of the files i.e. DESKTOP .INF 512 2) The ability to sort directories quickly by either NAME,SIZE or TYPE. 3) Display free disk space, and the amount taken up by the contents of folders. 4) A Green screen emulator / Normal screen switch. 5) A 60hz Big screen / 50hz Normal screen switch. - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - CATALOG V3 Is available from Walayat Software for only 3 inc P&P. In addition to all of the functions of V2.1 Catalog V3 can also :- 1) Work in Hi-rez as well as Medium Rez. 2) View the contents of files, whether or not they are in ASCII format. 3) Delete / Rename files. 4) Grab and dump screens to the printer. 5) Make folders. Other available software :- The Analyst V3 The AnalystV3 is the most advanced Technical Analysis program available for the ST, which contains some of the most powerfull techniques for analysing market prices:- commodities, currencies, equities, or any other price data, in a flexible and easy to use operating enviroment, with many automated analysis procedures. The Analyst is fully menu driven and comes complete with a comprehensive 50page+manual, providing a clear and easy to understand description of the selection, operation and interpretation of each analysis tool. The range of facilities offered by The Analyst represents exceptional value for money, The Analyst was designed with one purpose in mind, to increase your trading / investing profits, with sensible use The Analyst should repay your investment many times over,leaving your hands free to study the markets. A brief list of Technical Tools ------------------------------- MOVING AVERAGES Simple, Band, Weighted, Buy/Sell Trading System Candle charts Timing Signals (A whole range i.e. Key reversal days) Price Gaps OSCILLATORS Oscillators, R.S.I, R.O.C, M.A.C.D, Adv Dec Osc SEASONAL ANALYSIS Many different algorythims, Bull/Bear & Normal Seasonal charts Seasonal Charts alined to the price charts. Multi time period seasonal charts. Store Options:- Ability to store trendlines,gann angles,elliot waves etc... Draw Stored Options :- Automatically draws stored options. Chart markets :- Chart other markets alined to current charted market. Chart Spreads , between different markets. Point & Figure Charts, fully user defined boxes & reversal boxes. SWINGS ANALYSIS Multi-level swing charts User defined swings Computer generated swings Swing Cycles Balance Point Lines Swing Support / Ressistance levels. Zero Balancing lines. Swing Scattergraph. Swing Cycle frequency table. Seasonal Swings table. Directional % Swings table. Tops / Bots Table Price objectives forecaster. GANN / FIBANACI ANALYSIS Turn each angle line on/off Gann Angles % Retracement zones Time zones Fibanaci Time Lines Time ratio's Master Squares Cardinal Squares Store Elliot Waves ELLIOT WAVES :- Draw , Store & Edit stored. VOLUME Volume bars Equi-volume On Balance Volume (OBV) Volume Accumulation (VA) DISPLAY Trendlines Forks / Median Lines / Reverse Median Lines Cycle Finder Cycle Finder (b) Price Finder Hi-Low Ratio Chart There are also many non technical options such as :- Screen Pallete definer Screen Dump Grab Screen , Put Screen Zoom In, Zoom Out, Refine Price charts. Update, Edit price data, Edit Display, Setup New Market file Load , Save , Delete market files Load , Save Screens Calender, Catalog V2.1 SYSTEM INFORMATION Contains many system options from date & time entry to configuring the printer. The Analyst comes complete with a comprehensive 50page+ manual and fully upto date market data historys on the FTSE 100 Index & /$. The Analyst V3 works on all ST's in Medium Rez only, and requires a minimum of 1 Meg memory. The Analyst V3 is available for 17.50, A PD version with all file options enabled is available for 2.50 (works on half meg+ ST's) CALCULATOR V1.5 Calculator as the name suggests is a calculator emulator, that can be run either as an desk accessory or as a program, in addition to the normal calculator features i.e. +,-,X,/,%,SQR RT, The Calculator has also 5 memory functions and an extra memory display. Calculator V1.5 is available for only 2.25 inc P&P. All foreign orders must add 2.5 and make payment in pounds sterling. Make Cheques or P/O's made payable to Walayat Software and send to:- Walayat Software All orders are dispatched within 21 days of Dept ST receipt. The prices mentioned in this Doc P.O. Box 486 file are valid until Dec 1995. Sheffield S9 5YY If you require upto date information then please send an S.A.E. to :- Walayat Software ST Information P.O. Box 486 Sheffield S9 5YY zڭx m"؅AH 00+m -N`zڭx m"؅AH 24*-x m"؅AH 00pNjpNpNA퀠N(*- m(؅AH//A퀠N/zڭ( m(؅AH24 N~/*-x m(؅AH//zڭxhnique. If you do come across a program that won't work properly when PinHead is active, you can either disable PinHead manually before running it, or add its name to your PINHEAD.DAT file to disable PinHead automatically when that program runs. (See "Disabling PinHead," "Turning PinHead On and Off," and "Configuring PinHead" above.) ************* * * * NEW STUFF * * * ************* *************************** PINHEAD 1.4 ******************************** PinHead Now Fastloads Itself! ----------------------------- Version 1.4 of PinHead uses an undocumented feature of TOS 1.0 and 1.2 to "fastload" itself. This means that the speedup starts one program sooner in your AUTO folder, since the PinHead program file does not cause memory to be cleared when it runs. (NOTE: Normally, the use of this undocumented feature would result in the PinHead program file being left "open" by the system. PinHead 1.4 uses a special technique to avoid this bug in TOS, and you will have no trouble deleting, renaming, or copying the PinHead program file after it runs.) New "Wildcard" Configuration Option ----------------------------------- Starting in PinHead 1.4, you can now specify a default amount of "extra" memory to be cleared automatically for every program _not_ listed in the PINHEAD.DAT file. This way, if you have a problem with PinHead, you don't have to go laboriously searching through your AUTO folder and accessories to find the one that's crashing -- just list a default amount of extra memory in the PINHEAD.DAT file. To do this, just create a PINHEAD.DAT file that looks like: PH13 *.* 16 In this example, we're telling PinHead to clear 16K of extra memory whenever any program runs. The wildcard specifier "*.*" is used to mean "all files/programs". This should be followed by a space, then the amount of K (kilobytes) you wish to clear beyond the program's BSS. If there are other program names listed in the PINHEAD.DAT file, either before or after the "*.* 16" line, they will be processed according to the rules explained in the section titled "Configuring PinHead" above. *************************** PINHEAD 1.5 ******************************** Now Compatible with TOS 1.6 (STe TOS) ------------------------------------- PinHead 1.5 is compatible with the new version of TOS being shipped in the STe computers. No other changes were made from version 1.4. *************************** PINHEAD 1.6 ******************************** Now REALLY compatible with TOS 1.6 ---------------------------------- Well, I was wrong. Version 1.5 of PinHead didn't work with the version of TOS 1.6 that's in the STes currently being sold in Canada and Europe. PinHead 1.6 does. (The STes Atari gives to developers have a version of TOS that says it's "1.6"...but it's not the same TOS 1.6 that's in the existing machines. PinHead 1.5 did work with that TOS.) *************************** PINHEAD 1.7 ******************************** Better Compatibility With Ramdisk Programs and DC Desktop --------------------------------------------------------- PinHead 1.7 now uses a different method (suggested by Mike Vederman; thanks, Mike) to accomplish a certain task, that results in better compatibility with some ramdisk programs, the Shadow background transfer accessory, and DC Desktop. PinHead Now Follows the 'XBRA' Protocol --------------------------------------- A new version of Atari's POOLFIX program (which is needed to patch a bug in TOS 1.4 and 1.6) has recently appeared; the new program is called POOLFIX4. A user in Germany apparently disassembled the latest POOLFIX (POOLFIX3 - the one that worked) and added XBRA compatibility so that it would not have to be the very first thing in your AUTO folder. (Atari has given their permission for this program to be posted on the info services and distributed.) The catch is that in order for this to work, every program that runs before POOLFIX4 must _also_ follow the XBRA protocol, and not many do. Well, now PinHead is one of the few. PinHead 1.7 can be installed in your AUTO folder so that it runs before POOLFIX4...so now you can squeeze every last ounce of speed out of your bootup. PinHead 1.7 Is Also Compatible With the 68030 --------------------------------------------- PinHead 1.7 is now compatible with the 68010/020/030/040 family of microprocessors, so when the 68030 upgrade boards start hitting the market, PinHead will be ready for them. *************************** PINHEAD 1.8 ******************************** Even More Compatibility! ------------------------ PinHead 1.8 is primarily a "bug fix" version. There was a small problem with the code suggested by Mike Vederman for DC Desktop compatibility (see above; sorry, Mike), such that PinHead could cause some programs to crash under certain conditions. This problem has been repaired, and as a result this version should be sturdier than ever. Default Memory Clearing ----------------------- PinHead 1.8 now clears an extra 32K of memory beyond the BSS area of all programs, as a default. Through experimentation and reports from users, this seems to solve most (if not all) of the problems with programs that expect to find all memory clear when they run; and the clearing of 32K happens so fast that it is indistinguishable to mere human senses. If you don't want PinHead to clear even this much extra memory, create a PINHEAD.DAT file (please see above for a full explanation of the PINHEAD.DAT file) that looks like this: PH13 *.* 0 *************************** PINHEAD 2.0 ******************************** The Closer You Get, the Better That PinHead Looks! -------------------------------------------------- Version 2.0 of PinHead is now compatible with all versions of TOS greater than 1.2. This includes the TOS installed in TTs and Mega STes. And that's about the only real difference in version 2.0! OK, So I Lied... ---------------- There's one other small difference. In PinHead 2.0, I've removed the "hot key" on/off features. The reason? Actually, there are three reasons: 1) the code to perform those "hot key" functions seems to give MIDI programs fits, 2) to reduce overhead in the time-critical MIDI/Keyboard interrupt, and 3) the feature just didn't seem all that useful any more; it's better to add the name of any problem program to the PINHEAD.DAT file, as described above, and besides, this latest version of PinHead is so compatible that there really are very few problem programs! Special Thanks... ----------------- ...go to John Eidsvoog for discovering a new method to accomplish one of PinHead's nasty, dirty tricks. This new method is what lets PinHead 2.0 work on TOS 2.xx and greater. *************************** PINHEAD 2.1 ******************************** A PinHead Full of Trouble... ---------------------------- Seems a lot of people didn't understand that Pinhead 2.0 was only supposed to be used with TOS 1.4 or later, and that they should keep using PinHead 1.8 if they had an earlier version. Therefore, to prevent any more confusion -- here's PinHead 2.1, now fully compatible with all known versions of TOS, and with a new technique that should remain compatible into the foreseeable future. PinHead 2.1 is also lacking the hot key on/off feature of earlier versions, so people with TOS 1.0 or 1.2 who run MIDI software should be able to use this version with no trouble. ***************************************************************************** * * * PINHEAD.PRG and PINHEAD.TXT are * * 1989,90,92 Charles F. Johnson & Little Green Footballs Software. * * All Rights Reserved. * * * * PINHEAD 2.1 MAY BE FREELY DISTRIBUTED AS LONG AS BOTH THE PROGRAM * * FILE AND THIS DOCUMENTATION ARE INCLUDED, AND AS LONG AS NEITHER * * FILE IS ALTERED IN ANY WAY WHATSOEVER. NO PART OF THIS PROGRAM OR * * ITS ACCOMPANYING DOCUMENTATION MAY BE REPRINTED OR USED FOR * * COMMERCIAL PURPOSES WITHOUT THE EXPRESS WRITTEN CONSENT OF THE * * PROGRAM'S AUTHOR. * * * ***************************************************************************** practical application of a small phase-shift to God's Universe, to see if there was anything in those books that might help them with their problem. The books were very helpf. Q!/.. STDCAT50DOC 0STDCAT50PRG g STDCAT V5.0b User's Guide Copyright (c) 1988, 1989, 1990, 1991, By Bob Silliker All Rights Reserved THIS SOFTWARE IS BEING DISTRIBUTED AS SHAREWARE IF YOU USE THIS PROGRAM ON A CONTINUING BASIS PLEASE REGISTER BY SENDING $15.00 TO Bob Silliker 13097 107th Ave Surrey, B.C., Canada V3T 2G2 email: bobs@wimsey.bc.ca This manual was generated using PROFF V1.0 by Ozan S. Yigit & Steven Tress. V5.0b STDCAT User's Guide 1 Introduction Stdcat is a program that can be used to catalogue diskettes and hard disk partitions. It is a GEM window application using four (4) windows to display various parts of a catalogue. A catalogue is organized into sections with each section containing a number of disks, disk contains paths (folders), and paths containing files. Each section, disk, path and file can, optionally, have a comment associated with it. The program has three (3) ways to view the information in a catalogue. All views support four (4) windows, although, it is not practical to use all four windows in each view. In the first view, which is very much like the original program, the windows are setup dependantly with each window having it's own type. The window names are SECTION, DISK, PATH and FILE. To access information in the catalogue the user selects the SECTION of interest which will cause the disk window to display the disks in that section. The user can then select a disk, path and file. The second view organizes the windows hierarchically. That is, each window starts with SECTIONS. The user double clicks on a section of interest to descend to the disk level. The user can then descend further into paths and files using the same method. Each window can look at a different (or same) part of the catalogue. The intention here is to provide a means of comparing the contents of disks or paths. In the third view, the windows are flat with each window having it's own type. The window names are SECTIONS, DISK, PATH, and FILE. Each window displays all of it's type of information in the catalogue. In any view the user can sort the windows, enable/disable/order fields, and qualify (select) the information displayed in each window. The program was originally written to suit my needs and my way of organizing diskettes. Things have changed a lot from the first version and a lot of people have had input into it's present form. They know who they are and I thank all of them for their help. V5.0b STDCAT User's Guide 2 Quick Start I know that you will not read the complete manual. To get you started here is a simple step by step procedure. If you want to convert old catalogues for use with V5.0b then you must read the sections for the 'Open', 'Save' and 'Read' menu entries. 1) Run the program from the desktop or your favourite shell (remember that some shells require something like 'gem stdcat50' to turn the mouse on). 2) When the 'file not found' dialog is displayed just click on [OK]. This will bring up the menu and a blank screen. 3) Select the 'New' menu entry from the 'File' menu group. This should cause four (4) windows to be displayed. 4) Select the 'Add' menu entry from the 'Section' menu group. A section dialog will appear. 5) Enter a section name (can be changed later if you want) and click on [OK]. The section will be created and the dialog will disappear. The new section should be displayed in the SECTION window. 6) Select the 'Add' menu entry from the 'Disk' menu group. A dialog to add disks will appear. 7) Place the disk you want to catalogue into either drive 'A' or 'B' and click on either [DRIVE A] or [Drive B]. The disk will be read into the catalogue, the dialog will close, and the contents of the disk, path, and file windows will contain the information for the disk. 8) If you want to enter a lot of disks at this time (before reading the rest of the manual) then create all of the sections you want, select a section (highlight it), select 'Add' from the 'Disk' menu group, click on the [MULTI] dialog button (in the add disk dialog), if you are using two drives then click on [ALTERNATE A THEN B], place the disk(s) into the drive(s) and select either [DRIVE A] or [DRIVE B]. When the disk has been read in, place another disk in the drive and press [RETURN] or click on either [DRIVE A] or [DRIVE B]. When all of the disks for the section have been read in, click on [CANCEL]. The disk window should now contain all of the disks you have read in. Read the disks into the other sections using the same method. New Features Version V5.0b of STDCAT is mostly a re-write of the old STDCAT application. The main changes are: Removed: V5.0b STDCAT User's Guide 3 - the disk number from each disk. - the old printer output format. Added: - using the disk volume name to order disks. - the Flat view of the catalogue information. - the Hierarchical view of the catalogue information. - the section window. - the path window. - reading disks from Drive A, Drive B or alternate A and B. - reading hard disk partitions. - saving/restoring the setup (window sizes and positions and user configured options). - qualification for each window (that is, only selecting disks, paths and files that match a set of patterns on the important window fields). - disabling of window fields. - several field ordering options for each window. - storing catalogue information into an ASCII file. - date format selection. - keyboard short cut key sequences for all menu operations. V5.0b STDCAT User's Guide 4 Menus --------------------------------------------------------------------------- Catalog Section Disk Path File View Output Misc --------------------------------------------------------------------------- |New |Sort |Sort |Sort |Sort |Dependant |Layout |Read Setup | |Open |-------|-------|-------|-------|Hierarchical |Setup |Save Setup | |Read |Next |Next |Next |Info |Flattened |-------|-----------| |-------|Prev |Prev |Prev |Comment|-------------|Sizes |Def Windows|* |Save |-------|-------|-------|-------|Field Order |-------|Auto Newtop| |Save As|Info |Info |Info |Find |Field Enable |Printer|-----------| |Close |Name |Name |Comment|-------|Field Sort |File |Disp Format|* |-------|Comment|Comment|------- |Field Qualify|-------|Font Size | |Quit |-------|-------| ------------- |-----------| -------|Add |Add | |Cat Limits |* |-------|Update | |Cat Stats |* |Delete |-------| ----------- -------|Cut | |Paste | ------- * - these menu entries have been abbreviated. Catalog Menu New Start a new catalogue. When selected, this menu entry will open the four (4) catalogue windows in the default positions and sizes. All windows will be empty. The user has to add at least one section and then add disks into the section(s) created. This menu entry is enabled only when the catalogue is closed and a new catalogue is not being created. Open Open an existing catalogue. When selected, this menu entry displays the file selector dialog. The user selects the catalogue file to open and selects the [OK] dialog button. Selecting the [CANCEL] dialog button causes the open to abort. When opening an existing catalogue the program loads in both the catalogue information from the '.CAT' file and the setup information from the '.HI' or '.MED' file (depending on resolution). The positions and sizes of the windows and all user controlled options are restored to the state they were in when the catalogue was last closed or when the setup was saved. To select another setup the user can use the 'Load Setup' menu V5.0b STDCAT User's Guide 5 entry under the 'Misc' menu group. To convert V3.X or V4.X files for use by STDCAT V5.0b use 'Open' and then 'Save'. The 'Open' command will load and translate the catalogue to the new format. The older versions of STDCAT cannot read the new format. Please make a backup copy of an old catalogue before you convert it. This menu entry is enabled only when the catalogue is closed and a new catalogue is not being created. Read The read menu entry provides a means of combining catalogues. If the number of sections allowed in the catalogue is exceeded the remaining sections will not be read in. The only way to get all of the disks into the catalogue is to combine the sections. The program doesn't combine sections with the same name. If a catalogue is read in and one of the section names is the same as an existing section, and the read completes without error, then there will be two sections with the same name. If you want to combine the sections then the disks must be cut from one section and pasted into the other section one at a time, using the menu entries in the 'Disk' menu group. A rather painful operation. The program will not 'Read' the files produced from the earlier versions of STDCAT. If you have a V3.X or V4.X formatted file then use the 'Open' menu option and then the 'Save' menu option. This will load the catalogue and then convert it to V5.X format. Please make a backup copy of the catalogue before converting it. This menu entry is enabled when the catalogue is open or a new catalogue is being created. Save Save the information in the catalogue. When selected, this menu entry will cause both the catalogue and setup information to be written to disk. If the catalogue is floppy based then the program may prompt the user to place the catalogue disk into the drive if it thinks the diskette has been changed. This is not fool proof, you can, if you try, make it write to any disk you want (and of course you should be allowed to do that). This menu entry is only enabled when a catalogue has been opened with the 'Open' menu entry. V5.0b STDCAT User's Guide 6 Save As Save the catalogue under a new catalogue name. When this menu entry is selected the program will display the file selector. The user is expected to select/enter a new catalogue name and select the [OK] dialog button. If the user selects [CANCEL] the save will be aborted. If the user selects [OK] then a catalogue and setup file will be created. If the catalogue file already exists a dialog will be displayed prompting the user to write over the file or cancel the operation. If the user decides to write over the file then all the existing information is replaced with the catalogue information currently loaded. This menu entry is enabled when the catalogue is open or a new catalogue is being created. Close Close the catalogue. If any changes have been made to the catalogue information the program will display a dialog prompting the user to: save before closing; don't save before closing; or abort the close. If the user decides not to save before closing then all changes made to the catalogue information is thrown away. Every time the user closes a catalogue the program writes to the setup file. This is automatic and can't, at the moment, be turned off. This menu entry is enabled when a catalogue is open or a new catalogue is being created. Quit Quit the program and return to the desktop or shell. If there is a catalogue open, and changes have been made to the catalogue information, or a new catalogue is being been made, the program will display a dialog prompting the user to: save before quit; don't save before quit; or abort the quit operation. If the user decides not to save before quitting then all changes made to the catalogue are thrown away. This menu entry is always enabled. Section Menu Sort Sort the sections in each section window. If automatic sorting V5.0b STDCAT User's Guide 7 of sections has been disabled (in the Field Sort dialog) then this menu entry can be used to sort the sections. The program places a check beside this menu entry when automatic sorting is enabled. This menu entry is enabled when a catalogue is open and automatic sorting of sections is disabled in the Field Sort dialog. Next Move the cursor to the next section in the section window associated with the top window. This is useful when in the Hierarchical catalog view and the top window is displaying disks, paths or files. This menu entry is enabled when a catalogue is open, there is more than one section in the section window, and the cursor is not on the last section in the section window associated with the top window. Prev Move the cursor to the previous section in the section window associated with the top window. This is useful when in the Hierarchical catalog view and the top window is displaying disks, paths or files. This menu entry is enabled when a catalogue is open, there is more than one section in the section window, and the cursor is not on the first section in the section window associated with the top window. Info Display the Section dialog in read-only mode. This menu entry is enabled when a catalogue is open and there is at least one section in the section window associated with the top window. Name Display the Section dialog and allow editing. The cursor is placed on the Section Name field. Permits rapid entry of names without touching the mouse once [MULTI] has been enabled. This menu entry is enabled when a catalogue is open and there is V5.0b STDCAT User's Guide 8 at least one section in the section window associated with the top window. Comment Display the Section dialog and allow editing. The cursor is placed on the comment field. Permits rapid entry of comments without touching the mouse once [MULTI] has been enabled. This menu entry is enabled when a catalogue is open and there is at least one section in the section window associated with the top window. Add Add a section. This menu entry is enabled when a catalogue is open and the total number of sections in the catalogue is not equal to the maximum allowable. Delete Delete a section. Selecting this menu entry will cause a confirmation dialog to be displayed. If [CANCEL] is selected the section delete will be aborted. If you delete a section by mistake then just quit the program without saving (all changes will be lost) and re-run the program. The section will not have been deleted from the file and you can re-run STDCAT. This, of course, assumes that you had, at one time, saved the section in the catalogue. This menu entry is enable when a catalogue is open and there is at least least one section in the section window associated with the top window. Disk Menu Sort Sort the disks in each disk window. If automatic sorting of disks has been disabled (in the Field Sort dialog) then this menu entry can be used to sort the disks. If you change sections in Hierarchical or Dependant catalogue view then a sort will not be done on the disks in the disk window(s). The program places a check beside this menu entry when automatic sorting is enabled. V5.0b STDCAT User's Guide 9 This menu entry is enabled when a catalogue is open and automatic sorting of disks is disabled in the Field Sort dialog. Next Move the cursor to the next disk in the disk window associated with the top window. This is useful when in the Hierarchical catalogue view and the top window is displaying paths or files. This menu entry is enabled when a catalogue is open, there is more than one disk in the disk window, and the cursor is not on the last disk in the window. Prev Move the cursor to the previous disk in the window associated with the top window. This is useful when in the Hierarchical catalogue view and the top window is displaying paths or files. This menu entry is enabled when a catalogue is open, there is more than one disk in the disk window, and the cursor is not on the first disk in the window. Info Display the Disk dialog in read-only mode. This menu entry is enabled when a catalogue is open and there is at least one disk in the disk window associated with the top window. Name Display the Disk dialog and allow editing. The cursor is placed on the Disk Name field. Permits rapid entry of names without touching the mouse once [MULTI] has been enabled. This menu entry is enabled when a catalogue is open and there is at least one disk in the disk window associated with the top window. Comment Display the Disk dialog and allow editing. The cursor is placed on the comment field. Permits rapid entry of comments without touching the mouse once [MULTI] has been enabled. V5.0b STDCAT User's Guide 10 This menu entry is enabled when a catalogue is open and there is at least one disk in the disk window associated with the top window. Add Add a floppy disk or hard disk partition to the currently selected section. If you add a partition please remember, and take precautions against, the 40 folder bug. To alternate loading disks from drive A and B. Select the [ALTERNATE A AND B] button and turn on the [MULTI] button. After selecting the first drive with the mouse you can just keep feeding in disks and use the key to load the next disk. This menu entry is enabled when a catalogue is open and the number of disks in the section does is not equal to the maximum allowable. Update Update a Disk. This menu entry is enabled when a catalogue is open and there is at least one disk in the disk window associated with the top window. Cut Cut the current disk from the section into the disk paste buffer. The disk is deleted from the section and the information is left in a buffer that can be used to contain the contents of one disk. The user can then change the section and Paste the disk into the section. This is basically a way of moving disks around. If you use Cut on a disk and then use Cut on another disk there will be two disks in the paste buffer and when a Paste is done both disks will be removed from the paste buffer and put into the selected section. This menu entry is enabled when a catalogue is open and there is at least one disk. Paste Paste the last disk that was Cut was used on into the current V5.0b STDCAT User's Guide 11 section. The paste buffer only holds the contents of one disk. Using paste causes the paste buffer to become empty. To empty the paste buffer just create a junk section and use Paste to put the disks into the junk section. The junk section can then be deleted before saving the catalogue. This menu entry is enable when a catalogue is open and there is at least one section and the Paste buffer has the contents of a disk in it. Path Menu Sort Sort the paths in each path window. If automatic sorting of paths has been disabled (in the Field Sort dialog) then this menu entry can be used to sort the paths. If you change disks in Hierarchical or Dependant catalogue view then a sort will not be done on the paths in the path window(s). The program places a check beside this menu entry when automatic sorting is enabled. This menu entry is enabled when a catalogue is open and automatic sorting of paths is disabled in the Field Sort dialog. Next Move the cursor to the next path in the path window associated with the top window. This is useful when in the Hierarchical catalogue view and the top window is displaying files. This menu entry is enabled when a catalogue is open, there is more than one path in the path window, and the cursor is not on the last path in the window. Prev Move the cursor to the previous path in the window associated with the top window. This is useful when in the Hierarchical catalogue view and the top window is displaying paths or files. This menu entry is enabled when a catalogue is open, there is more than one path in the path window, and the cursor is not on the first path in the window. V5.0b STDCAT User's Guide 12 Info Display the Path dialog in read-only mode. This menu entry is enabled when a catalogue is open and there is at least one path in the path window associated with the top window. Comment Display the Path dialog and allow editing. The cursor is placed on the comment field. Permits rapid entry of comments without touching the mouse once [MULTI] has been enabled. This menu entry is enabled when a catalogue is open and there is at least one path in the path window associated with the top window. File Menu Sort Sort the files in each file window. If automatic sorting of files has been disabled (in the Field Sort dialog) then this menu entry can be used to sort the files. If you change folders in Hierarchical or Dependant catalogue view then a sort will not be done on the files in the path window(s). The program places a check beside this menu entry when automatic sorting is enabled. This menu entry is enabled when a catalogue is open and automatic sorting of files is disabled in the Field Sort dialog. Info Display the File dialog in read-only mode. This menu entry is enabled when a catalogue is open and there is at least one file in the file window associated with the top window. Comment Display the File dialog and allow editing. The cursor is placed on the comment field. Permits rapid entry of comments without touching the mouse once [MULTI] has been enabled. V5.0b STDCAT User's Guide 13 This menu entry is enabled when a catalogue is open and there is at least one file in the file window associated with the top window. Find Display the Find dialog. The find dialog is used to search for strings in the catalogue. The user enters the string and selects which objects to search for. The string to be found may contain wild cards (special characters that match one or more characters). '*' Match 0 or more characters. '?' Match a single character. '[characters]' Match any single character with one from the list (eg. [abcd] matches a,b,c or d). '^' Used as the first character in the '[]' list, it changes the list to mean all characters not in the list. Put it last in the list if you want match a '^' character (eg. [^abcd] macthes not a,b,c or d). '-' Used to specify a range of characters in the '[]' list. Put it first in the list to match the '-' character (eg. [a-d] matches a, b, c or d). View Menu Dependant Switch the catalogue view to the dependant mode. In this mode the contents of a window depends on the item selected in the window's parent window. The order of dependants is file->path->disk->section, where -> means 'depends on'. This is similar to the older version of the catalogue program. Hierarchical Switch the catalogue view to the hierarchical mode. In this mode each window is independant. When this mode is entered for V5.0b STDCAT User's Guide 14 the first time all of the windows will display sections. The user descends into lower levels (disk path, file) by double-clicking on an item in a window. Each window may access different pieces of the catalogue at the same time making it possible to compare portions of the catalogue (visually). Remember that, in this view, the menu entries (eg. Info, Name, Comment, etc.) operate on the the sections, disks, paths, and files ones associated with the top window. If, for example, the top window is at the disk level and the user accessed the Section Comment menu entry then the section displayed will be the section that the disks in the top windare are associated with. If, in the same example, the File Comment menu entry is accessed the the file will be the first file in the first path for the disk selected in the top window. Flattened Switch the catalogue view to the flattened mode. In this mode each window is independant and contains only one type of catalogue information. The section window, as usual, displays the sections available. The disk window displays all of the disks (regardless of section) available. The path window displays all of the paths and the file window displays all of the files. Field Order Setup the field ordering options for each window. There is a limited number of field ordering options. Each window has several fixed formats. Field Enable Displays a dialog that controls the display of the fields in each window. Field Sort Displays a dialog that allows the user to control the sorting options available in each window. Field Qualify Displays a dialog that allows the user to qualify the information displayed in the catalogue windows. The user may use the same wild cards used in the Find dialog to setup qualification patterns. V5.0b STDCAT User's Guide 15 Output Menu Layout Control the output format. This is where the user selects the general type (sections, disks, paths, files) of information to output. For the Flattened view the user may select any of the 4 types of information to output. When the [TRUNCATE] button is selected, the output will not exceed the number of columns specified in the 'Sizes' dialog. If the information to be printed exceeds the length specified, it is truncated. No wrapping occurs. When the [TRUCATE] button is selected, the output may contain lines longer than the maximum specified in the 'Sizes' dialog. The information and fields selected for output will be the same as the fields selected for display. If you don't want the section or disk name (for example) when printing out the information for a file or path then disable these fields for the file or path window before generating the output. Don't forget the save/load setup feature of STDCAT. Make good use of setup files, they can make using STDCAT a lot easier. Config Configure the control character sequences sent to the output. The program allows the user to set a separate sequence of characters for the following operations: print init - send this at the start of a print job. print term - send this at the end of a print job. page init - send this at the start of each page. page term - send this at the end of each page. line init - send this at the start of each line. line term - send this at the end of each line. new page - send this to get a new page. new line - send this to get a new line. field sep - field separation string. The program doesn't have any control characters embedded into it. The program uses only these strings to control the motion of the printer. By default, the program provides '\r\n' as the default new line and '\f' as the default new page. The field separation string is used when sending output to a file. If not specified the program pads the fields as it would when displaying the fields in a window. When it is specified, V5.0b STDCAT User's Guide 16 this is the only sequence of characters separating the fields. I might use this feature if I wanted to process some of the catalogue information on a UNIX system. I might be tempted to set the field separator to a ':', or a tab '\t', if it would make it easier to manipulate the file using standard UNIX utilities. If the 'new page' string is left blank, the program will use the 'new line' string to page the output to the page size specified in the Sizes dialog. Sizes Setup the output sizes, indenting, lines, columns, etc. The values set here are used for both file and printer output. The program only does a simple check on widths and lengths and will allow some, less than useful, combinations. If you the footer line count is set to 0 and the 'new page' string is specified, the printer will form-feed an extra page at times. Removing the 'new page' string or setting the footer to something other that 0 will correct the problem. Printer Output to the printer port. All of the information displayed in the catalogue windows will be sent to the printer. To limit the output use the 'Qualify' menu entry. File Output all of the catalogue information displayed into a file. The program prompts for a file using the standard file selector dialog and, if the file is open for writing, outputs the catalogue information to the file. The program will write over an existing file without complaining. In the Flattened view the program will create up to 4 files. Each file has a different extension according to the type of information output. .PRS - section information .PRD - disk information .PRP - path information .PRF - file information In the Dependant view the program will create 1 output file. The extension of the file will be '.PRT'. V5.0b STDCAT User's Guide 17 Misc Menu Read Setup Read a setup file and re-configure the windows, dialogs and output. The program puts the screens and dialogs into the state they were when the setup file was created. Save Setup Save the window, dialog and output configuration into a file. The setup file does not contain any window cursor or catalogue information and, therefore, may be used with all catalogues. The program uses two file extensions '.HI' and '.MED' for setup files (others as well but they are untested) and their use depends on the graphics resolution. This is necessary because there didn't seem to be an easy way to translate the window sizes from one resolution to another resolution. It is possible to read a '.HI' or '.MED' setup file when the program is in the other resolution. The program detects this and reads all of the configuration information except for the window sizes. Default Windows Put all four windows back to the default positions and sizes. It is not possible to get the section and path windows back to the default size using the window sizer. From my experience it's a GEM problem, but, I could be wrong. Auto Newtop When this menu entry is checked the program moves the window that the mouse is over to the top (active) position. This option failed miserably in previous version of STDCAT when run on some newer versions of GEM. The old method of handling this has been replaced with something that should be a little more portable across the many GEM versions (we'll see). Display Formats Configure the format for the date and file names. V5.0b STDCAT User's Guide 18 Small Font When this menu entry is checked the font for the text displayed in the windows is switched to a smaller font. This menu option is not enabled in medium resolution. Catalog Stats Display the current statistics for the catalogue. Catalog Limits Display a few of the size limitations of the program. The [MULTI] Button A number of dialogs in STDCAT have a [MULTI] button. This button causes the dialog to be re-displayed when the is pressed or the [OK] button is selected with the mouse. In most cases the dialog is clear of input and ready for data entry when it is re-displayed. It provides for the rapid entering of information into the catalogue without moving your hands from the keyboard. Please use this mode of operation when loading disks and entering comments (at least). It can make working with STDCAT a lot easier. Output Escape Sequences The printer setup strings may use any of the following character sequences to output non-printable ascii characters and control codes. \f - form feed (\014 = ^L) \r - carriage return (\013 = ^K) \n - newline (\012 = ^J) \b - backspace (\010 = ^H) \t - tab (\007 = ^G) \NNN - a single character in octal (\003 = ^C) ^[A-Z] - control characters (^C = \003) Short Cut Keys All menu functions are available from the keyboard with the exception of displaying the About dialog. Keyboard access to the menu functions is controlled through the selection of a menu to work with and then the selection of a menu item. To select a menu to work with press either the CONTROL or ALT keys and press the first letter of the menu title. For example, if you want to access the Catalog menu press either CONTROL C or ALT-C. This will place a small zero beside the menu title (indicating that this menu is selected). Next press one of the keys V5.0b STDCAT User's Guide 19 from the list below (for the file menu). To select another menu entry from the file menu just press another key from the list below. Catalog ALT-C Section ALT-S Disk ALT-D ------------- ------------- ----------- N - New S - Sort S - Sort O - Open F - Next F - Next R - Read B - Prev B - Prev S - Save I - Info I - Info A - Save As N - Name N - Name C - Close C - Comment C - Comment Q - Quit A - Add A - Add D - Delete U - Update X - Cut P - Paste Path ALT-P File ALT-F View ALT-V ----------- ----------- ----------------- S - Sort S - Sort D - Dependant F - Next I - Info H - Hierarchical B - Prev C - Comment F - Flattened I - Info F - Find O - Field Order C - Comment E - Field Enable S - Field Sort Q - Field Qualify Output ALT-O Misc ALT-M ------------ ------------------- L - Layout R - Read Setup C - Config S - Save Setup S - Sizes W - Default Windows P - Printer A - Auto Newtop F - File D - Display Formats F - Font Size C - Catalog Stats L - Catalog Limits The arrow keys are used for three functions. If an arrow key is pressed the window will scroll in the selected direction by one row or column. If the SHIFT key is used with an arrow key then the window will scroll by one page. If the CONTROL key is used with UP ARROW or DOWN ARROW then the cursor in the top window will move to select the next/previous item. Each window has a number key associated with it; 1 - Section; 2 - Disk; 3 - Path; 4 - File. Pressing one of these numbers will bring the associated window to the top. In addition to these keys the user may use the INSERT key to close a window and the CLR-HOME key to make a window full (and return a window to it's normal size). V5.0b STDCAT User's Guide 20 Usage If you run STDCAT from a shell you can give it two arguments: stdcat.prg [[catalogue-name] [catalogue-setup]] The first argument is the name of a catalogue file. If you specify just a catalogue name (without a preceeding '.', '\', or drive specifier) then the program will look in the directory (folder) specified in the STDCAT environment variable (if it exists) for the catalogue file. If there is no environment variable then the program will look in the current directory. If the first argument has a '.', '\' or drive specifier before the catalogue name then the program ignores the environment variable and looks for the catalogue file exactly as specified. Each time the program reads in a catalogue the program attempts to read the setup for that catalogue at the same time. The program uses the name of the catalogue with the extension '.HI' or '.MED' (depending on the resolution) to access the setup file. To change the name of the setup file accessed the user can add a second parameter to the command line that indicates the name of the setup file. It is possible to have the setup file in a different directory (folder). Environment The program looks in the environment for an STDCAT string. If the path is to a catalogue file then the program will load this catalogue at startup. The setup file will be the catalogue name with the extention HI for hi-resolution and MED for medium resolution. If the catalogue file doesn't exist then the program will display a dialog indicating the error. To setup an environment variable you either must have a program that loads at boot time and allows you to setup environment variables or you must be running a shell that supports setting them. In the shells that I am familiar with there is usually a startup file that will allow you to setup an environment variable using a line like: setenv STDCAT=c:\catalogs\arcdisks.cat Future Enhancements These are some of the things that I would like to change if I decide to produce an update to the program. There is no guarantee that these or any other improvements will be made available. The output format for the Hier and Dep modes needs to be worked out. V5.0b STDCAT User's Guide 21 Add or change the field ordering options. Notes By now everyone with a hard disk should know about the 40 folder bug. If you want to catalogue a partition please make sure you are running one of the programs used to extend this limit well beyond the total number of folders on your hard disk (eg. folderXXX). I routinely use folder500.prg (I know it's overkill) on my hard disk. There is no print or find capability for the Hier view. Bug Reporting Starting with STDCAT V5.0b a new bug history list will be started. Any problems or weirdness that you find is of interest to me. Please let me know by mail or email. If you have access to USENET you can contact me at: bobs@wimsey.bc.ca or ...!uunet!ubc-cs!van-bc!bobs Otherwise you can send land mail to me at: Bob Silliker 13097 107th Ave Surrey, B.C., Canada V3T 2G2 (604) 584-3668 Table Of Contents STDCAT V5.0b Introduction....................................................... 1 Quick Start........................................................ 2 New Features....................................................... 2 Menus.............................................................. 4 Catalog......................................................... 4 New.......................................................... 4 Open......................................................... 4 Read......................................................... 5 Save......................................................... 5 Save As...................................................... 5 Close........................................................ 6 Quit......................................................... 6 Section......................................................... 6 Sort......................................................... 6 Next......................................................... 7 Prev......................................................... 7 Info......................................................... 7 Name......................................................... 7 Comment...................................................... 8 Add.......................................................... 8 Delete....................................................... 8 Disk............................................................ 8 Sort......................................................... 8 Next......................................................... 9 Prev......................................................... 9 - 1 - Info......................................................... 9 Name......................................................... 9 Comment...................................................... 9 Add.......................................................... 10 Update....................................................... 10 Cut.......................................................... 10 Paste........................................................ 10 Path............................................................ 11 Sort......................................................... 11 Next......................................................... 11 Prev......................................................... 11 Info......................................................... 11 Comment...................................................... 12 File............................................................ 12 Sort......................................................... 12 Info......................................................... 12 Comment...................................................... 12 Find......................................................... 13 View............................................................ 13 Dependant.................................................... 13 Hierarchical................................................. 13 Flattened.................................................... 14 Field Order.................................................. 14 Field Enable................................................. 14 Field Sort................................................... 14 Field Qualify................................................ 14 - 2 - Output.......................................................... 14 Layout....................................................... 15 Config....................................................... 15 Sizes........................................................ 16 Printer...................................................... 16 File......................................................... 16 Misc............................................................ 16 Read Setup................................................... 17 Save Setup................................................... 17 Default Windows.............................................. 17 Auto Newtop.................................................. 17 Display Formats.............................................. 17 Small Font................................................... 17 Catalog Stats................................................ 18 Catalog Limits............................................... 18 The [MULTI] Button................................................. 18 Output Escape Sequences............................................ 18 Short Cut Keys..................................................... 18 Usage.............................................................. 19 Environment........................................................ 20 Future Enhancements................................................ 20 Notes.............................................................. 21 Bug Reporting...................................................... 21 - 3 - What worried Ah-Moses though, was that the egyptian gumbies might not believe all this codswallop, and would continue to stuff cats, jackals, hippos, baboons, and nile-crocodiles, and melt down their earrings to make statues of heifers. Ah-Moses quickly dismissed these misgivings from his mind, because, he thought (correctly), that gumbies who believed in green shoots of miraculous recoveries, claims of unprecedented prosperities, remotely controlled immaculate concept`$H?<NNT/$@?<NNT2<<g2<gBQC\|<<f|(HzF?< NA\B?< NA\/?8@AL"H/(a,_1߂@?< NA\G*"K kK^ JgёBJAg<f``+k +k+k  -"- Ҁ+A -Ҁ+A м$@*@t_CQ"KA$HNM@,$$$$ٵoC&i")n"<BBBBSlLBNHaaKa.(I,I&N%aLNurQNua.d&NqNqra$dCv !a"H@@Vҩ%QnNuf%Nurf%AQNuCtaTxr1 Hka1 Ag"CvtaTr1 HaBq jD`rptadpt?aBC@!!Q`N   jY JAM Packer Decrunch V4.0kIce!#Ƚ`D7S2(XOD0K')-?<LNAXr*M *Bm`i 1A){6+N`=5pf0-*N`,Rc0%X =bg.J3"KUlfil5)0)#$o K$ct6`q4- &>B.|zGl&0HX0ݫI̭6 @g:RF`ֺU:5 DH* gi,ֹ r9+I5Ȕl#q B+4˖x,^Bf .4VX$`Dd4Xg:'g&`^`-K)f݄N`#k'3G1 %8SQQXH56b +PgdZ)"ଟ4+P#(P+$4)M4+E j 5 XY<2K!mda`o%(R F"5$QjTJѭLdG@ .f 3!|EZx3ݢ?9/܌LE f=`L#.;"α*?_񗏶} ɘg*HL#-Mf@fCU0s- jU̢03&Y?$,\OHЫK-HZ>o{.w}\3H>>vs \39NX :\E$g,#xx>rc9UEg7fp.*9ຕufDt:v $&-/-9FyH W*3!`ά $`}5&fxzL @*Nh/VdY]9RwB|+dqH( rN ΄ P.: q&Z +,{Z:e 6fx 7-+(*Ʉgo}F /̐ p\nXt-@gBR>Ba r0,#tjP/DR%2l8TYt!0W.l_` *// "'i`;Zgf2o 2! @6YF&-n$  "@zS'QYV$F?<a.YB@&_eΘ53 պqm3n(0(}fi5**a=tkXX,Rw-D(t$U]  ]:KݶՔ*t R$?:dOfYLnc`8f˺'QK <_873 Ƭ3ZY@\yg15.nVm<9;.We:Ѹ?2>%m$tbt g l{B3*Yx4sEqB}Ējq$5 xa RRN]ظe\k k xXDaȪ)hvbf fA>qd͉x6vY2[]q@u296`n%x-0`L-xV87,:ĸ0Zg=uZcV T`5VEgeq3n fl8 zvo򬳭[!>Pl>HL>}LnS'A>3 w$6Ö=4s5` p`p lѤ.Vwf(]Y2?N<?b5 L(ꕖ2T&kfC[PJ\T ue|(tp ok.<bU:KLG"k$ /-7#f8ͬ`B6g\ W`Fp,/  pxxP-x3+ xq2s!*,a[#-+*лiq r27-%(6 a!f tRhf TNF g )$'Bl#x G0dK0oeE *g]' Hb"g2ePƶYf~qh&ogudĽϬ 1$NugNg(]7}f(PR p(ے-Ƭ%֧fFfBoJ.?f\2Qs 3-$`9g&!5o)fdXiox͐~i -MgRG*+0`0L ?  omA<`B@`WGHE*C\(f ` VɎfi7D\L9 ˆqu{c/(|;*L >lA2 luo\Tw3{63kkUQ9ẁGC046 s4\iF4 T/F#8T{m,P3;R5x3e ֞j L%F7~fbOTkeXz8-4hw@=v "`1&UЊb@P fXbVpPB˒-xzr' )BX ׀p`Dpـ#|J0z@m@Qho#g(/'(c6VJy0-(qXXoVaA`?Y}mccc{\Y1-ٸkA `jwH/H`F)mV`"w 0d=# ։ۛ#q[%8bH0@k[p]0bdvۂ0"\fTJ֯3q&8/xZB,PNpGt18red0ftgߎL+FU,bp{P</n rU"Ђl` S̊-P/g/2% h0 g /(aVoBXX&RU$'.KBl9L PBԑpH*(nD ,(-L (4Lug( |0c82<`XHXW? PNГ/R`SO`/ XOHЌ&@/ {?070f KSf`{~k35Z^fZS sgn-V ovb3taxGͅ+7$n2*Cam zn |h-2+m,V`T܍@2>fp=@6]g3(5װf_f`RRi؆0rRBBA<9OFqj'xJ/-\|w xEβsn=fLSP, <P nxxs떸يuKtź%siM& XVPg|N%!kQmbf q^(g &]mWj%³2").mS)H!*%l~ -xg> m0(wbjH0@?9 %`ZX`H`>uF`8;`0Ȱ0>F` Hf,G `/ 8w b6cPՒ+=sԼ?k]ܶmi=l݀`<7Gɝ]]'f:QZ|upCH`]P2?LTO?'!_ћfYp90fs' "2w5.=`NP2g u`lgkP0`SG!]f3,X.s/B? 1:Qnh %2ι :JBh̼tyܬC`f% :g0`97Q0g,,u0fUg佛>0`#?af gU39fH7^9VeΑg[xԪuzqf=xtBgB ()lrKtX[yfU; `,y,fbܴfzp,,˸]lYp WcIެt,; g~p`ׂ\3i2cgg0K)',Z) '<dmV[YfEk&~ycng g7Q6 l  lfdT;B>4EjE4zh0 Dl` e:7Y֖(Mf#88`!k5i+J,Ⱥ Y!+.hX9cHl"f:(@)g+L8u)MN4jRQveM/L׸E 8*r W|8Yk~lBfe VΞ%a4flK~gRFpV88+L$($MGd2(s؀p&64'Bb&f :@tR,j&p`=ƒ mO^,Yl_c4- $ ۀ4ghB1amI8z;B=ͺ m*-MG$g b*m `Jj``hk-h0cTdk)3-!N3a}N_» s (*YA}BP`zBfѺm^US NNpApB1?-I8]2jy4yufгc]HwBs/ BP!KImA;X$fبs{Y2/*re.;Kp* T c( \. +p\{nm-Yf!W$gBp.$i g2f56&qqs` |p mG~,~ev7`B@*_Xo%H EHЮx/*@`-\gQ:gS`Hm~t e&(= &b`C;/pY@ L8;[w@A!{$p:w_2HhpG`\Tom`<Br$ۢZ&RgB|S`w0(f.CBqO@!~as:1C`\8%sP)aF781!@8Z~.,5m[0iT7+R@1p60|,=:c/7DnU6`-rC@xjpIzXRtUeV}Hs 3 Dg6⨙H%kpc<6_:[*FBa_a܁H//őLLZ-uHLp:ԟBĮA4xg&Yd`.Bgٖ^Y!n~ Mg=` \B!;p6X,dm,HnB@xNDCμ,tօM W5p63W,_^am"6r|O˛H"SdrFvUf%SЊux6TS C:sjG6* XK +ח۰p(+zPh\0d0fnXZ `K m qỈzb޸%5I4\dJlAhR"̩Cyދ:teqS&91"sD")l!i^=![pO0 gHf5C0g^V^ (" Bg`9Bo=zNNYJ@g<0vyfa-`p fቹB)499ABAHA婎M gh*! -MX\k4-L(gD ,ްf6/,h /. N!KquXaCi6 -YsF*X~5 +&ؐ?EUc47X\`ҩk=)[5uDg. @g0pyNNTC_H@2V!6g3u-`nmV yh-Y"@p.\5x-fRDU' `$n>vJf.i C7YYp޼M6өA-H?Dcf~%gftm4_N-E20[*xf!.f3} %ʊg4F x $`qdo^b g8|ɸ%:jo=;vS~jF' .Scgg`wK[>$Ӎ:|D%-H@0JpI:F0%RFG;cVXo\NKt B~7LDZ D`,&uw@p ^d,gf`T*pE xkHZ} l0`W 03ӞS6P fOg0RG9?l MSp0O f alp-`R ̿P(ӻ!1d@6d\FԷ̀iGp|F(ƽ0[d,H/q-M]f0T FKRklnn#'0]&l#7%BΕunB`NuTpp{3LGg /.ԁm91A%V r~|z*ߟ -M>@gx ڭ$*m0` ~| nz#6/_f vxJtqn-f/{uFc8g#|pL HDLxβW\~ =5cJf& f3~"\a[-1stW|b 0f=b@N"$<{jpqvdp9 a膜`T Iύ&n>x3tbLVQ ^Q+ðsdqkfx+$P3+ڮZg=I⇘\!(f>.xNGm01乿͸(2`sp ُR`f 9J xZ#JU4!41SQ)gܜV?%Jr$,,mM<70Q-hsX\6@l|L!A\glw,2 ࢢR Tg[L /(mǞ}Z2bԃv$ fgq;`@ ~Dmfa5m a܉+ŶsKXV Xnws3 Y8yva¸- gEP ʸ nֵ˒t'A1#McNuG2KpsَٚӐjP / S3` 3#/x^x=gB.x%^J8zW~zń#Hx1)DZ"g ݙ=oA -HERkeH \,_n>ܔf@o77cH좁S6duƅ7q^ vGl+R5-l8Ǟ(o/Ylnh4$l MpM6`B0 ЮywYf eB(3Bg02&%FfnqsbA-nVSn`hcm@YzmÏp =xOޮ`lUfnDMf }fZp^g-P2A-H ?.lTrWf6ۋBR/ .T UBB! -M} ~g:RF5 Qj$TF5 -MѮc*m0`olK2 'R.DBf^, VeW^گPq⨐lVoP*9Llְo6 g `qj%B(=Bsf!.R2[ۢhp= XOn>3Ŷf0+ rq_fy p -"][/.&ffg4="j@ Vgb2Mm_m:@*tgn ^in9Pf_``p.e8>l 8gʌ"2RR `˰uk0 gp[ 8V.L#I%S@ @8bjH0@IRG PN`brEXENED`:E0E&EM6`clN)fZBU8Nj9%ˑى0HZpwd' rIlލY%oZ&`ښh:;RZō*P Gcc`d>!$x0/@H@/0Lt; #vH6%SC G2ClJ}.*@s'֩YdQ(@Rҋ̎SnF; LS"MS Mbp`L0J>DD\U:f|@?g D*gۇ lp_/XU'=@Y&DT c` ]Ю/ =H U/ ;fgLam zn H R`*_M~kxWOy gR0nN3.<@KblE0vx`(=F3nRl x.u0GB@17ԬGLf8X~H#1b>ݗY!x[o nBgpֻP\Ofv\4p?aD+b^U㪺̑9_qpvԥ8eSwiXc?`͛71M*I ʲ Bx,,̲ Gx؍ ۦ&U`9,D x9L)/!܌ C<=޼1O#n+! \ !Cв<=<2oWS@Mb.|pR`z "`fϞ<!ІxB<cB piҶHwa6[:\7;x&g:&1Rg47.@8/ 2 gt(gXޱKpL(R&k0`+Ga׀caƞq^7 <L8|w:_e&,y֯ 6'x{LofCg@ a4f43"@|k Q2-8dh~՜l9 PN`&ȲTcTc^`-|Ɯ?~Y.V69l-ɛT0!3K/ H Ȼ7#bff&m e yT0yb2~m 9{m ,dgEnL`2/цU* (lbC 0X[7(&,'"g9_Z~l [gR`m -T`+G?QTg ^ `GRVoAɔ @+P tBKpfL gHo hhg> 9C@f5g+m9 :f;Uql/6[D=aՄHs*U x[ YGX ‼X (@ M&@b -STKYbёBfHC\-dgz0i,xǁo|-L)p2FB xFj9FЍ BAKbGdى H<ƌ8p{#s67f4Kldddst.`vfV`dgi^7B@|W0=ouC&t;l9^ cxJ^d4b ژaDf9Hg`65uY`$f:fڦU6ҺgQ2 utPSxRSDyKAfvo=S'$Zsֲ"@Q pr[!KB?f6YUͺ̇4g2Έ2ʱf&:t Po]HJe9P\0(sb^H09NVD`2[*` eBgy'IQ-nA! @ѬKP hCp `XfigX<`, s@0YH0P ` ddm`H`U,g{C$`:*,E𸈂lgfX 8xD" @I!i` l+·f3F"Bs`~ *T)8@YVd /(!(ULVd gJ* g/]f'~˃f+ O*mb-M=`*f /,f_&JyLB( `h/R-h[rHL +7"Lӈ1g sj|fmnܳі质ō0 34h<&p/uTRMགྷ xpNt p#aܒl fިm3`jm1fcp4lVb xIL=Nm6_V[fnA&d"X6A{.l8`pgX7:/ d-xx4j JYnX\"Ԕ0N =dPIcSؚ2pVcSr3hGΆm3f xCcf.=QZ֘xr'ܘ5\@S2m^`&uqms5V\=Z& @X@\#QS9,f[ ~p&WFL[ 3mn[6(f4Ϻ.V8cG޹c]`v:# ?*,,t 6f'f2-[3:'Z7RkUn0bfOއX:e^h}Hm֞ږJsJx2 X"Wƙ0*sI41x͉n]VZs#tghBƲqF3@2xc˲:tcZ~'Hnܕ d&P`Rxr`6%`xgok\p0򌢢s*_I.Qf^BmIIYTg$bg30f9tUg YKHg7*XDu2KP*Tx -L`g:Ru%YF5 Qj$TF5 ,Ѯ(l0`2_^El/2WcZ)΍K-Ca^lj,:Kq\*tvU/u{wԃԀ]Nx4p M+/-4vb nL'f9UZpG+jf+Hfa FK:W)e"Hg,UefMf h-hY/`B +/@(8g.f΁Š ,a} ܊PM8WJQi EbeGi:ʝKi+eź&#bJM0[Lܢ@fؕԓ(qAR~ Vx+F<ac N` Hg:=Rf*bC`U|7EE5hs&F `r;\2#Ƚ`?`T2-R< v9F`5sgНD$?p>`r"/i`xg`pgf`"O~V``T `L^(`Dd/: ` ~p#y*YD2B n R/l0hk6Rn` o07s%,&>w2>0,8#!3i ,hnYŶ$ Lf\yՁ@s  pB"߾p"pP{ϜeXc69 dFcv"r w~l SV :rÙsWLn36aװ' 5)TBg{ܭOpRBEb 윅Um v{`͠4͢/hp:@@8%:H 3 ~&Bf!zsl#$53Rܖ=`nMxU`2X-7gϺt9h*=3 S](vOux RY ^S\0{ؓRWRДT@ZڪA16pa:n3H- p6NJgXX?Pk3>nIk4p9#"y o Ju칉c3h0/@ Q5 w5Jچpf&x=$~@mB&&x1w2+.MݐϖHH [#"MS0/K̰8&Ŭ<|afpf?źq&<a p=N*@ g4Eg uf -g_XUTfg2 n; *_AD 'xb|MEh ֩S -Gw(- rfO7HB@0A 7j5s ~]3gpL`pN`pMY&s3@1/~#{l?WRG`. UMTO-@ $ ,:geZ0gT #g8Zg2-fiXO`hj X q(NuHnp `B?<cքhy>O$ܧ`xϓpxxxxdجZ aQq!zq!zmu xjڢ唚{CI8<8<<u(x>cS@vwb2,s2!͸394jxZ 5 "3o u f2+-mpVlʲ8f#H\T;xTOp Y0{"Mcb8[4޺5,#*3"RH=62#-| q`B(g 3anoRiQOЩy(s -@[9>gq"]' -hdl%6pPB X/nCN|=`ֱ"|#Hh??x@+a Tɰf0?28ҁSAAi0-DFx%SXjRmᇂ`XOl4H F2q2j(枚 l00TqQ۰ֆBqN`N.4|40:ڥYـA͹Ў^,/ (3 𸠻n֯Y~$x xb!WڴRp՚K"j.Un r|"+mc "ȯ:gގ,`r9/ك, elwk騞dҞd\.sqr 'zc\kqr/',%<O,9g(NNw\;(m,sLfpr`x)ͯhdc*V,K}xǢ2м x-< p]ů`n`g5xm^t5pXV{Yr2c{ xXLk`+BFC  ~A!B+>/ԬTYzeN@ lľ2A-`HnKo&' ؀6kHzg~]w&@z}Gl.0S*mH ?} PN4 Њ@4NvPU$@pgX!uB' / Db]3k?@X(77llUU0`\JPkD`,tSTxAp@f:-`o /J5fjfܢg*DnH05ЁAie=m0ѵ6kfBWS F> `꺘 um^b lj6*3u/VV/qHї Re4ܐԪ 3<'3`t 3T21s OיV  bw8:MM4<9E5Jf 93D^d_h hxoN70(/gDpPΎ2=hm@=U B=:-9p 3,-2^ 2Tȸ +Um_ Nc!e 7:: 0T0,l$!GmpfY8 Ln.[8n a&f`/ Hl_fB@u^eBg3"`XO>y%@ :%$hox VVWRUkuLLGS/ LK, QQQ}l8e0).m ;YJ.+M %`RTj-vBA-HB ^|X&^x+c%$2xgWI$D l `&HEigmp],f-ssLZ1ͨf_p'f&Y[uV:`P/k{ˎaln Y#.}>/GA'2A4\K*Y2JXX(h` SkAop C-n+( " TfR`wg  ga9Eg(R}5B37ӲeREY 5H#R(^m,"6*P:*Pd=T; ]B«jBg2l \2Ay/h?R,`,eٴDxB Q7em Ў2&Hmseg}o(g $ ^a|T5WNx (fbT7g)`RbZ`>_`*ޥZ`09Jfamy-\;G` b#H0@^ PN@ +x `=n0ؔR0Giئ*NVr``]y`B-- mVY"TЩ`v+̬nSݓ/-:!e&77gt m˫lii=l9o2)ӹ"{!x43lu&{{j79o#^%^Ir4uHG ?u B Pqx-M7 g4{s hf4$X\YR|"%ñ{o g"TmfdwoBn) bX-}Y W$0vm2!ƨA@g[g(0Xgl:m2,"SAMD9 o(dmKY =ua92#pkCl:m \Zx^?DhXOV;ؒ,;ЪA(/ K b*ov'9H@0k)P`aT֩2vKYp 3<lB1kpx:\ qx1*5,Qj.T 0"N2$p(4Qy*(6pն2,e0W48.8<j[@ʢl5+4x@p6-{c{&(p3y2  XpZq&bV pMY5w?2.,f?2.,fA1)niATpNsp!<$T&p/G.`v f)\ *-u,ng47y jnOHo3j0Qj:7m0l$  86?ܞ>?-?,`XO<89F0G70F9@GoF ~pL]@L04T@Ir9lxpX61V + pfc[g0j phAxbdfhi2`sӄ) xq0FqQDl5 YZ"pi{[pkq-%DT^o:xXSͰ:l:` "/fY%pG >emRQǍ~ " < sNBƲ#1rZ4pd11< [371BlZzdI#p1LxJ;<Y6. Ӏ#@XO=pmr$#(* 3%Zj+0#*eX.MxXpjp߀#RI(Ƚlȹ-3 Wp p3N _63 >1l"n"p021r9 #&#mm:z;vDB2Ai AC`]XD@?̋juUEnhU@ n 5`#-fz`+fR#m X`dJKЍ,/`*mf #XRege `X/$vvSͲ +S|pX %B| x5dY @Jf4~0GV%JgRG0@%C`=p3kMz`8qF5HYHi ̉f3 O$X"XHSΤ0-L.?@wSynD8dټ "UfS@K" oh߀2/~gSAJ ~QkqQ(00? U2gL^ D:S]vY2"L'e6E:(Z~WbxG(f0GWpK [ b0&/ i- lU]G`ug$X$VR X g,WܷC0txrᬰYWYD]YG< Z.gؚe@&H@r@o^Kq-o$"xiѥRHvSbx2>nd.nG U(1;fC*gO>X`B7xuNZZ]H ̢g0 $&J7[,}PQf5.Wo x4Gf$;toKa=`8@=+|-T=+ *pr2krVpw@c,"fRqd sXbf$B* 2l@3QgC4[-1xm Fe?g0@T?\P3mk[ bgpLpО`-M SfpcL*@f 1,5`|0gqW Ƃw2c6 -:MG+ `D93w Ufaf&Rnοj+g.ݰAf|`BI27f,@?<ށB]2/fE.f5`j T2Lo3]f< XW``&"-s+|80fe ,=г+#.͊B#eK \e28UH@9ɺ_W,0gxYN;2KHnY M{de g/[Q)fYdޑ-h9N1T;~i-;o>D\ x /jdD 7dZ)xS`B'R1+HK>" gP]g t0\ f{txa \OrgVX׏ 3,fg.Y`(x0Ko0S<3l" # XA0S@; 7G<Nn/gZ|QfNq0@Hn؛ 4lMMCdk06Țlϔ DfB̚`^b7O G BhTZp 06ys^ Bg.p<˭"pET,Blԧ(`" u=3{Pr:fmpF|uw` m ͏ns5|!33vWV=8>!x}5HTOc7Clz: S9l^pQ H0dXmnupMhp8k@E>nH *@0Gpgx4S?V>r6Z1XK. -l< PC0f 9`$R @~=pH\O,A&Ї#8URƹQ)ؗ4z9A#"9'& h&p ,/ّH?p@ AM B_/ܿ6 PO*ygOGg fp`&R`Xsӱn?h;1TO`~C`~A`~P`pۗ@V/аlr3/0 |\k JhN"E zC3xa,rKgJ:C``0$:ApJfp3∲cd⒒d҂dN$!jD|$@A`" jDC$u o"`"/A _$"@0HAHBЁH@B@ЉN}h! (Mfc%H0HAf `BL0N^NuB udAV/V2S_X)dcy@#j+b,l*  PVYA!VXfE$*$m$V 'Xc(U(P,8,,1-V-z--N}1+1ř2-3V4J5$55'5V6Xc67b8V?ՉB[v8\*99BYF FFm#fJuWcJAJ6#JY(OOzOZ&6DD$[XUc#MmYSs$jHam|yemfd& "HʀTY)Cl,INT2Е‚V勡ENb(! B`dňV֫jXt~PX(F,XF`XJḍtt('hhrZZD d!rl!l|.(R/$p/3Ip,_E2 x:|6A3DyG<d`H8 KUNK2sŸMMFPg'Pqbv{4b1Z+h ,βP>Vd`5*V$XPȺ,-/КxP͒diPzTOϮ,,bkǒʬQ~lRAXE֎+27ιv.de6PMήZ٘hk qZΆr6ʚQZάr6U[%ܮPΥ]T 0C6,HƜ)r٘ς$s*)϶y@*BJ>!n`,&ը, (y€"@P*Jd!%!$&'"#v,zE02-/13-:dh@ 6  cut_d+n6< e<(|Ppsn-zsBpN NAM`BROREXm3laM|vna͸T[niq[q|8bchr FX%0܁UutUPDAr A (4MDd%cZ.%*c'DiIt'jiէU_k2|newѭhmxnt_D\yӡgxA] 3 [%dPNRdaµZHfoo!S <PRINR SIZגYn }ag, lQ|rmgQx\KE2dvalues|_9uYWd.XY^BabEDETE|LCAfeesuredo__dele()Misl pow}'+lVV9v%:e롅R^N5;F!,@m vhlu2kDd,G6rB FIRD:^˯I QfmPgŦ  0dC~Ai'>XۂԆy.J0VH M 2o!)nOŶ! sfͮV C!\>@ΐXhϜ߾C !3g2VdDU(Z8h : CD{ȶP,l-u& v,lHQUFHDYOU HdMO-DllSYoɶ D,9qrpSAVsHfP Hh SO_TNEW7um-MA3jV4.Xupmu;Wn33rtvT|Open *d|'SaV$aFa, k[fۢ|spaceISo<%sk4iwk|B0$ҁwv,IflMWexts!u ITlWةŬat3?݄8YES]MUs\d12s6%.3sH &#JOZ`氦xxA';FD: fAfkHOLD7NEW DISNAME:?nru: )I VjCA|D=VE~^숰RRECSIASMB:ItycorŽc-rin|driv c' ?NCXTUE|NCEL*.Up[2Th & 'A'|already exMt *fil̀d|can't be useds a disk name.j a%c:ThA]%[EP'%*ldۣ.s\%24l4vg8sL'k}bcZކFFz$* @MNQR<VWrU-_e!#&U1V,7:hJYZ|D13458;=?$BEGHV5.0٫օ,:bm$^B%.Hn]3k`W5 n$FX[%mʎ%Y) R`0Zi\Ѹzfpin뗱U6 8 hJDEZ[GUH9QBj\̦Z&TZ7_%[Һ)lVeny3ju؁Ԓ[͞"2^.F'<&;" 9 8+C=GfC1/BqoubU:xh 5` )7 qka^rɌ.SY<,)SفVlW<̳e,,%uxZ׌صuf5.(U)5 Z& ࠪkփXc&7EzX׀MN5[GmF 0 u1-@E* 4ʀLQ=DG=su3!MhX&XF7i;6*xmJL+˯5hLX x WUόf{fC xK\Y<;,\BY7lƱ3q*(.wM/qQ4;{:gxb?(.sGQL<:xV`x3.REwW(|\edĻY7iwq.sve{"^.4`v"t()bۊYT$W\!I x "e#e$e%e&e'e(ez̭m\]+z*4,)35^jP,2+X .U*l,3:b-9.,sׁʤ/%[09@Ҁ1e23lSiLm]> 25,E<WR.b^2b6FEIMB,"6emĸLlpke\T5X ʸ..Ve2v=**f6 RM8,$Hvd\`]d /?06Œo["aޠt5 ʸ}.CܪlPEu1jqQ]:U uQ]e\TbnU6띺Pn`(-6C@6@AfNUl#,cv X؍YD4ܩA'¼ ZPRfx72-AǜmTP i2-)1TqWT7'ňwv`vϡUReղDm9z%phc堂B+& U W h f†3P– 4+>Z9l%X/).sPdfUHs<4 9۔U Y_vmր e0YDY +1+U[f p#rmcuK*f ,B^Z2Wxi*lժ,sWFK^Z2xi* K`WKI{b,Wj 9Ջl9ۋl8fpkl9l)3]MIKc .^d!e= XV "Df0#.-^x$98 %?&wi FB'Q^x(9X )_*w iB+tx!,]z .^x<.yx/x0]@1.s2%0 34w@5.s6%0*7aїC8^U9Y>Z:m"S3R;eN -xv =X >$0L? x1@2xe1ۄAK`MBL$x1C2/x1<6%[KE&F@łGw9 GbHR^,xIY/JKfc D%0nTL=&,xmBM2uxN2xi*OK`VPxav)UQ9KURY/VSeʼ\pKx#[Usψ2^j[V^fW^BXPYdx0Z2x! *TK`PY fI~m7:]7V^e *`_7SR`eJ.pa\x*baj\c}^>duJe,tNHf1 UX[e%X>k n#C&"BӇXЀ}܀,^$bp=Ƀ5xy߼ Z +xK`I^ $^, \G!^ Hݓ d@4` . x %5 އ )/Fpf2Ȭ::d*'P@> zp`H[xn8^Y hfppWl|xv؀x~s`xc_TxA1,.Ke7F.{ۋxA^P$x :xzxD>y0^Ѐ/vA,9F x x>x@XB"lIGUR!ρӢYY//Dj;KS.O9M *NL4 GSa 'ݕ 7F>րl|x9i&%y0kRsEx0*OG-S2C ^<ӗO[k0+*af\2PlacCiskvpH\w6hRmouBH83)hgthpdrive AtternRAsele60f]A JA>BEˉcwL toload in a partion.-IVj= 30rf>B-ޘ^KK/cn xpyt x,Zn0;U:S5GGX7miEG^HEAJrOR3s WID]`FDGHl0RVw6 9X VU!ir #L%Ӎ/w0DSkH큷azeCHdk-th;.ViOpPMiscfƒbX3cTDd V5.0b81B2^3P4W5mskbccsy 6M-VOQ`UĹ+bA]˸losVpi ..^0i%PNax>ŁAdg8UpUU:asC x&ev*>N. Izo9mm:D(!prdapHvrarchicş-t;nebYKOrd]#EnabdѐSbe>eQuifyLfo2F81)figizen8DN.>Y i r:H\J#h#c4 20^ `49".KY V$Jt7h -5X2% rFe4&&* 2R" /<2cJ :0,EBB.0 JD& C׀GݭI&Ncͦ'F@?$ZApaEq pi" 0t(g+C"8@zE @L a m0i,P ]V\(R 84 6*_fq46: ,~ uV`q"'* ~: ]SxKй xFP9|r`Y)܁,ø/(CÌ9QRzeh $3 #;@ `HPZ 5 0LVT<-ah"  V `ܶbEV@Ȁe6,KYM8J, k&D(6H˘IH5 JdA#Xn"$ / `L, % F.J3m"6cSռl\n$(2D"we(Jg( N¯"CX "4&b "&&$,:X~Uf.(?:n+9]z< "f!Ӱq6dȲ[YzfQ]L&qĄM$$ 4T*&`.F^J ,fyr4t:&~vR.&h$nPZwVy S5AeqPKE>w*ɋ.p6R:(B(8 D . (L,:b-h]x@l iZ N(ZG2+PP]Ÿ/lU"JB!0dD( cVGK 9FYQt *[*" (HXZke"0ybF$P+) p.<J$jt$P ̴e%HBUR,G ZA fЩq2ϒť u7X$!WVpnM@DRNiNY67`#c3 `Af5U-p07DxX 3q7u[é J-ǺY*xr/32J} &6T > .y~ f Ru.2"(H` 1,@uAf2ATrX{\e4֟\NjZ@m4/.5+ < z&"%2E"ډ "Iur("2* (:"$z*LLt( h$V:(HB@ j**& [ CɄ$ $1/^cQ,!"0$@ P&o,"zd<.(>^` jXRZJ\ tP*Rp*$B4 *2 0 ZA  3,( vr. .d2"$NCL)Eh ? ɍut*LA7%7#7@GDN*s<8jPE<|hL 7R  8 `G` w@5{4h P+0tzF @J~  $8>"RF4F0",x/s.6*" x ".$jt:BX<ܿ<H8+*0462p* 6]& ,$ &(2> 0?p7ݲ4]|<<f|(Hz(?< NA\B?< NA\/?8@K.,M/-a8,_1߂@?< NA\G "K kK^ JgёBJAg<f``+k +k+k  -"- Ҁ+A -Ҁ+A м$@*@t_CQ"KA$HNM@,$$$$ٵoC&i")n"<BBBBSlLBNH$Itxr:<9TDZb63@RCKs c,03s@c 7 3 11TBX03s@b7 01@3 1TBQ03s7 3 11TBXGfL+Nu zjC.prtQQ6t[2AXd zFCpr1HQRAQNu z "z$zr4<x0<9024TBTDQ z&z"z$z4<tx0<82X6244XDTBQ6BRNua`XNuA"ҭgRҼ>0<ӘQ A0<BQa ad zt"zx&zd/ (N0<< Q|%><(zV6<[NqNq@o0)Q|%dT@01Gm2G8+kR20ERRJe20fH|lL`Sj8*ZgYRR811@Gd1@4131 Gd1 320fH|m-t)4Bj%TFkg, `&% |,`g]FDF-%-QFDF*D? zb0JA @2 Q z4`//?/wwws333331t B**jY JAM Packer Decrunch V4.0kLZH!j?0poR( R)=}r 'd{-YE~>t`K^$}Cы+Knh \D\%1iPa#޿Drַ7 N{L S*hK ^-k3UrgDWϸl/L2o2+#(2yrKPRh+*,\9qX~x ] Xy~Vs3_,VD&+\OUKyhD}Y(X=vKר^ ]CXeiu1UAaV䇹{\YmltZ~Z8D u]Bkq|OOW@G',~il,k<@xp֤Mjkc 1=$ ȩB{WT}y|=ްyp7X`CQūQt,--W7z\ B/#>v>f1J;?7k{A4ڼ98=,R~F3NԷ#dw5g.U[rX&wR B^_ \VļB;IUzaG:kLI_, VD6NOTѯ-}{ gts RSW6aj˧F:DNQIp9zcf,رGq#7){ё480%vྫྷ?aDlAu8CWc!䂵]7s`mhQ0á\d<=J?p}3?JqBב0]B_8,.1k_}: ^[x1 GiA =f=|Y0{n4uƲa# Ed,BRN1FHS}s-Cx )ZA\ t;rJU|F^!~":€Fj# 8F~{#px%if4xs;ٚ;՟S7lr=06Й>4ٻ|ceDWUl)6,*t*߸ʐc1Z3 Nȯ}.<w= aBnaicQ u tH>̡,+[b3f8YτԺ dCY=hPg(B_"><ك*& [}"sx7nCeޛ6"r}'n$'d-(\yUww/KL#p}A"/zâ{/Cn9d^A&zK]]NetxF!6h}~=I0yL^g%*m@.As@12qTL,F4AzK~a^̩tȲ\}̛xbfZD)VHGk#d7;܂}mjaҪ8>?ß`Vl>1OW')I#QO}*~/?Y| !l$OR'.'W'\:%eId/@ /Rd7 hGOr{`&OORIO.8"ĢBiH >`&xWEVED9K|Ίɛdox7uk~Eۣ˒Mm^@GMQp > G1~=u()vw8t?-BӮʮ]9>j_| ɿz|  8tb dmVmrp ճ?l-"Q輾bqo݊ΟI Պ>b+A n'^~9h6Խ нoD!{#^#Xs#T{ZwWE+k?J~ {tj) Q,hR|L(= '`b 6m|8Pښ@ Zl`kj3(͂7l58_iP74z+' [_@4 >I@F`~'4nW}Oz(*X`yJh=еFFoia_ =%_\+j쩮AzOzU 9)8(鸞k שT9\+żn^*Bm^uz㻸a ʚ+[Թn P8$[DdmIH1 I`=y̝}^NP]uЂ @ !g(?#hXx z,J)*ojn]ԯ7epJKr{yև=e!Z?Uqj6N\X6hҥ]m0 _R:\dhO2Fmًg;omɊ9[zk:~]6s3i#1Xn#.3y︣yH <+4vqao@D$RW@{\9~{ځ1%}r>l .ct0)Q/We5wǐ$eWOSY??zh͞+Nw1_Yhu8ٿ?{yPi\p'lԵP|__ N7FW#u}^9zz`OBU#Rx{H/vTTYov$hg<>S&uNU͓]vbCСڳr+ơwO>fTSPubD1“OI$s&- Ze'iNzuj4h#Č~p(Ә.=S)}aMg,*^a<yRʱC/u+J(C;vO&Lo+=S~!Sus$nA ~UhqX5o0WﺍF| MB1#zW0w9)[M͒vdk[Ƈ*@m. C+7mʕM 'u@/ħ=]O<,X)6F\p)7S0w_&hfY :O-nzef> fzrQPeO=K=-ud UHV%O7 z+x{gJn2b2'b3 [ҹ1,_[-1zbC S: |/'*Zˈ(Rv-8P?`_\ =2GOe#L`(Кq!Yis7IpzWbAJ>T땾;?"{<^4yd&#LR/ru9qSIòVM|iʫfRAU}z}2 yNǭfy>bVjǘU3&`Eٲpw&hL qmYH0  0Lܢ4J Ưn/,nOM'z-ƢoUmmߪ{ur\`eˁ9PfB5Sw3Qi?~_G| Gܤvx4P8aJ']=Q>~h)a7 k{Zb2uҐEo+GN[7o:ܪc/|:}]Š,ב<QS28_'ސVT,Bx&G_M#?Z'm9O\ bC;'=[fCZ/s*O`晽$6G:[9MCa4^g9πgp~e!^)s!\5~]o8mD2،1wݬ;a%_)[6 G=&|1[M(> 9 ~4T_wa2Ug-YL #ZO̘\o%:zg$l3w}=>Q,O+:?Qcn'ϖe@e&9 MjɲU۳_d~ehY.5n^UbzuRVfTeKUY:g@8K .L:{=p¹1|2XiEH _.Uw}B!ٯxvMK ZGǷ:8Ň!*$>67] ٧43ߦ2֫|`;oI"C2j箄朓bO}WH[[X" )y6xi'uF*0hIg虸 q )[&o[q7"?~pz`ψJ\WŞ_&I@1xE#8sω8 E;1Q}_p햘'#j(!&01yz~R]+JO*VV+tIтފǮ210;k%3qݷ^p&s>A}V$w rcެ8,7e-ۃRlhS005cyT30^@x 뛽A6ly,򟿰yßĭ4KJsq|l?_u{[;#V}̵ax]HA7~3*ƃ^b ^՝Zy^we.4#1F:E8G\ijJjs =4jY[v~jǮJCvTqO?}]t'CFـwwv|_D~A'PzuO$qi;5&.{44*)Po$M3p˲dV6 Eヤ_w\w_iׅm ][zuAb k%$>D^p$R:*"ʐB!3~vÌ-|WQ #R`&&Np.ch0Kn}ๅ~:pE5;x=\XtY_M&xEO^/8 2ZjR*Yf|Z-`_뀁u}2vA[ʼnǁq41$/SCg\yNʗr(݄6PK| e6!s FcP6:7dA<7*)B{xQ,W}oz+6wɛ^+ qu0΋gRvNz_t=~c;Uf )i.ńc8z0{흎JGVږnOʤp:#Ht,Ct2MHgI0Aґ.^&N<<^t˛vrUk8n|.!}.02m?*83j-Dq{d~vwq +[f gi6㧃VblGt Yo=h [KRL`}cMWn=f>~jz*azg;i 'xf):]+:#e EwAs;DKd9q[ xd=7;:=k$ E1w`Ow$sH0 aA;<+|N* |\: (p@sx}3jQmTQM=|3Npz)$ d>/{=9)>Øcl\M2B;pv}I:=v{;!Oא[{}b\/;dv;9K9f;}pm1NLJf{RHuo(9B*z%{/ F)~+Ksp8QE@`eg(!h{-3 p~> Jjed ?oAS(gL =Yװm*h/E7hw߇CFO kzaˎQ\v!:L-a& lɫݝB/ps}G=Q%#i#_D i׺GxT3p>W >J/y=[p/B%T@8A^q&j$-ݯD$q} Jâ;7X/i@fTus̫#F|X6C8[n۫UeE"aU2֓8m,tbڡ퍃Խ~攝kˎ>Ȣ~>_wzss7LrJĢށb|O/EY2a H^W8(oPcV8kX ]}Wc(9uHM)ۗ@v^Tj=8)DHM%>.^ɄPTJ/Q29{G-!:e:¬Tm5eh y/G40Qs<mPdf>OԲ}E8r A7lzo鉅*B߉йF0;4dyTbP~{8g<ۀ*uҥS#E;MԖ5fˍoA,xkSmH>`'v^ɲ! 0K(˄A!ȫ5 XTm:g++ŃƋ'P9||Rfϻ\0 vh٣3vCFի:{&x]?m߻h/dؿm/ߡC7Nww/-sf(ZFGo봸C 'QSj$@:{p_2idt7 V[:4[#'mȽHv!.#JUghqK/R8jOp .K+cH>;( 6* u) Qq$f'sǕg-P_Au%w -MҌA0.Rф5aN6" `ֹVYBڅSo2?mll鲐X] /S,*K_;?HjE{stm&)O7d:5ZLSs,=wӎiDcWxbavGG<$%=.'=Gh(MV锍ΆꯌUS-DC48n?Olx}}:]FϯzՎ|=x!b68u]CS2Pt +sҙA@VӘjLD~?:$Cړ}np|KQ s5o1!n$98ƌP3z^Zʠk1J1 4 s<30PTfod+m$φ'>Is[}$F>3zӳȇ(֔diK,F`lm yݦ&A9+_%Xt<})ðˍަH+6& zdѸWI>,A]BA.0h#/H3MsCvxByw(nFb.։ DF؟8ڙyvKaaBV]Lhz5|xN26zuxxQ_XCmî$LOn2P:}azq&нuR=ma2 [o@i"~jec nnwװSx9O^[RBXg+zjҀ?+}݉Hqfd7ڈQc$yٽ.-!._X>ٷ=crL5fl Ux+;1蕵Ӑ+q;|iXHVvc2C-z 67f%mwRֳ=VŬ1s慉[ߖAWp0k]n|aǟq訂7zsH=+1͏0#ti"W+& !}'D;]]3Nw5q ZQ]DqWda nƹDmb]}FtFQ` d[&k_ P8m1ֻG<`;$!O>@6OPM09)}AC>ۧNzz&g~:R5I^aoVvH7h[PƁW86NR:)PKi;9_pAaohHQ'SPy{」@/^ko^~ltˆ^0:qwpmWV5H\5~=;R?T[ %~R'?XփF xxX4k%tuà̡Qǝ7g&T,"ؾ\H!Hg- |;\|27ZHO 'aLAv%&~ *aR<8zvWPRX2꟝UaُJbsn>./`eCRom0\W"o"dO:*0&iaglr~3Ĕ c$άwΜi{at%`Yq>{C{n-Ckܮ0\z$6VdV:bji4THVؔ1tr~%SCSyĬL\ IƏ*0 4>b_Oe'LTjCpzVLD)Ą+ʢ0KR[\!h27#)?Z^HJ'QP &.^2.vS dغyHhc{ !} f˳A17y΍('3OrlhMX& !'$hg?O: $J\ w6b5\=W {vR 7@ |vEek~ H ʎi{A SmOKy:FtQ[KY6{ȁ}$B:.7*ͦII8!b#Vg=wP_p!DCO(?\%,3v r-Ǣi)+QqkGwasSjsD @8~ HW&-}gg0os0 ԌCͭz F7puLhZe!IǨO;5x{·=[.?_CNCd~kGDY Qn~[7վr '\;h<{T8 og4"5A4ׯZ/4@ Aȕa;F`,@ڊz 6TA,JQ.`@ & ۦuϞ3kPZ@Ѳ?2Z$-sj4QLR4kujpuoI^60/nkp Sd Y P0 jq_)>Q*P!,a: mJ6> &~SJoze Hrي,_b1t&@eBU+5y_2ҭwD7j1`uK16*+ l4Mng*@Yݳf,Ae4hzUsJԠ 2mM=e 2ȹD eno!gm,P 0:;+q H(TԀn0Ѐn2Ln K5 }\*ڀEP"D${2L A1;u(J,U.itnT7 !OBLۆIuJ@N*~!߈b p@6` ͕b_t6@x 0 @ 6uo%Ed6)\ d za(s ^ |ѥ-9AKm /Ezo7@O07@*4+K7"h})s.9,n0aNn>