4IBM mJ]p 3м|x67VS+| &=t&G+|rg|&|||?|7| &| |H7|?|r }u  } tn}a2^D}36 |<|7|=|7|@|*;|@PNXr(<|v 7|& |ي.|}=|p t"36|ˆ;|36|*|9|ô9| 6;|ʆ}6*| Non-System disk or disk error Replace and strike any key when ready Disk Boot failure IBMBIO COMIBMDOS COMO`  @`! #@%`')+-/1 3@5`79;?A OGIKMQ S@U`WY[]_a ce`gq s@u`w{} @` O @ ` @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` @`!Aa   !Aa!!#A%a')+-/1!3A5a79;=A!CAEaGIKMOSUaWY[]_a!cAeagikmoq!sAuawy{}!AaAa!Aa!Aa!Aaǁɡ!Aaׁ١!Aa!Ao B b  !"!B!b!!!!!"!""#B"%b"'")"+"-"/#1"#3B#5b#7#9#;#=?$A"$CB$Eb$G$I$K$$O%Q"%O%Ub%WY%[]%_a"&O&kO`  @`! #@%`')+-/1 3@5`79;?A OGIKMQ S@U`WY[]_a ce`gq s@u`w{} @` O @ ` @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` @`!Aa   !Aa!!#A%a')+-/1!3A5a79;=A!CAEaGIKMOSUaWY[]_a!cAeagikmoq!sAuawy{}!AaAa!Aa!Aa!Aaǁɡ!Aaׁ١!Aa!Ao B b  !"!B!b!!!!!"!""#B"%b"'")"+"-"/#1"#3B#5b#7#9#;#=?$A"$CB$Eb$G$I$K$$O%Q"%O%Ub%WY%[]%_a"&O&kDATAHAN  `FIRSTBAS  `EST_SHEET  `xSTWMAN V>STWRITERPRG zHPERS_DBS  `QCONFIG TOS >9QUIKREF TXT M;STWCODESTXT SlSTWELENGRSC XRCONFIG TXT \G HELP TXT ` TEMPLATETXT cXYZZX DAT "`eDESKTOP INF !hCOMPUTERMMG !j.  `.. DHANDLERPRG ^DEFAULT PRT ^=README DOC ^>xSAMPLE DB ^C,`BT` Efv*oM( m HPHUBg?<JNA(m)m -:gS)@ -OK1PC#HNFHx?<HNA@)@l/?<HNA)@h&@)@XЬl)@d)@`ARCpr Ѝ"QHNFALNjHz2?< NA\pdAxr0XQ)K\NN,,VN ,`NuJrBjNuHz?<&NN\CAp$L Qp NBlJpNNpMN9@pdAr 0Q0tr N9lN&Nupealp`NuaNJHz?<&NNBWNANC2A@p222NrҌ0<NB0,rNurA9Ar`v C9Cr`rt9@9A9BNrrҌpsNB0,Nu9@N`rDҌpsNBNuC2 @ e @}bA@p222Nr,Ҍ0<NBNu &8*:EENuHn 2$4BBNuAd RdQRB BbABJk 0NuJBjBBXNu 0Nu 2$NuE`B<gJEgEjCDEDF Fe( F dF8BCHC` F0bFHC8v` HD8HDkDуdQRBNuDdBDA@kgAр[SBk0NuJlJBk&Nu0g H@rB JkЀ[` BbNuJBj prtNuHPAJgPpr$< _Nup _NtNu&8*JEgJBgJjBEB:HC҅H@:|ۆ҄ۆ<HC>H@ЃdHA@B@H@хk HAҁHAрSB BbNuNpNNuCDEJEgJBgJjBEBQ*HE?<>0rHGGdHGGdSWDуdi\?<>0rHGGdHGGdSWDуdiN?<>0rHGGdHGGdSW2 H@N?<,>CEdGH@0r`?<`JBgVB&8TTDуdQRBNuDAр&AdRAрAрDуNuprt|=|  g +g -f .g20  b 0e 9b da`RF` .f 0e 9b dajSF` Eg efX +g -f 0e 9oSH`00  b&Hz0  b E Do`HJjDDDS4</NJFkSFk&aQN`Ha"FFaQL8Nް6.JgtBnNupr$<NuJBk4<rpAC v JBgJjv-| Bb BkH>aaNRFBdL8?Nް<JBga2SF Be BgQRB`ApdR e <rRF&0xafEv+0JFjDFv-Hƌd0BFHF 0HF0ANuprt|`2:HQ A dNAXJ@jNNuNJ@g,A,BBgHQ?<=NAP FJ@k??<>NAXtNutNuBNN^]N vN )@p `H@)@prtNAHplrtNB 2pN pNpapaprapalpalpalpaTpaTpaTBp'a?<NNT@B){L9|0<rtNpapap9@p`pvN v`v`vj`v `v`v`v`?Aa*` Al 2l 4)lVH)lRprtNAl 2l 4HVNuAl 2l 4L VA0000000000prtN9Cp rtNAv` Av `Avl 2l 4)lVHNaBp0,l 2Nua40,HNua*p0,l 4Nuaprt0,l 22,l 44,NuN9||BlBlrҌpsNBNu0<}N& ?<NNC`&?<NNT"@ C <}N`N(* 9AJA)H@@[000][ˈN Evz`* [g" ]g |g QSz` zQSpQ][ɈN Dvx`* [g" ]g |g QSx` xQSpQ]Bp4NHNu*( INA)H @depd ae zb QB DNA\)H @ e` ae zb \gQBA BhNpZNA BP"`#|}N*A"H0,tg"Hg \f`A\fS A ENAR@H`2QNur|<N @xepw2A$JBjDFHB t`0QBl9F)lVTAtp 9| N2(g"P@g2RADAH""l`r2oZAe 1@#)I`Nuk1@Nup NN"l`dpNAtrdJhk\QpaNH ld$l`"Hg: k&@0+R`g k#&@0+S@H3 Q&f)I`LNuApNN8$Nx$BS@kH2QNupC ұd"X0Pg"RA$D#Nu"X0Nu _0HpN _0HpNp"_0HqNp"_0HqNE ұeHHQ0)N$_$ZR@H`2QNu$Y0gHR@@"D%$X0P2g# R@%NupE $ $X0dP.gRG,D%pr Y2dP.gRG,D!p4Ae4v`VfANuNWHNuNVHNuNUHNuNSHNuNRHNuNTHNu Ihd*Nx$E$RR@H`2QˈN ENu Ihd"*Nx$E8*$R`"QˈN ENu2)A IJAfr4(Ae*RBBc0*SA?Nx$E$R`QˈN ENup`(* 0(iNx$E 4R`Q$D 4R`QˈN DN ENua NuN IHPg"B  g &gNJBjt BNut`Rptr ae OgT Xgj HgSRB ae Fb$0k  c_  c b退`tSJBkNRB0 b b瀀`RB0 fрd`0H 0 0H@Nu?<*NATAN,p N"H2H@N/0@N/YdNHAN2p <0Nx`QNu0g< @g4:8(g* b.&NxSD`Q0$C$RQLjN CNuNpNxp NpC 0(gFd"P$I` *Nx$E$R(S@jv A(Wf( ae zb Q DNur ,* N& ( EN C"Sj|AcJ@fCAHPBHQ?NA\ _JjNNuH&N*րN*jNu?r`??, N$F Z268SDĒDcCc2Ac0`QNuBNq Y Qf*d ЀЀ 2$4BBNutHRp` HRpJQfpNNq Y Qfd ЀЀNuNnNt$_& Y Qf d փփABJk 0NNrNl$_& if"QdփփHRNfNlNr~,Nq8DRzXEEg"7PNqR$HBJBgpNJgJigp`eetЂ`"ЀeЁdp`ЀeЀe"Ѕe$W.H@@NL"2` NqR YEjrd0` SjN$_NЀЀ 2$4BBN YQf "_Nq*eNrNl*< NqbІSGfN$_NփփHRN YQf "_&Nq*eNrNl*<&NqbֆSGfN @$P "t402g YRBB%(4g $`RBB%(Nu~$_NЀЀ Np"X4g S`"QNuNuNzJPgBP, d4d<e<Ѐ"ЀЁE Y0gR@2DAH!b` `ЀЀ`Ѐ"ЀЁE. l ,`2"X2g,e($UAk&QHPS Y2g RSj _b l ,"X2geb J"F\NԳxdtdD& pk<HCJCf2 IN |d& xfN"Nud & f2Nup@Nxd& tkHCJCfNf "@Ed ddeƐdH@J@f  @  "002Nu" KC`e N`d \NN l\Ӭ\ NupNd d3 d# d# # d# # # # d# # # # # # # # dB` # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # QNudd2d"d""d""""d""""""""dB` """"""""""""""""""""""""""""""""QNu?k?<NM"UAf J@fH@NuDW?<NMXNuPj0,lf$J,nk l*fp?Np N9|nNA0,l2J,jk 0"fZRAR@ 0"g 0 f` 0 g 0,f9@lTll`BllA"H"g"A4`Q"AA 0! NuS@R@ 0 g 0,f9@lRll`R@ 0 fQj`Bll?<?<?<NM\NHQN0&g ! ge l*g l*gpNNu<,*?Hj\F FfN`H FfN`RGFc8>`4A g6 g0 g` gTlfelhgFf2pRGRFa`a,` `?~ap ap a 0NuCpE`bf`FgRGJGgRSGSFFgCpE`Yf`Nua@Jf gH@ fa(@ fza0 b @ Ee0Nu?<?<NMXNur9A(HNLNu0,^2,`NzEfpaRppaNAEg0PaľEfa4RE`p a2a*Efp a(NlldeS@f lbfSl`9Ab9FdNupapqr`p`ak NupNuakfpNupNtddA0oH?<?B?<BNA Jk.,?<?B?<BNA *kBg?/?<BNA JkNuN<(`|HP?N.<pg2JFg W"X2@e2<A`QNCpR@ 1 fA 0! "_Nfp`pNu)H9@Jp4NP'J&f H LNu P&NuQ'` J,'fJ,&gHA#ȇeC! B,&LNu-W)K20, 8k8@ gJl&f"Nu , 8g"P 8 @/, 8N  8fQ 8J,'gNupB <``L@ H)l26)z @W , Jf`CfSHj-D@Hd0H@H 0H@0`fSC\fS , @a"C\fApNNNڶHP?< NA\NuH@aa/a a Nu@0 9c^Nu| PC>$Error # ][Abort]\f.B &lX)K\)ld` lp ,BQjNup(NVtHB9BL@@TAt )l g.A( f hgSASAgRB`9BJNSAgNuڠA JpBQA/)H )l gBlJpNB Aprt0 0BBB R@ @efA000 0PB0 *00 000\0X0 *0000 0P0BX0, *@00p1| 1|QBX0 $HTH0P &0 *0,NupNSk [0NupNuHPaH8 _&X Pf/|~ K!zag @ ep 24C"2 S@ػ Td BTA3A0C4$I2a222B"0@2A\xvaRg<2#M 4B3BS@ -f ػ Td>BAAb8RGRC`3RSG5GC5C J1DcaRF F e`RG GcdNuXASF1F41R 1h4 x1EDgVA)H)H 9|J?<NNTU@g,ACg dRhdRh(gpL8Np>L8NAJ0?C bL000zH?A/.)HpNLrHH/>Bl/,ff.f.ffNu l /.g&, ^`D&, N`>&, R`8&, V`2&, Z`,2,/4WAARA0,/6A hfRAS@f9A/,&, Jo ? CN0`@k Ap0(/.NuA Nup)@JphNLtH &JKBCH .A/~0 1PP1P1PA L? &<@>AFG0000X0000X0000X0000C ~AJ0g0  pi, N"F QNuYp-KNu _b@gGHpp 0f NuGNp @"l`Yd&-KNN"l`YepN&#k"C-KN"Cփk փk2##`փk"`2`$Y8gHRDD*D%H8#$c2g# HRDD%H`p"l`Qd&&| NuN"l`QepZNpr`&AdRd QJBgRBBABJk"l` d&6&|0!NuN"l` epZNC ҳfHP0(Nx$W$RR@H`2Q"H _$l` dd" $X&0BP6Y&|Hg R@@%E ҳeHQ0)N$_$RR@H`2QNu$Y 0P1@Hg R@@%NuN$l` epZN"X0gBPHR@@"D#Nu,jJj `BffAgb Jj 2$NuJjNuN21.0 March 1, 1988CNf?<NNT+@A0 0BmA C"NfBmLBm?<NATANC Nfp\NCNfHm p:N"_NHPA"_NCNfANp(CVNBN2 DESK CVNHxN> About DATA HANDLER4CVNHxN>-------------------CVNHxp1NCVNHxp2NCVNHxp3NCVNHxp4NCVNHxp5NCVNHxp6NCVNHx A CVNHx N> ACCESSORY 4CVNHx N2 Use an Accessory CVNHx N2 Return CVNHx A CVNHxN> FILES 4CVNHxN2 Set Drive Path CVNHxN> Load DB tCVNHxN> Save DB CVNHxN> Change DB CVNHxN2 Add New DB CVNHxN> Delete DB CVNHxA CVNHxN> RECORDS 4CVNHxN> Add CVNHxN2 Update CVNHxN2 Delete CVNHxN2 Search CVNHxN2 Sort CVNHxA CVNHxN> PRINT 4CVNHxN> All to Screen 4CVNHxN2 All to Printer CVNHx N> Select Fields CVNHx!N> Printer Setup CVNHx"A CVNHx#N2 QUIT CVNHx$N> End Session 4CVNHx%A CVNHx&A CVNHx'A CVNHx(A CVNA3N)|9 JNN`NڶN>N.pr+N <NN\NpNpNpNp N@ -N&<x*<N@NrnNTHE4NpNp NpNp N@ -N&<x*<N@N"<NAcNAN&<x*<NNfN;jApNAN&<x*<NNfN;AqNAN&<x*<NNfN;AyNAN&<x*<NNfN;A NAN&<x*<NNfN<ANAN&<x*<NNfNAVNA8\NN NڶN>N\N.pr2NNJVersion AN\NN.prNNJ Points to remember and consider:NN.prNNXG1. When building a data base, try to keep the field name size no larger4NN.prNNJFthan the length of the field to allow proper display of the field nameNN.prNNJHon the screen. (In any case, the field name will be properly displayed.)NN.prNNXE2. Calling an accessory is done through the menu and must be returned4NN.p rNNXCalso through the menu as some accessories will punch 'holes' in the4NN.p rNNXdisplay improperly.cNN.p rNNJL3. Control D will date stamp a 'Date' field when adding or updating records.NN.p rNNJDSet up your date fields for a length of eight characters (mm/dd/yy).NN.prNNJJ4. Sorting on a date field is possible if the name of the field is 'Date'.NN.prNNJ.Right justify any numbers you plan to sort on.NN.prNNJJ5. You can have a maximum of 1000 records in this version of DATA HANDLER.NN.prNNJB6. DHANDLER.PRG, DEFAULT.PRT, and your XXXXXXXX.DB files should beNN.prNNX=loaded in a ramdisk for the most efficient program operation.4NN.prNNJ([ Hit left mouse button to continue....]NNSWHgNBZ`pNN>N.pr%NNJPage 2NN.prNNXC7. DEFAULT.PRT is loaded automatically. If these codes are not the4NN.prNNJ@same as yours, you may build another printer setup and then saveNN.prNNJBit back as DEFAULT.PRT. This version uses only font 1 and font 3.NN.prNNX/No other printer codes are active at this time.fNN.p rNNXG8. Default drive is the drive the program is loaded from. Set any path4NN.p rNNXname or other drive if desired.sNN.p rNNXI9. Change DB allows you to change the name of a field and the length of a4NN.p rNNJ(field. You cannot delete or add fields.NN.prNNXG10. We are considering adding numeric inputs plus math functions on the4NN.prNNJBnext version of DATA HANDLER. Your suggestions, ideas and commentsNN.prNNJ@are solicited so please write us! (And thanks for your support!)NN.prNNX/Tom Robertson Richard GuthrieoNN.prNNJ0103 Woodcliff Ct. or 106 Forest DriveNN.prNNJ0Simpsonville, SC Fountain Inn, SCNN.prNNJ&29681 29644 NN.prNNJ([ Hit left mouse button to continue....]NNSWHgNGl`N NڶANzNNfNI|N }]HfNGHxN2Not enough Memory! | | HPN2OKr"_ NFAHNNI|A 0 -S_HfNHpNpNpNNH.pNpNpNA @0 <r$<ANPAN/p"NXN`NqNqprNXA P0 <r$<ANPAN/p"NXN`NqNq -JWHfNHA|Np rN< <"<?N -SWHfNIA|Np rN< <"<N -UWHfNILA|NprN< <"<Npr NXpr NXNNAN&<x*<NNgN NڶAN&<x*<NNfNIA8\NA|N*A|NBmNN NڶN>ANN.pr NNXCurrent drive is 4A N\NN.pr NNXCurrent path is 4AN\NN.p r NNXCurrent filespec is 4AN\NN.p r NNXEnter new drive letter (A - G) 4A:rNN.p r NNXEnter new path (\name\) 4A@r NA:NC:NfA@NC@NfHm:p:N"_NHPA@"_NCFNfHmFN>*.*"_NNNv&<x*<NNfNL A:C NfA@CNfAFCNfN.pr NNXFilespec now reset to 4HmN>*.*4"_NN\NN.pr NNXHit any key to continue ...pNZA$NNLHmFN24|does not exist or there|are no files in the folder."_NC"NfHxHm"N2OKr"_ NFAHNN NڶN>A~NzNNfNLA퀊 0NMlHmN2,|is already loaded.|Do you want to continue?"_NC"NfHxHm"N2YES|NOr"_ NFAHNAHN&<x*<NNfNMhA퀊 0BmNMlBmA퀊N&<x*<NNfNPA\NA2NAbNN.prNNJSelect data base to LOADNHmN2*.DB"_NHPA HPA.""_NA.NNv&<x*<NNfNP\BmvANN.pr NNJLoading A.N\NN.pr NNX Record # 4NN.prNArNLNpINHPA.r"_N^pNNCNfpNNlABN ABNC\NABNC2N <CbN+|ABNANpN/-NC\NpN/-NlC2NN`NqNqpNNlAHm.N> |not found.d"_NC"NfHxHm"N2OKr"_ NFAHNBmBmA0 0N NڶN>N.prNNXSelect file name to save 4AN\NHmN2*.DB"_NHPA HPAv""_NHmvp"_NzHPN>.DB"_NfNS$BmANN.pr NNXsaving 4AvN\NJ with ArNLNX records.4NN.pr NNX record # wNpONHPAvr"_N^pNAN\NpNABNLN+|ABNANpN -C\NN\NpN -C2N@NPNN`NqNqpNAHmvN2,|is not a good file name.|It must end in .DB"_NC"NfHxHm"N2OKr"_ NFAHNA~ 0N NڶN\N>A 0N.prNNX [CHANGE DB]4NN.ANNNhvN&<x*<NZN/p"NNJ* AN\NJ *NN.prBNNJ Field lengthNANA 0Bm+|ABNANN.A NrNpFNANLNN.A NrN -C\NN\AN <r$<H <r$<H <r$<H <r$<HAN <r$<H <r$<H <r$<H <r$<HANN.prNNJPress F1 to changeNN.prNNXthe field name.4NN.pr2NNJPress F2 to changeNN.pr2NNXthe field length.4NpNZA큼NA큼N&<x*<NNpJBgp/A큼N&<x*<NNpJBgp/A큼N&<x*<NNpJBgp$VHgNY`tA큼N&<x*<NNfN\8 <r$<H <r$<H <r$<H <r$<HAN <r$<H <r$<H <r$<H <r$<HAN <r$<H <r$<H <r$<H <r$<HAN <r$<H <r$<H <r$<H <r$<HANN.prNNJ Input new NN.prNNX field name.4NA큶NN&<x*<N^A N N.A NrNpNhN\NN.A NrNA큶NC\NrNBm@+|ABNAN -C\NNNA3You have exceeded the|maximum record length|of 230.HPN2OKr"_ NFAHNA$N&<x*<NNgNc`N NڶN>A~N&<x*<NNpJBgp/A퀊N&<x*<NNpJBgp$VHfNdHmN2,|is already loaded.|Do you want to continue?"_NC"NfHxHm"N2YES|NOr"_ NFAHNAHN&<x*<NNfNdBmBmA~NzNNpJBgp/A퀊NzNNpJBgp$VHfNpN\A0 0A CNfBmFA\NA2NpC\NpC2NBm@BmRA CNfA @0Bmp <r$<H <r$<H <r$<H <r$<HANN.pr"NNJReturn to ExitNpNpNpNp N@ -N&<x*<N@N"<N- Add Data Base -K"<NANN.prNNJ&Application Name (25 characters max): NN.prNNX#Enter Filename (8 characters max): 4NN.p rNNJ Enter Number of Fields (8 max): NN.prNNJRecord Length:NN.pr(NNX(Must not exceed 230)!NN.pr-NArNANJWHfNghAl 0Np <r$<H <r$<H <r$<H <r$<HANN.pr*NArNANHPN>.DB4"_NCNfHmA"_NNNvzNNfNp@ <r$<H <r$<H <r$<H <r$<H N.prNNJ*Your Records will be shown in this format:NA 0N.ANNNhvN&<x*<NZN/p"NNJ* AN\NJ *NANpC\NNNHpC\NNNL8NHpC\NNNL8NHpC\NNNL8NA+Do you wish to|save this database|to disk ?4HPN2YES|NOr"_ NFAHNN>AHN&<x*<NNfNoANN.pr NNJDatabase is being saved.NpONHPHmA"_Nr"_N^pNAN\NpNABNLN+|ABNANpN -C\NN\NpN -C2N@NPNN`NqNqpNADatabase saved to|file 4HPA"_NHPA"_NC"NfBHm"N2OKr"_ NFAHNNoHxN2Data base not saved.HPN2OKr"_ NFAHNNp:HxN>3You have exceeded the|maximum record length|of 230.4HPN2OKr"_ NFAHNNpHmA"_NHPN2( already exists|hit OK to return to menu"_NC"NfHxHm"N2OKr"_ NFAHNNzN NڶN>A C(NfN.prNNJSelect data base for DELETE.NHmN2*.DB"_NHPA HPA(""_NA(NNv&<x*<NNfNqHm(N>% is about|to be deleted|are you sure?."_NC"NfHxHm"N2YES|NOr"_ NFAHNAHN&<x*<NNfNqA(NN NڶN>N\A 0AhNABNChNN.prNNJ [ADD RECORD]NN.ANNNhvN&<x*<NZN/p"NNJ* AN\NJ *NAN+|ABNANN.A NrN -C\NN\AArNzNNfNzLHxN>No records loadedHPN2OKr"_ NFAHNN{N.prNNX[UPDATE RECORD]NN.ANNNhvN&<x*<NZN/p"NNJ* AN\NJ *NANN.prNNJRecord number to update:NN.pr(NNX(enter 0 to exit)4N <r$<H <r$<HtHArNH <ЍNHAdNANzNfN{N.prNp2NhN\NN.prBNNXRec# 4ANLNA{NN Nڶ <r$<H <r$<H <r$<H <r$<HANANA 0A 0A퀜 0+|ABNANN.A NrNpFNANLNN.A NrN -C\NN\AArNzNNfNdHxN>No records loadedHPN2OKr"_ NFAHNNA 0N.prNNX[DELETE RECORD]NN.ANNNhvN&<x*<NZN/p"NNJ* AN\NJ *NANN.prNNJRecord number to delete:NN.pr(NNX(enter 0 to exit)4N <r$<H <r$<HtHArNH <ЍNHAdNANzNfNN.prNp2NhN\NA 0A퀜 0N.prBNNXRec# 4ANLN+|ABNANN.A NrN -C\NN\AArNzNNfNhHxN>No records loaded4HPN2OKr"_ NFAHNN:N\A 0N.prNNX[SEARCH RECORD]NN.ANNNhvN&<x*<NZN/p"NNJ* AN\NJ *NANA 0+|ABNANN.A NrNpFNANLNN.A NrN -C\NN\AN <r$<H <r$<H <r$<H <r$<HAN <r$<H <r$<H <r$<H <r$<HANN.pr)NNXSEARCH Criterion:NN.pr;NNX1 [n <NN\ <NN\p]NNN.pr;NNJ2 [<=]NN.prCNNJ3 [=>]NN.prCNNX4 Range4NpNZA$NA$N&<x*<NNpJBgp/A$N&<x*<NpJBgp/A$N&<x*<NpJBgp$VHgN`tA$N&<x*<NfN: <r$<H <r$<H <r$<H <r$<HAN <r$<H <r$<H <r$<H <r$<HAN <r$<H <r$<H <r$<H <r$<HAN <r$<A$NNZA&N A&N&<x*<NNfNtN.pr9NNX Search: [4 <NN\ <NN\p]NNA&N&<x*<NNfNN.pr9NNJ Search: [<=]NA&N&<x*<NNfNN.pr9NNJ Search: [=>]NA, 0A N&<x*<NfN+| <r$<A NNZNAN -C2N@A,NN^A,N N`NqNqAvNA&N&<x*<NfNA NC2N@N/A킈"NA>NArNC>NBm6A&N~NPN.pr:NNXFound: 4A2NLNA2NzNNfNHxN2No records foundHPN2OKr"_ NFAHNN:BRBm< -C>N@&<x*<NNfNN.prBNNXRec# -NDNA퀜 0 <r$<H <r$<H <r$<H <r$<HANANA 0A 0ABNANPN.A NrNANC\NN\AN@C>NN`NqNqArN&<x*<N^N/tC>NSAN&<x*<NNfNA>NArNC>N/- <r$<C>NADNA8 0AN&<x*<NNfNADNABNSAN&<x*<NNfNANABNSA8N&<x*<NNgN: -NArNNgNN NڶN>N.prNNX[SEARCH RECORD]4NN.ANNNhvN&<x*<NZN/p"NNJ* AN\NJ *N <r$<H <r$<H <r$<H <r$<HANA&N&<x*<NNfNxN.pr9NNX Search: [4 <NN\ <NN\p]NNA&N&<x*<NNfNN.pr9NNJ Search: [<=]NA&N&<x*<NNfNN.pr9NNJ Search: [=>]NA&N&<x*<NNfNHN.pr:NNJEnter HIGH rangeNN.pr:NNXFound: %A2NLNN NڶN.A NrNA NC\NN\AJVHfN/- <r$<C>N <2Ѝ/ <r$< _N,N/-tC>NN``NqN NڶBm6A NC\NHPN2Date"_NpJBgp/A킈NN&<x*<NpJBgp$VHfNN2 / / C킲NfHmHxHmpr"_Nr "_N HmHxHmpr"_Nr "_N HmHxHmpr"_Nr "_N HmHxA킲r "_N +|ArNAN -CbNHPA,N/A NC2N@N""_NC킸NfA NC\NHPN2Date"_NpJBgp/A킈NN&<x*<NpJBgp$VHfNN2 / / C킲NfHmHxHmpr"_Nr "_N HmHxHmpr"_Nr "_N HmHxHmpr"_Nr "_N HmHxA킲r "_N HmA킈N"_NRHPA킈"_NHfNx/- <r$<C>N <2Ѝ/ <r$< _N,N/-tC>NN`^NqN NڶBm6A NC\NHPN2Date"_NpJBgp/A킈NN&<x*<NpJBgp$VHfNN2 / / C킲NfHmHxHmpr"_Nr "_N HmHxHmpr"_Nr "_N HmHxHmpr"_Nr "_N HmHxA킲r "_N +|ArNAN -CbNHPA,N/A NC2N@N""_NC킸NfA NC\NHPN2Date"_NpJBgp/A킈NN&<x*<NpJBgp$VHfNN2 / / C킲NfHmHxHmpr"_Nr "_N HmHxHmpr"_Nr "_N HmHxHmpr"_Nr "_N HmHxA킲r "_N HmA킈N"_NRHPA킈"_N4fN0/- <r$<C>N <2Ѝ/ <r$< _N,N>/-tC>NN`^NqN NڶN.pr:NNXEnter LOW rangeNAvNA NC2N@N/A킎"NN.pr:NNJEnter HIGH rangeNAvNA NC2N@N/A킔"NA>NArNC>NBm6A NC\NHPN2Date"_NpJBgp/A킎NN&<x*<NpJBgp/A킔NN&<x*<NpJBgp$VHfNN2 / / C킲NfHmHxHmpr"_Nr "_N HmHxHmpr"_Nr "_N HmHxHmpr"_Nr "_N HmHxA킲r "_N N2 / / C킲NfHmHxHmpr"_Nr "_N HmHxHmpr"_Nr "_N HmHxHmpr"_Nr "_N HmHxA킲r "_N +|ArNAN -CbNHPA,N/A NC2N@N""_NC킸NfA NC\NHPN2Date"_NpJBgp/A킎NN&<x*<NpJBgp/A킔NN&<x*<NpJBgp$VHfNN2 / / C킲NfHmHxHmpr"_Nr "_N HmHxHmpr"_Nr "_N HmHxHmpr"_Nr "_N HmHxA킲r "_N HmA킎N"_NRHPA킎"_N4pJBgp/HmA킔N"_NRHPA킔"_NHpJBgp$VHfN/- <r$<C>N <2Ѝ/ <r$< _N,N/-tC>NN`NqN NڶN>ArNzNNfN.HxN2No record loadedHPN2OKr"_ NFAHNNpN\A 0N.prNNX [SORT RECORD]NN.ANNNhvN&<x*<NZN/p"NNJ* AN\NJ *NANA 0+|ABNANN.A NrNpFNANLNN.A NrN -C\NN\N < Ѝ/ <r$< _N, <Ѝ/ <r$< _N,N`tNqAHN <r$<H <r$<H <r$<H <r$<HANN.pr:NNJ Function keysNN.pr:NNJfor sort fieldNpNZA$NA$N&<x*<NNpJBgp/A$N&<x*<NpJBgp/ABN&<x*<N^A$NNpJBgp$VHgN`hA$N&<x*<NfNpA 0 <r$<&<x*<ANN.ANrNNJ NNz`NqNq <r$<A$NNZA큀N A큀NN&<x*<N^A N N.A NrNNJ->N <r$<H <r$<H <r$<H <r$<HAN <r$<H <r$<H <r$<H <r$<HANN.pr6NNJEnter: A=AscendingNN.pr=NNJ D=DescendingNpNZA$NA$N&<x*<NNpJBgp/A$N&<x*<NNpJBgp/A$N&<x*<NNpJBgp/A$N&<x*<NNpJBgp/A$N&<x*<NNpJBgp$VHgNb`(A$N&<x*<NfNpA$N&<x*<NNpJBgp/A$N&<x*<NNpJBgp$VHfNAl 0A$N&<x*<NNpJBgp/A$N&<x*<NNpJBgp$VHfNLAl 0N>A큆 0A큀N&<x*<NfN+| <r$<A큀NNZNAN -C2N@A큆NN^A큆N N`NqNqArNCtNN2 CXNf+|ArNAN -NNCRNf/- -CbNHPA큆N/A큀NC2N@N""_NHPHmXARNYD"_NR"_NHPAR"_NCtNA큀NC\NHPN2Date"_NpJBgp/A큀NC2N@&<x*<NpJBgp$VHfNpNhC킲NfHmHx -CtNHPpr"_Nr "_N HmHx -CtNHPpr"_Nr "_N HmHx -CtNHPpr"_Nr "_N -CtNHPHxA킲r "_N N`jNq fN\R` -CtNHPA킦"_N*fNS` -_HfN -CtNfHP -CtNf"_N8RS -^Hgj - ]HfN/- /-AN -$]HfN/-/-$ANN NڶArNzNNfNvHxN>No records loaded4HPN2OKr"_ NFAHNNA>NArNC>N+|ArNAN/- <r$<C>NN`NqNqANN NڶN>ANN>Rec# CNf+|ABNAN -CPN@&<x*<NNfNHm -C\N"_NHPp N"_NCNf -C2N@H -C\NNNL8NfNHm -C2N@H -C\NNNL8NZNNh"_NCNfN`.NqA 0AN P^HfN A 0AN ^HfNHA 0BmpONHPN2CON:r"_N^N>BmpNAN\NANANN^AN AN&<x*<N^AN ANNCRNfN2 CXNfANC>N@&<x*<NNfNpNHmXARNYD"_NRN\ARN\p NA큞 0+|ABNAN -CPN@&<x*<NNfN>pNANCbNHPA큞N/ -C2N@N""_NN\p N -C\NNNH -C2N@L8NfN>pN -C\NNNH -C2N@L8NZNNhN\ -C2N@A큞NN^A큞N N`NqpNNANANN^AN AN&<x*<NpJBgp/ArNANNNpJBgp$VHgN.prNNJ,Press any key to continue... or ^C to exit.NpNZA$NA$NzNgNB`A$N&<x*<NNgN|ArNANNgpNN NڶArNzNNfNHxN>No records loaded HPN2OKr"_ NFAHNNNArNC>N+|ArNAN/- <r$<C>NN`NqNqADNN NڶN>HxN>#Do you want|record numbers printer?HPN2YES|NOr"_ NFA퀐NHxN>Do you want|date printed?iHPN2YES|NOr"_ NFANAN&<x*<NNfNNCNfNA CNfHxN2"Is printer ready to|print records?HPN2YES|NOr"_ NFAHNAHN&<x*<NNfN ANA퀐N&<x*<NNfNN>Rec# CNfNA CNf+|ABNAN -CPN@&<x*<NNfNHm -C\N"_NHPp N"_NCNf -C2N@H -C\NNNL8NfNHm -C2N@H -C\NNNL8NZNNh"_NCNfN`.NqAN O_HfNBpONHPN2LST:r"_N^HmpXN"_N fN$pNAN\NpNAjN\NpNNpONHPN2LST:r"_N^HmpXN"_N fNpNAN\NpNApN\NpNA 0AN ^HfNA 0BmpONHPN2LST:r"_N^pNNJ Records for database: AN\pNhN\AN\NpNNBmpNAN\NpNNAN&<x*<N^AN ANNCRNfN2 CXNfANC>N@&<x*<NNfNtA퀐N&<x*<NNfN"pNHmXARNYD"_NRN\ARN\p NA큞 0+|ABNAN -CPN@&<x*<NNfN$pNANCbNHPA큞N/ -C2N@N""_NN\p N -C\NNNH -C2N@L8NfN$pN -C\NNNH -C2N@L8NZNNhN\ -C2N@A큞NN^A큞N N`NqpNNANANN^AN AN&<x*<NpJBgp/ArNANNNpJBgp$VHg+|AN&<x*<NZNANpNNN`NqNqArNANNgpNN NڶN>A 0N.prNNX[SELECT FIELDS]4NN.prNNX[TO PRINT = * ]4NN.ANNNhvN&<x*<NZN/p"NNJ* AN\NJ *NN.prHNNXPrintNN.prHNNJLengthNANA 0Bm+|ABNANN.A NrNpFNANLNN.A NrN -C\NN\ANAHN <r$<H <r$<H <r$<H <r$<HANN.prNNJPress function keyNN.prNNXto toggle printing.4NpNZA$NA$N&<x*<NNpJBgp/A$N&<x*<NpJBgp/ABN&<x*<N^A$NNpJBgp$VHgN^`hA$N&<x*<NfN <r$<A$NNZA큪N A큪NCPN@&<x*<NNfNA큪N/tCPNNA큪N/ <r$<CPNA>NA$N&<x*<NNgN6`N NڶA 0Bm <r$<H <r$<H <r$<H <r$<HAN <r$<H <r$<H <r$<H <r$<HAN+|ABNAN -CPN@&<x*<NNfNN.A NrNp*NNN.A NrLN -C2N@H -C\NNNL8N&<x*<N^NPN <Ѝ/ -C2N@H -C\NNNL8N&<x*<N^ _N, < Ѝ/ <r$< _N,N`NqN.prLNA큰NLNN NڶN\BmADNHx pCD~NHmN> DEFAULT.PRT4"_NNNvzNNfN^HxHx <r$<CD~NHxHx <r$<CD~NHxHx <r$<CD~NHxHx <r$<CD~NHx Hx <r$<CD~NHx Hx <r$<CD~NANNHmN> DEFAULT.PRT"_NC킚NfpINHPA킚r"_N^+|p AN+|pANpN/-/-NlCD~NN`NqNqN`NqNqpNA퀊 0ANN>BmBmN.prNNXSelect .PRT to load4NHmN>*.PRT"_NHPA HPA킚""_NHmA "_N fNϺpINHPA킚r"_N^+|p AN+|pANpN/-/-NlCD~NN`NqNqN`NqNqA퀊 0pNANAHN&<x*<NNfNtN>N.prNNXSelect .PRT to save4NN.prNNX+Use file name DEFAULT.PRT for auto loading.4NHmN>*.PRT"_NHPA HPA킠""_NHmA "_N fNtHmp"_NzHPN2.PRT"_N fNHxN2file name must|end in .PRTHPN2OKr"_ NFAnNNtpONHPA킠r"_N^+|p AN+|pANpN/- -CD~NNPNN`NqNqN`NqNqpNANNшA8 0A8N&<x*<NNgNѮ`\N Nڶ+|p AN+|pAN/- -CD~NzNfNfN. -NvN&<x*<N^N/ -NN&<x*<N^N"N/- -CD~NNPNN`nNqN`RNqN NڶAV 0 -NvNA\N <r$<H <r$<H <r$<H <r$<HANN.prNNX[SETUP PRINTER]NA퀊N&<x*<NNfNlN.prNp[NA킚N\NJ loaded]NN.prNNX Code Option!NAVN&<x*<N@N/A\N&<x*<N@N"N Left Margin4N <r$<&<x*<N@N/ <r$<&<x*<N@H -NL8N@H <r$<L8NZN"N Top of Form4NN.p rNNJFont 1 (10CPI)N <r$<&<x*<N@N/ <r$<&<x*<N@H -NL8N@H <r$<L8NZN"NBold ONN <r$<&<x*<N@N/ <r$<&<x*<N@H -NL8N@H <r$<L8NZN"N DEFAULT.PRT"_NNNvzNNfNNpNHPpPN"_NCjNfpNHPpN"_NCpNfpNHPp@N"_NCNfNpINHPHmN> DEFAULT.PRT"_Nr"_N^ADNHx pCD~N+|p AN+|pANpN/-/-NlCD~NN`NqNqN`NqNqpNANN NڶBmx+|pANHx -CD~NzNNg NN` )|not saved, are you sure|you want to END?4"_NC"NfHxHm"N2YES|NOr"_ NFAHNAHN&<x*<NNfNRNڶN\NڶN NڶLA퀺NLA퀴NLA퀮NLA퀨NLA퀢NA퀴NNC^NfA^NA퀜NN.A퀢N/A퀨N"NA퀜N/Ad"NA퀴N&<x*<N^AN AdN*JWHfNN2Please input a number|between HPA퀮NN"_NHPN> and 4"_NHPA퀴NN"_NC"NfHxHm"N2OKr"_ NFAHNN.A퀢N/A퀨N"NA퀜NNhN\N.A퀢N/A퀨N"NA퀜N/Ad"NNAdN0A퀮NNpJBgp/AdN0A퀴NNpJBgp$VHfNvpaNCdNfNAdN0AN N.A퀢N/A퀨N"NA퀜NNhN\N.A퀢N/A퀨N"NANLNA퀺N/AN"_NjA퀮NANNpJBgp/A퀴NANNpJBgp$VHgN@`N Nڶ <r$<H <r$<H <r$<H <r$<HANN.prNNJEsc toNN.prNNX Exit4NN NڶLAPNLAJNLADNLA>N <r$<A>NNZvNN/ADNvNH <r$<L8NZH -NL8N@N"NNpNpNpN <r$<A>NNZvNN/ADNvNH <r$<L8NZH -NL8N@N"NDZ HRR&\RRfhp&>P Z(|x>R&RJ&NRRHdDR^&N<<2 RV&D>D>LP>:Zj`x(zxB$<>Zz*J`j202R"zx8 R&L&&lRB^ R Rt&"| r&&Fx 0PLZFbb>x JZ0 0 0 0 0 0 0 0 0 0 27 80 0 0 0 0 0 0 0 0 27 15 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 27 64 0 0 0 THE ATARI ST DATA HANDLER Version 1.0 by Tom Robertson & Richard Guthrie This program is distributed under the shareware concept. You are free to copy it and give it away but if you use it, please send $5.00 to: Tom Robertson Richard Guthrie 103 Woodcliff Ct. or 106 Forest Drive Simpsonville, SC Fountain Inn, SC 29681 29644 1. After unarcing, you will find four files: DHANDLER.PRG, DEFAULT.PRT, SAMPLE.DB, and README.DOC. 2. For the most efficient operation, we suggest you place these files in a ramdisk and then run DHANDLER.PRG from that drive source. The program uses whichever drive you run it from as the default drive but you may override default by setting the drive path from the "FILES" menu selection. 3. To use a desk accessory, select "Use an Accessory" under the "ACCESSORY" menu selection. This allows you to then pick any accessory you may have under the "DESK" menu selection. When you finish with an accessory, you must select "Return" under the "ACCESSORY" menu selection. 4. Under the "DESK" menu, "About DATA HANDLER" is two pages of helpful information on running the program. Review this material before proceeding. 5. We have attempted to design this data base as a very simple and easy to use system for handling data. Each screen has instructions on what can be done within that screen. Select "Load DB" from the "FILES" menu and load in SAMPLE.DB. You can use this data to practice adding, updating, deleting, searching, and sorting records. You can see the results by going to the "PRINT" menu and choose "All to Screen". Within a few keystrokes, you'll find the system very easy to use. 6. After you've finished a session with DATA HANDLER, be sure to save your new data back to your disk. Select "Save DB" under the "FILES" menu. The program will prompt you to do this. 7. An interesting feature also is the "Change DB" selection. This allows you to change the names of fields or the lengths of fields. It will not allow you to delete or add fields. This feature is very helpful in custom alignment of your data when you print to the screen. 8. "Add New DB" allows you to set up a new data base and prompts you through each step. After creating your new data base, you must save it to disk and then load it back in before adding new records. 9. "Delete DB" is just as the name implies, be certain!! 10. During adding and updating records, you may date stamp a field named "Date" as long as the field length is eight spaces long. Control D will put the system date in this format: DD/MM/YY. Also, sorting on a date is possible if the field is named "Date" and the same format is used. 11. Under the "PRINT" menu, "Printer Setup" allows you to enter your printer codes for fonts 1 and 3. The default is for a Panasonic 1091 so you may need to change these settings. Function keys F3, F5, and F9 are the only active inputs with this version. If your print length is under 80 characters long, font 1 will be selected. If print length is over 80, font 3 will be selected. F9 is for printer initialization. DEFAULT.PRT should be placed in the root directory only. 12. "Select Fields" under "PRINT" menu allows you to toggle any field on or off for display or printing. An asterick on the left of the function keys indicates the field will be displayed. Experimentation with the various functions of the program can teach you more than any doc file so have fun with the program and thanks for your support!! New Prospect List 6 Name 20 Address 20 City 13 St 2 Zip 5 Date 8 7 68 Jones, Jack A. 110 S. Broad St. Charleston SC2278802/04/87 Melton, James A. Travis Circle Toccoa GA4467809/14/87 Wheeler, Ronnie D. 101 Davis Street Macon GA2278801/15/88 Newton, Jim Wentworth St. Clemson SC2245504/12/86 Glenn, Fred B. 9 Miracle Drive Greenville SC2960603/06/88 Thomas, Jerry R. 406 Pleasant Ridge Piedmont SC2343305/19/87 Scott, Thomas R. 110 Hale Drive Ware Place SC2223406/17/87 Rodgers, George R. 15 Charlotte St. Charleston SC2267701/12/88 Locke, Samuel M. 216 Whitmore Drive Piedmont SC2325508/09/87 Love, Bill T. 616 S. Wrenn St. Clemson SC3332105/19/87 Johnson, Tom E. 17 Cedar Lane St. Greenville SC2772111/20/85 Ledford, Gene A. 14 White St. Piedmont SC2221104/16/87 Richards, Robbie 12 Skyland Drive Asheville NC2238806/06/87 Smith, Ron R. 3709 E. North St. Macon GA3342212/11/87 Taylor, Benny T. 1566 Cherokee Lane Spartanburg SC2223701/19/88 Thompson, Jasper C. 1 Green Meadows Ln Charleston SC2223405/22/87 Young, William T. 105 Pimlico Circle Charleston SC2223405/17/87 Thompson, Danny D. 303 Del Norte St. Greenville SC2960606/10/86 Dalton, Charles F. Indian River Road Fort Pierce FL1778701/08/87 Anderson, John 1555 Smith Drive Anderson SC2967706/16/86 McKinney, A.R. Centre Blvd. Piedmont SC2964404/07/87 Roe, James 22 Quail Hill Anderson SC2964402/03/87 Tumblin, Edwin 155 Bennet Way Clemson SC2954406/07/87 Brice, Ken R. 12 Fulton Acres Spartanburg SC3452201/14/88 Brown, Allen M. 108 Pelham Road Greenville SC2960608/19/87 .  `E.. FB DOC zt FF#FB PRG }t ObSFB RSC t dGENIE DEF t iGENIE RPT t jSAMPLE DAT !`k*SAMPLE DEF t mSAMPLE RPT t nTRIMFILEPRG t o XYZZX DAT "`XYZZX DEF (`fJLPS DAT *!SINGLES DAT '!lLPS DEF 0!g/LPAB DAT ]`LPAB DEF q`SINGLES $`iINGLES2DEF !gIN DEF !hpA DAT J`A DEF O`INGLE1ADAT (`INGLES1DEF 0!i^INGLE1ADEF /`jINGLEA1DAT `INGLEA1DEF `k  First Base - Database First Base is a fast memory resident database system for small and medium size applications. It is not full featured but has a wide range of uses, is fast and very easy to learn and use. Besides the usual type of application such as address lists, video tape listings, computer program lists, records of checks, etc. a separate program is provided which will enable you to put the GENIE directory of files into this database so you can search through it at your leisure. The entire data base is loaded into the memory of your ST. The more free memory you have the larger database possible. There is an arbitrary limit of 6000 records for the current revision of the program. Options in the program are selected either by use of the function keys or by selecting from a pull down menu with the mouse. The return, delete, backspace, insert, home, and arrow keys are used when editing a record. A database file generally consists of three parts the filename.DAT which is the data organized as one record per line (which may be more than 80 characters). The data is in ASCII format so the file will appear normal when viewed and it will be accessible to editors or other programs. The second part is the filename.DEF. This file defines the field names and the length of each field. It is also in normal ASCII format. It can be created with the First Base or it can be created with a stand alone editor. The third part is the filename.RPT. This file identifies how the data will be printed and what heading is to be used on the page. Limits for revision 1.3 are one printer line per record 80 character per line normal or 132 character per line compressed. To run the program double click on FB.PRG. When the load file box is shown you may change disks if the data will be on another disk. Click on select. You may seclect an old .DAT file, change the disk drive, or enter a new .DAT name for a new file. If you choose to make a new file brief instruction are displayed and the cursor will be at the upper left corner of the screen. First you type the name of the field, it looks best of when preceded by a blank space. Then type a : followed by a space. Finally use the _ (underscore) to specify the number of spaces desired for the field. For example... PROGRAM NAME: _____________________ When you are satisified with that field press the return key. Continue in the same manner for other fields. You are limited to 11 fields and not more than 80 character across the screen on any one field. Finally after the last field press the F5 key (write). This saves your field definition file and your are ready for entering new data. Any time you want to enter new data into the fields you must first press the F6 key. This sets up the data entry mode. After pressing F6 you fill in the fields and press the F5 key to save the data. After pressing F5 the record will advance and fields will be blank again waiting for the next entry. When you have completed entering data you can press F3 to go to the first of the data or one of the other function keys to escape from entering. To edit fields the editing keys work as follows: Up arrow moves to preceding field (up). Down arrow moves to following field (down). Right arrow advances cursor to right, at end of field goes to next one. Left arrow moves cursor to left and stops at first of field. Return is similar to down arrow. Back space deletes character under the cursor and moves it left. Delete deletes character under the cursor but does not move it. Insert toggles the insert mode on or off. Home sets the cursor at the home position. Shift home clears the fields they do not stay cleared unless you follow by pressing the F5 key. Control home sets the home position of the cursor (depending on what the current field is.) Undo is for quitting without saving the file back to the disk. Help displays a brief summary of commands. Function keys are as follows: (F11 to F20 are obtained using shift) F1 Display next record in sequence F2 Display previous record in squence F3 Display first record in memory. F4 Display last record in memory. F5 Write current record on screen to memory. F6 Begin entry of new record. F7 Clear fields (but don't save to memory unless followed by F5.) F8 Sort the field that cursor is currently in. F9 Search the field that curson is currently in for a string. F10 Quit and save the data in memory back to disk. F11 Delete a file from the disk (making room for .DAT file. F12 Format a new disk (currently single density 10 sector only) F13 Merge another database file with the one in memory. This will only work when both files use the save .DEF type, that is the fields are all the same type and length. F14 Quit but don't save the data back to disk, same as Undo. F15 Not used F16 Print normal sized print. F17 Print compressed print (set up for Epson printer code.) Sorts can be made on any field, either ascending or descending. To sort first move the cursor to the field to be sorted. Press the F8 key and wait. To do a double sort resort on another field. Then the first field sorted will be ordered in the second field where fields are of the same value. Searches can also be done in any field. First move the cursor to the field to be searched. Type in a string to be searched for. At this point if you press return the search is forward from the current record. You can also search forward by pressing the F1 or you can search backward by pressing F2. When a match is found the record will be displayed. You may then press return to continue searching or another key if you are done. A blank screen shows that no further matches were found. Searches are not case sensitive. In order to delete records from a file you must first display the record to be deleted, then press F7 followed by F5. This leaves a blank record in memory. Before quiting and saving the file to disk sort on any field in ascending order. This puts the blank records at the first. When the file is saved these blank records will be skipped and not saved to disk. Printing is limited to one record per line. In uncompressed mode that is 80 characters or 132 in compressed mode. The report format can be created through the program or through a stand alone editor. When using the program you select create format (F26) through the menu. After doing this the fields are displayed preceded by a number for each field. That number is used to identify what field is printed, A is 10 and B is 11. You set up the format by typing the number of print locations for each field desired. For example if you wanted 10 places for field to you type 2222222222. Then if you want field 4 next which has 5 places you type 44444. $, spaces, . , etc may be inserted. This all goes on one line. To make it easier to know the exact number of places required for each field you may press the function key corresponding to the field number. This will put in the required spaces for that field. If there are less spaces than the field requires printed entries are truncated. If there are more spaces blanks are inserted. After entring the coded format line press return. Backspace is the only editing key that works. Next enter the page heading which labels the columns of fields. The cursor will be lined up under the coded field data so you can tell how much room you have for the titles. When you have completed this press return. This completes creating a report format. Before you begin printing you may decide to print the data in several columns. This will condense the output and is usefull when you have a large number of records but the amount of data to be printed is small. For instance if you made a list of programs and what disk each is on you might be able to print 4 across compressed. Select the number of print columns from the pull down menu. Included with this program in the .ARC file is a sample set up for keeping track of computer programs that I use. It is only included so you can try out the First Base program, some of the entries are coded with letters to save space. Also included is a program called TRIMFILE.PRG. Using this program you can take the GENIE file list and adapt it to the First Base program. If you download the GENIE list #4875 (or more recent update) and want to convert it you will need at least 1 meg memory and a double sided disk drive. Parts of the total file can be handled without the space requirement. When you run the trimfile program to make it compatible with the .DEF file that is included here you will need to enter the following number at each prompt of the trimfile program. 15, 2, 71, 13, 48. Suggestions regarding this program are welcome. Write... Dave Henry 1720 Wickersham Dr. Anchorage, Alaska 99507 `RlEDN ND>*O*m - ЭЭм!"ҍ¼.A// Bg?<JNA m"m -So Q m -SBQ(m)M*mN lHhNLX/,?,NN\?<N2?<A?<NAXNuNV nfHn?. BgN1xPHlHlHlHl/.N0HlHlBg/.N/x?,?,?,?,?< ?< BgBgBgN/?,?,?,?,?< ?< BgBg?<N/?,?,?,?,?<Bg/.N.`P?,?,?,?,?< ?< BgBg?<N/v?,?,?,?,?< ?< BgBg?<N/N/.NX-@ .N^NuNV .N^NuNVHN,9@ȆN!NHlN0,XJ@fHl?<N/B\?<N1LTHlLBgBgN0P?</,LN-\9@Ȧ| ̌l3̎9|9|Ȑ9|Ȏ?<N;T9@BlDz9|Ǎ)H̠Hl?<N.\B,HlN)>X9@Ȧ lȦg`HlHlHlN  HlHl̬HlN HlHlHlN ?<Hl?<=N:P9@Ȩ9| lȨlBgHl?<Hl̬N2P)@ fHl?<N,\`BlBlBl`4/,?<FHlN4 ,H|f`BlȜBlȺ`8AȺH| f`, lȜfAȺH|_f9lȺȜRlȺ lFȺm lȜf9lȺȜ lȜo9|Ȝ0,An0ȺBl"`$A"2," A҈ ARl"0,"lȜm0," AЈ @B0,ȺlȜ9@0,ȜR@2,A00,l9@0,A00,R@9@RlRl l mN!0,T@9@/,N-X ,l/0,H/N3P XS)@X?,Hl`N\A` Aa /<]?<HN6\/NX)@H/N6pX ,@t)@< N lȼfHl?<N#\9@$ l$f` l ȼf6Hl?<N#\\HlNX9@Ȧ lȦfHl?<AN/X\N l ȼfZHl|?<N#\9@$ l$f2Hl?<N#\Hl(?<N#\)lHDBlBl`N lo9|?,/N,X lȼmB lȼn:Bg0,|%?/,LNDP?<0,ȼ|?/,LN,P0,ȼ|9@ lȼfT?<?<NX)@8Bg/,8N\9@ǰ?<BgBgBgBgBgBg?,ǰ/,8N?<?<NXN lȼf|Hl?<N \9@ lfTN" lȦfDHl@HlN&P)@/,?<HlN' /,?<HlʄN'p /,N"XNL lfN?<?< ?<N@\?<?<NXN?<HlN\BlȠBlȢ`?<HlN\ lȠf ,T;9@ȸ0,ȸ|19@Ƞ l9Ƞo 0,Ƞ^@9@Ƞ lȸm0,ȸlnx0,ȸA02,ȸAP9@BlȜ`H?,Ƞ?<?<N*\0,ȠAȢRlȢ lPȢf?<?<NX lȢf`RlȜ0,Ȝlm lȢf` l Ƞf0,ȢRlȢA AȢBHl?<NR\?<?<NzXBlȠBlȢ`?<HlʄN\ lȢf` l Ƞf0,ȢRlȢAʄ AʄȢBN dN lȦfBHlBHlN#P)@ g&/,HlN*P/,HlʄN)P/,N XN"N@ lȼo l"ȼlHl?<N\ l ȼfv)l̨̤)l̤̐BlȪB\`H)l̤̐BlȜ` l̐R̐H| g9|ȪRlȜ0,Ȝlm lȪf`R̐R̐R\ ,\XmHlNX9@Ȧ lȦgN`Hl?<AN)\A)H0,R@?/,?<6N(P l  l/ (/N%^  l/ ( /N%L )@d ,XR\/0,H/N%. )@x ,xdoHl?<Nf\BlȼN`DHl(?<N\BgHl?<=N(\P9@ l o8?, ?<>N(BXHlHlBg?<VN(. 9@Ȧ lȦlN`BgHl?<N'XN ?,ÖN,TBg/,LN\9@Ȧ/,̨?<IN'\NDLN^NuNuNVBn` nR Rn0.n mN^NuNV . 6.HЃ-@ `0 n H|f`* n R H??<?<N&\Rn0.n o?< ?<?<N&\?<?<?<N&\?<D?<?<N&\N^NuNV?<?<?<N&\?<Y?<?<N&\0.|??<?<N&v\0. |??<?<N&^\N^NuNVBn=nB.`\ l&fHnHnHnHnHnHnBgBgHnBgBgBgBgBgBgBgBgBgBgBgBgBg?<N<=@ ng=n=n?<?,Ȇ/,LNP?<?./,LNP0.|"=@0.@=@ n9f=|D nEm nVn 0.|=@ n5m n8n 0.|=@ n,f=|n` naf=|W` =l&Bl&0.@ nDo nMf@|0.n l*Rn?<?<?<N$\?<C?<?<N$\`| nKf8|0.ng(Sn?<?<?<N$\?<D?<?<N$\ nRf| lf9|`Bl nPf` nwf9lȺDz nHf=|q nG7f=| nGf=|p nSfN?<?<?<N$\?<j?<?<N#\=n`6 n ( n  n H??<?<N#\Rn0.n m n  ?< ?<?<N#\?<?<?<N#\?<k?<?<N#t\N nf0.ngSnN?<?<?<N#@\?<D?<?<N#.\?<?<?<N#\?<j?<?<N# \=n`6 n ( n  n H??<?<N"\Rn0.n m n  ?< ?<?<N"\?<?<?<N"\?<k?<?<N"\N*.H|f80.@|:=@ no 0.|=@ no n)l=n ng`R0.n o.H| g9n& l&g`*.H|o.H|{l0.n n lfNP.H??<?<N!\?<?<?<N!\?<j?<?<N!\=n`H n P n n0.ng n H??<?<N!H\Rn0.n o?<?<?<N!(\?<k?<?<N!\N`".H??<?<N \ n Rn.H| f0.n9@Ȟ0.N^NuNV .=@=|'`F0.H=@0.|0??<?<N \0.2.A=@0.H =@ nfN^NuNV=n=|'`F0.H=@0.|0??<?<N *\0.2.A=@0.H =@ nfN^NuNV?.NT?<-Bg?<N\?<NT=n =|`0. =@0.H =@ n l`D0. H=@0.|0?Bg?<N\0. 2.A=@ 0.H =@ nf?<NZT?<-Bg?<N>\?<NTN^NuNV ,̨"./2,H/N"Ё-@ .N^NuNV ,̨"./2,H/N"Ё)@̤Bn` l̤R̤ n R Rn0.lmN^NuNV ,p/0,H/Nd )@h ,̨Ьh)@̤Bn` nR l̤R̤Rn0.lm l̤ R̤ l̤ ,pXo)lpXN^NuNV?<E?<N|X ,pR/N\XBn`R0.A?0<2.A?NDXHl`0.A0S@?0.A?NPRn0.lmN^NuNV/.NX)@̘/. NrX)@̔Bn` l̘R̘ l̔R̔Rn0.lmN^NuNVBn`$?< Bg?<NT\?< Bg?<ND\Rn0.nmN^NuNV?<NTBn`XBn-n `> nH| g nRH?Bg?<N\`?< Bg?<N\Rn0.n oRn0.nm?<NHTBn`?<-Bg?<N\Rn0.lm?<NTN^NuNV?<?<?<Nj\?<f?<?<NX\N^NuNV?<?<?<N>\?<e?<?<N,\N^NuNVA-HBnB.`Rn nRP.H|0@.H| o .H_@@.H|m .Hlo.H?Bg?<N\`p..HHAg.HA=P0..HAPn(0.RnA`H9@ȸ?,ȸBg?<NN\`?< Bg?<N<\n nH| g 0.nm`?< Bg?<N \Rn0.noN^NuNVBn`?< Bg?<N\Rn0.nmN^NuNV?.?<NXBn`?< ?<?<N\Rn0.n mN^NuNV?<M?<NXN^NuNVBn`j nH|.fD nR n R  .V-@Bn` nR n R Rn nm nR n R Rn nmN^NuNVHl Hl Hl Hl NR9@ÖBn`0.RnAÀ0 n m9|ÔHlHlÖHlÀN N^NuNV0.=@9n9n9nRn9nǼ9n0. R@=@ 9n 9n 0. R@=@ 9n Ǵ9n Ǹ0. =@ 9n 9n 9n 9n Ǻ0. | =@ 9n 9n Ǿ9n ǶRn 9n 9n Bg?,ÖNXHl?<?,ÖNjP?<?,ÖNXSn 9n 9n Hl?<?,ÖN:PHlǼ?<?,ÖN(PHlǴ?<?,ÖNPN^NuNVBlǼ9|9| Ǿ9| ?< ?,ÖNX?<?,ÖN*X=|`*9nǾ9nHlǼ?<?,ÖNP0.|=@ nm?<?,ÖNX?<?,ÖNXN^NuNV .N^NuNV .N^NuNV=n =n0. nH n-P` .2. nf` Rn0. n//.NPJ@f` .2. nf`&Sn?,Ȥ/.0. n/N J@f0.nl00.Sn nA/0.Rn nA/N^P`0.nfRn0.no80. nl?.?. /.NP0.nl?.?./.NPN^NuNVH0&n$n -K-J 6,ȐHЃ&@ 6,ȐHЃ$@0,ȐR@=@`RRHHAg`Rn0.lȎo lȔgTHHAfH .6,ȔHЃ&@ .6,ȔHЃ$@0,ȔR@=@`RRHHAg`Rn0.lȒo lfHHAo0<`0<=@`HHAl0<`0<=@0.L N^NuNV-|A-H n  n n  n n  n N^NuNV .N^NuNVBlȼHl(?<N \?<?<?<N\?<;?<NfXHl?<BgNPN?<O?<N.X?<?<NBgNP\Hl(?<N \N^NuNVB`R mN^NuNV,H|fHl&?<N\`X0,HS@9@0<72,SA9@ȾBlȮ9|ȬHlʄ?,?,N,PBp`?<?<NDX9@Ƞ lȠf?<?<N*X9@Ƞ lȠf`RlȮ l8Ȯf\?<NT?,Ȭ?,NX?<NT ,p6,ȾHЃ)@p ,pXo`Hlʄ?,?,NPRlȬ9|Ȯ ,pXo`f)lp\BlȜ`6Hl`/,\NP?,N^T ,\м7)@\ ,\Xo`RlȜ0,Ȝlm?<NTRp ,pXoN^NuNVBlȜ`0,ȜAn=P0.Ȝn 9@?<?,NPX n g: l Ȝl0,Ȝ|1??<?<N\`0,Ȝ|7??<?<N\Bl"`L0," AЈ @ȜH|f`40," AЈ @ȜH??<?<Nr\Rl" l"m n f?,?.BgN\RlȜ0,ȜlmN^NuNV?<?<N(X)@T ,T9@Ƞ lȠf^?<?<?<N\?< ?<?<N\?<?<?<N\SlȢ lOȢf?<P?. NX lȢlBlȢ`F lȠg>0,Ƞ nȢ?,Ƞ?<?<N\RlȢ lPȢf?<0. R@?NXN^NuNV9|`L9ll3̎0,|A@.Hl$/.Hl.N =@,.H|A9@?,?<NLX0,ܰlf,̎,3HHAf l$g ng nH|f=|`Bn0.N^NuNVB,BlȜ`AȜA3ȜRlȜ lȜmHlN(X9@ȦBlȜ`AȜA3ȜRlȜ lȜmN^Nu)I,)J("/0<NB"l,$l(Nu NV9n0.| A" AA-H=|` nR2.AH0Rn nm/,hN.X0,˜N^NuNVA)HlA)HpA¨)HtA˜)HxAŒ)H|A„)H€Al)Hh?< NXT9l˜f0,fN^NuNV?<NT n0š0,˜N^NuNV)nŒ?<nNTN^NuNV9n¨9n ª9|?<pNTBl n „0,˜N^NuNV?.N xT nn0<`?.?<>N X9@`g0<`0<N^NuNVHlD/.N PJ@g`HlJ/.N PJ@gNHlP/.N PJ@gj `hH|afB0<n?/.N\> @f?./.N4\>?<B?NPj `0.n?/.N\>j Gf Bj <`05G Bj <$%@?<B?* NP%@5l L N^NuNVH0&n$K`0.H| f`HSn 0. @o: nSh0( @m n R @H|` /.N^X=@ @fB nf f <` L N^NuNVH$.f BB`J". BnJlVnDJlRnDvd`Bbd nmDdD-@-A LN^NuNV/BnJlRnDJ lRnD 0. -@0.n0. nngD -n N^.JNuN^NuNV nl <`?.?./. ?<BN -@ m .`?<?.B?<BN -@?<?.B?<BN -@ nf .Ю -@ `$ nf .Ю -@ `0.g <`b . oHn . /?.?<@N6 Bg?./. ?<BN ]|9@`g <` `Bl` . N^NuNV/.?<HN\N^NuNV/.?<IN\N^NuNVBn`60.A00f"0.A000.A20 ` Rn nLmN^NuNVBn`&0.A00nf0.A0BPRn nLmN^NuNV?>.=|0A0"HPgXHf0(>N^NuNVHlV/.NPJ@f =|`Hl\/.NPJ@f =|`Hlb/.NPJ@f=|`f0. |g0/.NXJ@g0<``Bg/.?<NX0. |?/.?<=NlP=@9@` @l0<`0. | ??.N~X0.N^Nu)I,)J()_$NM"l,$l(/,$Nu)I,)J()_$NN"l,$l(/,$Nu)I,)J()_$NA"l,$l(/,$NuNV`/. nRH?N\ nfN^NuNV nf:0,Ұlf0<9@9@`?<NT=@ nf*0,g Sl?<?<NfX?<D?<NXX` n f00,RlA ?< ?<N,X?< ?<NX`v nf ?<NT nf20.2,RlA?< ?<NX?< ?<NX`*0.2,RlA?.?<NX0<fAH|f0<`0,RlAH`` nf?<NfT``0 FIRST BASE v1.3 <--- Fast in memory databaseDave Henrycopyright (c) 1987 by'I$:%#I#m# # # #  # ! # E# i# ###&'#K#o###$#$##$#G$#k$ $$ #$ #$# $#! $#"D$##h$#$$#%$#&$ #'$#'PP*  %  ,  5  <!  .P  D Y n (<"! Pi !.#- $1%B&S'd(u)*+,- " /4#012 34(. 7! @r Oi    d\ FILE NUMBER: _____ FILE NAME: _________________________ FILE TYPE: __ ADDRESS: _____________ FILE DATE: _______ BYTES: ________ ACCESSES: _______ LIBRARY: ___ DESCRIPTION: _____________________________________ 11111 2222222222222222222222222 33 4444444444444 5555555 66666666 7777777 888 9999999999999999999999999999999999999 numb file name tp address date bytes access lib description B Bg BgB BgBg BgBg? BgBg?< 9|Ȑ9 8 bit to degas font converter s049 su m 8 byte emulator s153 sa a copier s144 su a copier s152 su a netmidi s231 su a network s230 su accessory load s063 su address s049 sa m adventure (orginal classic) s053 sv m adventure system create s046 su m aim image processor s236 da m alarm clock accessory s099 su almanac s185 sa c alsase (play/demo) s056 sg m alternate reality s001 sg m 8 alternate reality s031 sg m 9 alternate reality saved games s002 sd amiga demo s100 sa animatics s071 sn b animator s038 su m archive s046 su m 8 archive s050 su m archive Artist :____________________________________________________________________ Year :________ Cat.no :________________________________________ Track.1.:____________________________________________________________________ Track.2.:____________________________________________________________________ Track.3.:____________________________________________________________________ Track.4.:____________________________________________________________________ Label :______________________________________ Cond :________________ Special :____________________________________________________________________ Cost :___________ Value :______________ Charts :_______________ PROGRAM: ______________________________ COMPUTER: _ DISK NUMBER: ___ SIDE: _ DOS TYPE: _ PROGRAM TYPE: __ LANGUAGE: _ NOTES: __ RATING: _ 111111111111111111111111111111 2 333 5 66 77 88 9 Program Name Com Disk Dos Type Lan Note Rate ` B, N NL*O*m - ЭЭм!"ҍ¼.A// Bg?<JNA m"m -So Q m -SBQ(m)M*mN lHhN,X/,?,N\?<N?<A?<NAXNuNVNR?<NTT9@9|Hl?<N\B,d`9lHldNX9@0,lfl9|`AbARl lmHlHlN \P)@29|Hl?<N\B,P`9lHlPNX9@0,lfl9|`ANARl lmHlHlN P)@.N6HlNXHlxN@XHlxNX9@HlNXHlxNXHlxNX9@HlrNXHlxNXHlxNX9@HlHNXHlxNXHlxNX9@HlN^XHlxNXHlxNfX9@N\SlSl lo9| llBlBl`/,2?<PHlN | Rl0,lmBl`/,2?<PHlN P ,H|f`Bl9l`Z0,l9@AH| f9| lfA `AARl0,lmRlA lm/,2?<PHl6N ,H|f`Bl9l`z0,ll9@A6H| f9| lfA `A6A0,loA `Rl lmBl`AH| f`Rl lmRl ln AB/,.HlNPRl lu0m8/,2N8X/,.N.XN^NuNuNV` nRH??<?<N \ nH|fN^NuNV?< ?<?<N \?< ?<?<N \N^NuNVBn`P?<N T=@ nfSnSn`( n f nB`0. nRn n mNnN^NuNV0,|A@Hl/.HlN ,H|A9@?,?<N PX0,`N^NuNV?<?<?<N \?<f?<?<N \N^NuNV?<?<?<N \?<e?<?<N \N^Nu)If)Jb"/0<NB"lf$lbNu NV9n$0.| A" AA-H=|` nR2.A$H0Rn nm/,N.X0,N^NuNVA$)HA)HA)HA)HA)HA)HA)H?< NXT9l0,N^NuNV9n)n ?<4N0TN^NuNV)n)n ?<ZNT n00,N^NuNV?.N T nn0<`?.?<>N HX9@g0<`0<N^NuNVHl/.N PJ@g`Hl /.N PJ@gNHl/.N PJ@gj `hH|afB0<n?/.N\> @f?./.N4\>?<B?NhPj `0.n?/.ND\>j Gf Bj <`05G Bj <$%@?<B?* NP%@5l L N^NuNVH0&n$K`0.H| f`HSn 0. @o: nSh0( @m n R @H|` /.N^X=@ @fB nf f <` L N^NuNV/BnJlRnDJ lRnD 0. -@0.n0. nngD -n N^.JNuN^NuNV nl <`?.?./. ?<BN -@ m .`?<?.B?<BN -@?<?.B?<BN -@ nf .Ю -@ `$ nf .Ю -@ `0.g <`b . oHn . /?.?<@N Bg?./. ?<BN ]|9@g <` `Bl . N^NuNV/.?<HN\N^NuNV/.?<IN\N^NuNVBn`60.Aj0f"0.Aj00.Al0 ` Rn nLmN^NuNVBn`&0.Aj0nf0.AjBPRn nLmN^NuNV?>.=|0Aj"HPgXHf0(>N^NuNVHl/.NPJ@f =|`Hl/.NPJ@f =|`Hl"/.NPJ@f=|`f0. |g0/.NnXJ@g0<``Bg/.?<NhX0. |?/.?<=NPP=@9@ @l0<`0. | ??.N~X0.N^Nu)If)Jb)_^NM"lf$lb/,^Nu)If)Jb)_^NA"lf$lb/,^NuNV`/. nRH?N\ nfN^NuNV nf:0, l f0<9@ 9@ `?<NT=@ nf*0, g Sl ?<?<NfX?<D?<NXX` n f00, Rl A ?< ?<N,X?< ?<NX`v nf ?<NT nf20.2, Rl A?< ?<NX?< ?<NX`*0.2, Rl A?.?<NX0<fA H|f0<`0, Rl AH`` nf?<NfT``0 of course. When a constant number is used as an argument brackets are optional. However spreadsheets can also use values from previous cells as arguments to calculate new values. When these values are used as arguments, you should use the number of the cell in place of the value in the function. You do not need brackets around the cell number. For example, to get the sine of the value in cell A1, enter . . . =SIN A1 followed by of course. You amy also have nested functions, that is one function acting on the result of another function, all in the same cell. A few examples will help. All the following are valid and correct . . . =SIN A1 =SIN(A1) =COS(SIN A1) =EXP COS SIN A1 =EXP(COS SIN(A1)) In fact these expressions with nested functions are bad spreadsheet practice. Very quickly, it is easy to lose track of the structure of the spreadsheet and where results have come from. The 'DISPLAY' command detailed below may go some way towards helping the situation but nested functions are only recommended when you are short of space on the spreadsheet. GLOSSARY OF ACCEPTED EXPRESSIONS ================================== The spreadsheet uses the Fast BASIC 'EVAL' command to recalculate the expressions in the cells so any valid expression in Fast BASIC can be used in ST- Sheet. Each is detailed below for those of you who don't have Fast BASIC. - Unary minus. Gives the negative of a number. + Unary plus. Gives the positive of a number. (Optional). NOT Inverts its argument. ^ Raises the first value to the power of the second. >> Bit shifts to the right the first number by the second number of bits. << Bit shift to the left. As above. * Multiplication. / Division. DIV Integer division. MOD Returns the remainder of an integer division. + Addition. - Subtraction. AND Bitwise AND operation. EOR " " " OR " " " ABS Returns value without sign. i.e. ABS(-10) = ABS(10) = 10 ACS Arc cosine. Result in raians. ALOG Anti-logarithm to base ten. ASC ASCII code of a character. ASN Arc sine. See ACS above. ATN Arc tangent. See ACS above. COS Cosine. See ACS above. Remember in radians. DEG Convert an angle in radians into an angle in degrees. DISCFREE Returns bytes free on disk. Might be useful ??? DRIVE Determine current drive. ??? DRIVEMAP Determine which drives are attached. ??? ERR Number of last error. ??? EXP Exponential. e (2.71828...) to any power. FALSE Logical NOT TRUE. In fact 0. FIELD Width of PRINT field. ??? FREE Determine free memory. ??? GRAFHEIGHT Height of graphics rectangle. ??? GRAFWIDTH Width " " " ??? GRAFXBASE X-coord " " " ??? GRAFYBASE Y- " " " " ??? INP Input from an I/O device. ??? INPSTAT Input device status. ??? INT Integer value of argument. LEN Length of a string. ??? LN Base e logarithm. LOG Base 10 logarithm. LOGBASE GEM screen base address. ??? OUTSTAT Output port status. ??? PEEK Examine supervisor memory. PHYSBASE Physical screen base address. ??? PI 3.1415926 . . . RAD Convert angle in degrees to an angle in radians. RND Return random 32 bit integer. RND(-n) Return same number again. RND(0) Return same number as last returned by RND(1). RND(1) Return random number in range 0 to 0.999 inclusive. RND(n) Return random number in range 1 to n inclusive. ROUND Round a number to the nearest integer. SCREENHEIGHT Determine total screen height. ??? SCREENMODE Determine current screen resolution. ??? SCREENWIDTH Determine total screen width. ??? SGN Return sign of argument. -1= -ve, 0= 0, +1= +ve SIN Sine. SQR Square root. SQUARE n squared. Faster than n^2 TAN Tangent. TIME Internal timer. ??? TRUNC Truncate value towards zero. TRUNC(10.6)=10, TRUNC(-9.5)=-9 TXTHEIGHT Text rectangle height. ??? TXTWIDTH " " width. ??? TXTXBASE " " x-coord. ??? TXTYBASE " " y- " ??? TXTXPOS X-coord of cursor. ??? TXTYPOS Y- " " " ??? VAL Value of number in string. I see no real use for some of these functions but they could come in handy. Some of the mathematical functions can be operated at double precision be preceding them with a 'D'. The extra decimal places will not be noticed though, and they will just slow down recalculation so it's not really worth it. TEXT IN THE SPREADSHEET ========================= A sheet full of numbers is not very meaningful so the facility for text in essential. Each cell can hold up to nine characters so only short titles and notes can be squeezed in. To enter text, position the mouse pointer over the required cell and press the left hand button. When the '?' prompt appears you should type in your text. To indicate to the spreadsheet that it is text you should precede it by an apostrophe sign, ('). For example to place the text 'PRICES' in cell D4, place the mouse pointer over cell D4 and depress the left hand button. When the prompt appears type in . . . 'PRICES followed by . Due to the small size of the characters I suggest that you only use upper case characters, to improve readibility. In fact it is advisable to keep CAPS LOCK ON throughout as all expressions and commands require upper case characters. INSTRUCTIONS AND COMMANDS =========================== There are only seven commands in this early version. Suggestions for additional commands and instructions will be gratefully received, and will result in a new version being published. For all of the commands, only the first two characters are tested so it is only necessary to type these. Thus RECALCULATE ON can be shortened to RE ON. In fact the ON can also be abbreviated to N. Thus the shortest forms of commands are shown below . . . RECALCULATE ON = REN RECALCULATE OFF = REF BLANK n = BL n BLANK r = BL r SAVE = SA LOAD = LO QUIT = QU FORMAT DDDDDDD = FO DDDDDDD DISPLAY ON = DIN DISPLAY OFF = DIF The functions of these commands are detailed below . . . RECALCULATE:- With this ON, after ever operation the values in the spreadsheet will be automatically recalculated. Thus the spreadsheet will always be up to date if an alteration is made. However recalculation and reprinting can take a while so only turn it on every so often. BLANK:- BLANK followed by a number will remove all numbers, expressions and text from that particular column. BLANK followed by a letter will remove all numbers, expressions and text from that particular row. SAVE:- This command allows you to save a spreadsheet you have created. It will be saved in its most recent format. Each spreadsheet will take at least 2 kilobytes on the disk. LOAD:- This command allows you to load a previously created spreadsheet. QUIT:- QUIT is the only way you can leave the program. You will be asked to confirm the command. FORMAT:- At start up the highest value in any cell is 9999.99. Any higher value will result in an error. The format command is the most complex so it will be explained separately at the end. DISPLAY:- If you haven't noted each cells expression then it can be difficult to work out what's going on. With DISPLAY ON any cell that the mouse pointer passes over will have its expression printed at the bottom of the screen. This can slow mouse movements but is very useful. The format command allows you to display the numbers in your spreadsheet in any way that you like. Essentially you can select how many digits you want before the decimal point and how many afterwards. There are seven available positions so you can have seven digits, or six digits and a decimal point. This allows you to configure your spreadsheet to deal with either very large numbers, or very small numbers, or a mixture. The 'FORMAT' command hould be followed by the seven symbols that you require. These symbols consist of upper case 'D's or 'Z's and at most one '.' . If any of the last seven characters in the command is not a 'D' or 'Z', or if there is more that one '.', an error message will be generated. The '.' in the command specifies where the decimal point will come. A 'D' will be replaced by the digit in its position, while a 'Z' will be replaced by a digit or a space if that digit was '0'. A few examples may help . . . Number. Format. Displayed as. 125.3 DDD.DDD 125.300 125.3 ZZD.DZZ 125.3 1.253 DDD.DDD 001.253 1.253 ZZD.DDD 1.253 5832.456 DDDD.DD (rounding up) 5832.46 58.3 DDDD.DD 0058.30 5791347 DDDDDDD 5791347 23 DDDDDDD 0000023 23 ZZZZZZD 23 From these examples you should be able to see that 'Z's allow you to remove ugly leading '0's. As a general rule, it is best to have all 'Z's with 'D's just before and after the decimal point. The default format is 'ZZZD.DD', all decimal digits that cannot be displayed will round up the previous digit, (see the example above). ERROR MESSAGES ================ Whenever an error occurs, it is trapped and the Fast BASIC error type displayed. When you exit the alert the cell mentioned will be automatically cleared and set to its start-up value. The following list summarises the errors I have successfully invoked. All are trapped and cannot ruin the spreadsheet. Illegal assignment : You tried to enter a character after an '='. E.G. '=A' '=CHR$(65)' To big to be real : The number you entered, or has been calculated, is to big to be printed with the current format. E.G. Any number greater than 9999.99 on start-up. Missing right-hand bracket : You entered an expression with more left-hand brackets than right-hand brackets. E.G. '=SIN (A0' ACS/ASN range : The number you entered, or has been calculated, breaks the -1 to +1 limit on these functions. E.G. '=ACS 2.6' Division by zero : It has come about that, a division by zero has occurred. E.G. '=(SIN 1.7)/(2-2)' EXP range : The argument supplied for EXP is to large. E.G. '=EXP 100' LOG range : The argument supplied for LOG is to large or small. E.G. '=LOG (SIN 0)' Negative square root : You tried to calculate the root of a negative number. E.G. '=SQR (5-EXP 2)' Tokenising error : This error occurs when Fast BASIC's 'EVAL' command cannot convert your input into the tokens it uses. E.G. '=ASC ("T)' No such variable : You have put something in your expression that doesn't constitute a function, a number or a cell address. E.G. '=STOP' Incorrect format : This is the error message given if you follow the FORMAT command with anything other than 'Z's, 'D's or a '.' . E.G. 'FORMAT zzzD.zz' On this disk you should find the following files . . . ST_SHEET.PRG : The spreadsheet as an executable file. or ST_SHEET.ACC : The spreadsheet in a desk accessory format. EXAMPLE1.DAT : An example spreadsheet for you to play with. MANUAL.ASC : The necessary documentation. READ.ME : This file. If your disk is missing any of the last three files, then first,contact me at the address below, then contact the library, as the inclusion of all these files is part of the agreement between me and them. You should also have ST_SHEET.PRG or ST_SHEET.ACC, if you have both then you can count yourself lucky. If you only have one, then send 2.50 and the disk that your current version is on, to me at the address below. You will receive the alternative version in return. ST-Sheet is in the Public Domain and as such there is no copyright, however if you do still have the software after 3 months, then you must send 5.00 to me at the address below, or erase the program and all documents. In return for your 5.00 you will receive the most recent version of the spreadsheet, (which won't be in the Public Domain), in both .PRG and .ACC formats. A complete, documented source code listing of the Fast BASIC code is available for the minute sum of 5.00. Send the money, and the disk with your version of the spreadsheet. You will receive the listing, hopefully laser printed, and your disk back. ST-Sheet will be under constant development so any suggestions for new commands or instructions will be gratefully received. If that feature is included then the suggestor will receive the most recent version of the program, free of charge. Loads'a'money, suggestions and comments to . . . Neil Smith, 42 Hayes Road, Bromley, Kent, BR2 9AA. please. `I&` F 4MJy f2*O*m-M - ЭЭ// Bg?<JNAO JkO a0a.A=X=P=| N6Jf`BnBnBNaa p N1JngAV-H=n0<#N1a>"< <NJg-H<-H@aNN/N/a/N.zLNuH0<?N.zLNuB@=@AD-HpNN1Nu0<`0<`H=n =|A-Hp!N1LNuA$ k"X"`Nu=|BnphN1LHH=|p3N1Nu=|A-HpN1NuJngA-HpN1 n(fpaa0. |g |ga>Jnf`&AL @!@!@C!I!I-I-I"Bh Bh"=h$B,B0B:BNu n,n^A@Rh0<(AQAh AhA@ShAPUhAPhQhAThZh*PhBNuH2IA!2I naL?NuH=@R2IA-p na,L?NuH0.RA pa0.RaLNuI8.L(t@0,$AaNu?:MGNI&K&PPJ4Pg RR`TTR| m.BDCJQgBQ:MG7PRDTT| m8.RL0.Ra0.RAH1NuBngPa=@HA1aJf -nv`H0.aaJf6 nv .r".za28.LGH/3@?<INA\L'v@0.2IK;aa@nRf-nv0.Ra 0.a a .BnNung` Nua>N^JgH?<NNT/?NAXJzfBra .r".z nvNua$Jg?AQ-H=|p4N10NuH@P nv"CXf"(fBLNu=@B.Ad-HCB<.:<PQA-HpZN1JngaJf&=|Aj-Hp4N1 nf`t0.a a8Jfb nv .r".za8.LGH/3@?<INA\L'v@0.2IK;-nv nv0.Ra0.0.Nu=n =|phN1Lnbf=|phN1LHH=|/=|plN1LHLH=n =|piN1NuLaB8.HĈDl4B8.nLDl68Bno0.B8Cnno 2.CnNuaL aaBn=|-LHplN1-n-n=n=|piN1LH$H$fNrL$NJ`,Ha(?A?C26/:/>/ a>?CLNuAnEG0C@n2E6@n6NuvNu=n=| piN1Nuaa=n=| phN1JngJngLL aZJBgdJCg^JgNH@0HB4Ԁ-@ -B -@ -B A-H A-H =| 0<1N.z` BDN0=n=| `ba`H=|=|)HplN1-n-nnnLNuBn=|phN1-n-nLB(C KCJBP@CTAUACCB@axNu=|--n-npdN1=nNunnBn=|--n-nplN1-n-n=npeN1Nu=npfN1=npgN1NuA-H=n=|piN1Nu Output Id?<NATA:Bg/ ?<GNAPJfS\*.BSCBNuAdC0<BAA|mRRQNuLBDN0IAN"<SAf"O /NuNPJ  !z!n!n"1n$NuJng"a$p=@RaAL-H-Ha`J/<?<HNA\Jg-@-@"-A" @@2<CSAf-H @aj></<?<HNA\JgJE%p-@"-A" @@2<CHSAf-H @aXG|(mB@Nu<NuJf.-n-n-n B/<?<HNA\-@-@Nu nJg2< BAfNuI8< H/?<INA\LSDfNuJg/.?<INA\NuH~T.,/?<HNA\JfnB` @ L~NuH?<NNT-@?<NNT|f=|=|=| `2|f=|=|=| `=|@=|=| 0.H=@LNuHA-H -H =| JDjD`D@ASBSCJDjH DDH `H DDH 0<1N.zLNu  02 46@ N f ~   {  "$&,. &%x7'6&H(8*G,.467YIXH@jXZZi\^dfY { k z   j p |   { &Z-H\JgB@BABBJg6 [fRAR@ ]fSA |fRB|g |fPNu|nJAfJ@g|nJf/< ?<HNA\JfpNu-@ n0<r:< n^n:<1A!|1|1EBB BBhRAQ nC0|g 21`0<1|. nn 0< 1| .1n1n,1n1n!n2<F4<1Q"n\ n-H"n\$n [g JfPNuRJfPNu ]g`B%nD-H$n`&nBG [g Jf`` nR ]g$ \g |g`B%n `B<F '`G-H ]f`AR"n#H\A[#HT"n80<a><0<?a>Q"nH0<$i gBAJgPA`3AQ"n$IHB@2<i3@5@Q nh1@D1hL41h$ 1h1hT<1h1hl1h  1h 0<"n a><"n0<?a>Q"n0)bh24<@3AQ"nH0<J f Q n4<2.A0(h@l 6h1CQ nh0<BhQ-n=|pN1B@Nu$I8< n^l8<BEJ g5EDQ3ENuBB$I2BC&i gBDJgPD`Dn6Q5CQNu-------------------- Desk Jg/.?<INA\A-HBnpN1B@Nu` 0 00}    0 @ P`p8ppp p0p@pPp`ppp}T ,(<22 2 F m@ d z    $x  $<Z< n00P<%P< D @ @(@8@X@hd@xxd@xd @xd @ @h `  "" Desk File About Runner-------------------- Load Program Run Program-------------- Show Info Dump Output QuitFast BasicRun-Time InterpreterComputer ConceptsProgram execution stoppeddue to:OKProgram InformationCANCELRUNNERFast ST BASICRun-time InterpreterRUNNER bits: Phil MartinInterpreter: Jeremy RustonGavin TheobaldPhil Martinand Nigel, who doesn't like to be mentioned!Version Number: 1.05c/00 Computer Concepts 1986Gaddesden Place, Hemel Hempstead,Herts. HP2 6EX EnglandTelephone: (0442) 63937PROG1 .BSC32___FFFFFFFFFFF99999Name:________.___Kbytes of Workspace :_____XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX_________________________________________________________________________________[3][A loading error has occurred. |you may try again or cancel.][ Cancel | Retry ][3][The file you tried to run|was not in Fast Basic format.][ OK ][3][The file you were trying|to access cannot be found.][ OK ][3][The pathname chosen could|not be found.][ OK ][3][Access not possible.][ OK ][3][Invalid drive letter.][ OK ][3][An error has occured.][ OK ]?p``p?%t%z,%t%% L% d% |% % % % % %!<%!T&"%%%%% % $!)$& "&:"%"&B"&E#&B#&Y#$#%#L'$'%'$'%'$'% &`#&g#&u$ &$$&$<&$T&$l'$'$% ",%<"D%X"\'8% 'Z%<'t%X(4%$(V%@(p%\'%((%D(%`$$aؼ-H/=@JAgp6N1L`LH pHHBnp3N1L pH=|Bn-Wp*N1=n-_p2N1=nL pHH=|p3N1`(Nu?(|ff6<UT`<If,C$g|<(xaf6SCUT``\<.f"C$gF<(xahf86UT`<Af P6; Ja6.gr)a(F|fr+a`~ApNuDodgy assembler token!BWLSRD--SCYf<` TQDNuDNuhWfd~VBCDDDADDIDDQDDXDDNDINDSLSRTSTTSRHILSCCCSNEEQVCVSPLMIGELTGTLELOHSRACHGCLRSETHKLRMPAMPIMPMMPCRBTBFBHIBLSBCCBCSBNEBEQBVCBVSBPLBMIBGEBLTBGTBLEBLOBHSBRACSIVSIVUORIORVENQUXGXTNCLUDEMPSREAINKSLSROVEAOVEMOVEPOVEQOVEULSULUBCDEGXEGOPOTPTRGRIRESETOLOROXLOXRSTETRTSBCDTOPUBAUBIUBQUBXUBWAPTFHILSCCCSNEEQVCVSPLMIGELTGTLELOHSPRASRAPVRAPSTNLKSPP $Zlqxڏ(9D bB.Bn A$$<2<`=| < gX< gb< gr<"g<$g<%g"`F p`8`b. p`pANux<0fRD`v`0m <n`SHCJCg 0<8a0a 0aHC0a`\0<:a0`vJ.g<ae <zb 0m<n< o < m鋆`SHCJCg0<,a0aHC0a`0<.`0<*a<"g< g2Sgt`<"gSSg`B0gBSgL`pANu0<a0 A$Nu0<  fR@`Sa`r0<  fR@`Sa`ZC ¼<ae <zb )<ae <zb f0HR$LJ.g<ae <zb g` gJ)fa(JS|@g\|BgV|gV|gP|Dgl|RgZ|Tg`|PgZ|FgN|Hgΰ|Jgư|Lg$|Ng2|Vg`|XgZ``"`B@a`rB@aB@aB@aa`XS|cBS0g@BS`8B@aa<0eμ<9c<Ae¼<Zc <_e<zbSg`TfJfJ)f`.B@a|< gSgt`<.f<0m<9n`<9n<0mH`NbS<g><g^L&H@J@g0<a H@aH@a`b0<a0a`PNZL&0<a H@aH@a`*N(&L0<4a H@aH@a`ȼ<AmL<znD<Zo<_m6&L<0m<9o<Am<Zo<_m<zox <|g$x <&gx<%gx<#g x<$gxS (fRD |gf|g|g| g| g0aB@aa`Ja( VDDmSgS`BS8DgBSNuJn f :f0<6aB@aR` fp(aB@A@av`* <fnp&a`RB@A@aP`* <fHp$a:RB@A@a*`* <f"p"aRB@Aa`fUg0NuXpAgNuDodgy token-K -H *H b-H <k|:o2|Fo`pANur |lr FFaVQ`C`NLbZrpnljhfdb`^\ 0D2*TJTga`2 A<:a`V|<`,r%az0aQ`.8|<`8,r%a`2<0aQzJk Q`0aQ`|<`,r$alzfSEj2<0aT`A;aBQ`0123456789ABCDEFr"a"ga<"fa`r"a2 gjR`d< a Mp&n Nu|<`,C6BC(kBARAj܄SAfJCg0av`JCfr0a`;B@'d H NANLEgaR`HLNANLEga&`r#a`2AAar|a `r2AAAar&a`\2AAAar%a`F2AAAa`6Xga`2 A`C`fga`|@gV|BgP|DgJ|PgD|Rg:|Tg8|Fg0|Hg2|Jg,|Lg|Ng|Vg2|Xg,`T`TTX`Tga6`2 A`X`No entry in DeTokKeyTab!!#(-379>FLSX]kmoqsz-137;?Y_w| &/8@JRWak} ",6:?INimqw !$(+.02579;=?AFKQW_fp     % . 6 ? G O U ] f n s   >    $ + 5 7 = C E J H P X ` h n w { "  CI #,4<D    $ . 7 : G N U h r { 7>   X   # ( - 2 7 < B G L P T Y ] c h m r x %   $ ) 3 : B I@gNuXB@ANu@THENBELSEDGOTOFGOSUBHREMJ\LDATANRESTOREPWHILERSWITCHTCASEVPROCXFNINKEY$INKEY`!b#d(f)hSNDREGjLOGBASEl,nPHYSBASEpHELPr:t;vERRORxERR$zERR|SETMOUSE~RECTSCREENWIDTH?@[]SCREENHEIGHT>ENDUPDATEENDIFENDSWITCH{~CALLCHAINCLEARGRAFRECTCLOSE#DIMENDPROCDEFAULTDEF|ABSENDRUNTXTRECTPRINT#INPUT#PRINTVDU(TIME12$*TIME24$TIMEESCAPEHEX$READAPPLREADPOLYGONNOTONOFFLENRESERVESCREENFREESCREENFREEACSASNATNDEGEXPINTLOGLNPIEPIRAD%TANCOSSINSQRREPEATUNTILFORMAT$(\DOFORM^SETWINDTITLE`SETWINDINFObGETWINDWORKdGETWINDCOORDSfSETWINDCOORDShGETWINDPREVjGETWINDFULLlHSLIDEnVSLIDEpTOPrGETFIRSTtGETNEXTvSETDESKxHSLSIZEzVSLSIZETOSTEPNEXTIFRETURNINPSTATOUTSTAT&INPUTINPFORRS232LINEENDSGRAFMODELINETYPELINEPATLINEWIDTHLINECOLLINE FILLPERIM FILLSTYLEFILLCOLFILLPATFILLCIRCLEMOUSERESERVETXTXBASETXTYBASETXTWIDTHTXTHEIGHT GRAFXBASE"GRAFYBASE$GRAFWIDTH&GRAFHEIGHT(OUTXBASE*OUTYBASE,OUTWIDTH.OUTHEIGHT0OUTDUMPDOUTHANDLE2OUT4HIDEMOUSE6SHOWMOUSE8CLS:HOMECHR$@GET$RGETREC#VGETBYTES#BGETDINKFPAPERHTXTSIZEJTXTEFFECTSLTXTXPOSNTXTYPOSPPALETTERPOINT(TGRABTPUTREC#XPUTBYTES#VPUTWAITBUTTONWAITEVENTWAITTIMERWAITMESSAGEWAITMOUSEXWAITZPC\<<^>>`DIVbMODdEORfORhANDj<>l<=n<p=r>=t>v+x-z*|/~^EOF#EXT#BPUT#BGET#MAKEDIRDELDIRLISTFILE$PATH$DRIVEMAPDRIVEDISKFREEDISCFREERENAMEDELFILEFSELECTOPENINOPENOUTOPENUPPTR#FILEATTSFILETIMEFILEDATEBLOADBSAVEMENUTAKEMOUSERELEASEMOUSEDSQRPOLYMARKMARKTYPEMARKSIZEMARKCOLPOLYLINEINSTALLPERFORMTRASHSEGFREESEGNAME$SEGMENTBLIT{something}WENDSETCOLLEFT$(RIGHT$(MID$(ASCINSTR(EVALEXEC}|}&}%}#}$$}$}DUMPVARSDUMPPROGLOCALCURSONCURSOFFCURSCOLCURSLEFTCURSRIGHT CURSUP CURSDOWNDUPDEV#REDIRECT#LAUNCHMEDIACHANGEVARCOUNTFIELD '"TAB($SPC,DATEUK$.DATEUS$0SYSTIME2SYSDATE4TRACE6TRACKING8KEY:ALTTRANSBLIT@SYSVARBMANDEL(DJULIA(FSEARCHLISTJeremyHy-_$-L =@ Jng|g |+g|f.n!vNu=@ V.n F|g|+g|g |gJn Pf&NT/ .$a` .$a`NX aNu(n R` NuNuT4T@TLTVT`TjTtPHyU`8:@R8..,$" @>N"  B\B\BNuXNuTNu\NuPNuBJf0 @NuT La"L1INuTY9JNuP Hx P` Ha Hb Hc Hd He Hf Hg Hh Hi Hj Hk Hl Hm Hn Ho H   @AB &  b P2Q2R2S2T2U2V2W2X2Y2Z2[2\2]2^2_2 d j p  ؀ ± xNH.N N A NW BB HGA !! Lp ?1 d  H @ D Nw :F x PHB 0Nw Nw Nw 2Nw 6Nw XQ HHA |P Q R S T U V W X Y Z [ \ ] ^ _   J Nw @NG J NW p+`Ba n$} gaT$O͵@eRn ~Dn ~aBn B B. B a.| J.g ?.!za=_!za gB. z<FC_4h(gJ. f@g"4BBPBA<FC4hJ. g(4(. g . f4(. fp*aJfzJhk. . J. gE h. N=F faaxۮ ۮ `Dn ~Sn ~J. g p aNBn Jn ~fXJ gaP(n -L 0. =@ H`J. gJ. gtaB fBn jzaJ. f . -@ -n z n $}gaSJaJNuDeep and crisp and, J. g*H瀀E taQp aNT. aNLTn LNuQ 4. J. fn aH (n UA 0<a| p< gfJ. f<\W ɰ<"fn ɰ<:fJ. g@< gJ. g2.$nn$xn$jl&aMRn `4. n RB n a`L0NuP :fp/ara/ac . faaNZr`f . f*abBNzJ. g E f$$aۮ ۮ `8Jg& f n >x8SDp. a2Q`aa. aa nl!zgt _NuP :fp/a. °<W ´. ga B z nl!zgzNua`6|kAC xangZRQa J. gtJ. gn nl!zfta_=@ xJ. gTJ. jN n ~fFJ. gtaG f6`& Bz aFG f& Bza6G fBBB[z a&. Nu nl!zf`_dNup-`P :fp/ara_F-@ -@ -@ |lfa_0-@ zNuP :afp/arJ. gtaN . zJg R-@ zJ. gH(n Uap<~ . zanL@J. g p[aJE ztaQp]aJTn a^. aѮ zNu:fp/a@r<<V$O͵eDn ~/. /. HN{XL-_ -_ Dn ~B P Nu:fp/arJ. fJ. f,a. NuJ. gBB. ZB. Nup*aNuk::.fp/ar . fJgJ. gJ. faB`TaF`F . f,?a Nu0 . g@|> Nu . f @|> Nu . gj<Nu j<Nu:fp/aragp.aX@`:hfp/araJ. fJ. fa. NuJ. ga|. Nuk:&fp/ar` . f |> Nu . f2J g:fp/adra`4:fp/aNra`:fp/a8ra`J. fP:fp/ar4FZBBaJ. f. ZB. Nuagp.aX@. Nu:^fp/ar . f S gp.a`kj:5fp/ar . a U . g 6@f:4NugHH°f(Nu/ Ea $_< Nu0<`` 0<_`0<[Sn Բ<fzNuzNuJ. f4BB. ZBJ. f:fp/ar`:fp/ar` F . a|4`:lfp/ara`k:Pfp/ar` . f-n p-@ G a0<|> Nuk:fp/araP`P . f 0<s|> Nu . f 0<t|> Nu:fp/aHr<fa` . f2J g:fp/ara`:fp/ara`:|fp/arax`:ffp/araa. Nuk@:Hfp/ar . a  a ,4. Nu0<}` 0<|`0<yzNuk:fp/apr` . f 0<|> Nu:fp/aJrJ. g J. gH` J. f@a. Nu. `ڌ. `:fp/a ra@. Nu:rfp/a r`:`fp/a ra`:Qfp/a r`:8fp/a r. . a ,4Nuk< . jv . j: fp/a nr . fp*a ^` . f Jfp/a J|G a0>|G a$4F^B8JBG<jrfrYANu . g"J. fp*a : fp/a r<<@` . gp*a : cfp/a ra F< NuBBBNuG `G ` G ` G `+ +<kgj<gj<n/ E a v$_<g@`:< j < k0g6g< kg8` . g.a ,`( . f$`a ,4`a @4` a *4+4t+B+BNu . a . k$Nu4Nu: fp/a Nr`kp: fp/a 8r<f . g . ff . 4` . gN . . g4`x4pXZdQ4` . g" . g . o . n 0<|> Nu: 2fp/a r<fJ. fJ. ga<. . 4NuJ. fa2. . 4Nu: fp/a Lr . a` Bn pn p` Bn pn p4. pBBNu: fp/a ra`: fp/a ra`: tfp/a r`0: \fp/a raF` 751`6: 6fp/a rB. Nu: "fp/a ra . a=@ h2Nu: fp/a nr. Nu: fp/a Zr`40<Nu0<Nu: fp/a JBn B n Q ` F;j*J fP -L P ad ~ . ab`pI` J f-L FJgNu`p@f(fa rNu<kR. ra&_'A| . f|r A||`0@|@gC x`<JFk@|Jg|@k8razfl<f^Aa\|rAA`8|gd|lg\|rgT|df<|Zf| |||` raf|||F`Ua`r||`r||A|`|!jN|kFF / 2"g )(fSS`" Id" IdR<|Zf| |||`L|@kF|k,F|Pj |(kF(<m||F|Ja|fgl|lf<kBAaf0k|ffƲ<g <gr:.fp/arSF + fR+`+R++`r+`j$_?Z XJf|(" Id2`¼|;k2`a`2Ƽ|*g*| k |,kf|g22`|"k2Nu"f, NdNuE ֳf p'@`2P / I HpaOL'@(_`F|jp/aB+z <wgR+<g z <f||E`rxQ p2|xfP p`&||g UHDJDgJp@|HD'D`4<ra@f2<j*~HDRDHDJ. pgfkRQQ p2`?F|@f8<FJk2I` |dp/a<Pd<(k(J_?<Nu<<NuH$g EtaL$Nu/ Eta$_NuJ. g/ Eta$_aBn n |. NuH pg$< gJ. g2.$nn$xn$jl a8Rn `LNuERROR: WARNING: Privileged instruction Odd-byte address Absolute reference Null branch Tn a@0<:ka86Nu<gj$$g$Ff*Nu$HBJBgFBfNuHH°fNu4H°fNup.aBNuJ.g H`aLaJ. gE f4<gj`$a ۮ ۮ NuJ. g0E f&S0. U@n fp a7Bn tanpaQJ. g&HHn f/?. x?<@NA JkadLNuJ. fNuE f"n &SQNuA; EHNun k*g(n S/J. g0.$x n$jl p a6Q Nu$n >B4UBWf +g -f <,<Nu<NuWLDHMFC_H J. gl??. a .! g8Jn g p a6|Bn Eta|! n $Harp a6VBn 4J. ga6J. f4J f-L =B LpNu.n FNu 7aJaKaB0Cd (:gBH?<NATJk_A@d|:eBgHnf?<GNAPJk_|LJf|\f !\fR$IAf*.*BLNu-_ p?<NATJk_2?R@?Hn ?<GNAPJk_A Jf|\BA p'?Q/. pNu-_ pA!&p'1Q?<NAXHn ?<;NA\Jk^/. pNuaIXa$O͵@e^/ L 6H`2II(t"l@-L 6-I :XL/. bB b?.!z?. P/. RBn P/. LA$,r ?Q |W-H L?.=@a,/.!vRna:Sn-_!v=_A$Bp 1Q-_ L-_ R=_ P=_!z-_ bLH 6(_Nu-O!v`݀aHa0H N LL0NuaHpaA@JPfp~Nup~NuSk nNup3`٤aH>a n >C&@p0CQ0Dn ~/ . /. /. ?/ N *_0aV0/ N L*_0-_ -_ _ Dn ~(_P B zNup4`a7`a7`aGba6=@$a6NuHy`Hy`Hy`Hypa Sk?a6 oNa60QXNu<k|rg|Bg|gUaFNu=F!zNu<kJ.f$O͵,e|FbA`jNa`޼|Gg|Gg|Ge|GbFNA!|Hp``zp#`p2`pH`<k=F!zNuT=|r!zNu=|r!zNu"D"b\%J%*~|zxtrp48xj8Ftb^\? :pV|RNLPpFLB|<\|>)2:>;x"># B[8888888"9~9D9j99:,;f;x;~;;;;;B>H77Rzxvtrpnljhfdb`^\ZXVT\P]2]DJ^_ DB_D__:86[`0.ab>jj&j."=>R>b>v=@ >x >j6 bXbzj dFdriijkkTkkleRdrggJ7Dv lVlzlm.mn no,opoopqq@q]>Vr99:rzsHJHFtFtttvvvFvvv0wxw|xHx&$zyyz gh8Tb~ >,>@?"?6?@@>?z<tV@Z@@f@@@AA0AdAB &<k|pfaC _ NuHn z`<k|pfaB=@!NuNRNNARpra`HaB@@?a4aB@??<NN\NuaB@?Bg?<NN\~Nup`0. JaQ.n B(n 6`<kaSH<k|pfaC$L@`RPps`Әp`Ӓ<k|pfaB(ab"9at-@!Nu<k|g|f`t<k|gb|f`Pp ` aAa- nl!zgNu<k|pflaA-@ -@ NuaRH<k|lfaAЁa+ L@BGaQtNup%`Һp&`Ҵp'`Ү<k|mؼ| b2;`HtX L0T@fvHpaALRCXR/H0aOi/ nl!zg nf!zfL"L(HaRg(I ЂЁ/ a+,$_$LB00@f00@"H`#QR`BXQ<k|lgB=F!zNua@|H //L?!|D!,_N,_@!H?!|L0Nu=\!zNua@HH@J@fH@|eaOz/ (n 6NX(_Nup9`zaQrH(n b f (n 6a`<|lg|Lg>|fTaa@|lg|fU-L bL@aO<k|lg=F!zNuT` g/ (@aXY-L b(_` AT<k|rg.|Bg(|g"a*E0DP/ (IaY-L b(_`U"n 6X `<k|Lg@|g|`la`T<j(f`X<k|Lg |`la`TNup<`Xa>`PpA`Ja?/ ?.!z(n > N9J@kr2$O͵e&OBgBgUA?0JAf(O/ a<.!z|rg|fӤ.W=_!z(_Nu<k|g|g|8fӂ`<k|g|g|8g|:f``pq`Ϧa>F/?< NN\NuBga>4?a0`a>*?@?<#NN\Nua>/a0Da> _a Fa \Nua= @a 4pa HBGNu?<?<NAXJkSD`Z<kaO,Ha/<kaOLGf=FE`N$"4`002`  "`L !iH`gg`f`f`(n 0. `Ζp>0.!Nup>0.!Nu<k|pfa==@!Nu/.$A-H$`B:.!BD<k|rg|g|Bg|g|lg|tg| gּ|"g|$gUH a=|L0|ga26@kg?0< SCa'Q02p n >`a'Q<.!z`l=F!z0< a' g-@$Nux`LJn!g>r2.!g4!HADAg(n!0< `a'jQ`<k|rg|g|BgBDBE`=F!z`0< a'4`H a;2L00< `a'Q`H a;L0|lg$|ff|2n!gd?0< a&2`?H a;|L0|ffL20a,R`nH JDf.|ga;" n >a{ n >pR@JfL0Nu n >aw`a;.aL0Nu.$}?P$}a*Bn#aQ,.ga@< gJ<g*<cְ<g2.#|ga&$A!Rn#`Jn#g0<a&Sn#`a%2.#A!B0a*0@$}Nu<kzx|f<k|*g| g|"g6|$g|lg|tgؼ|rg^|gV|BgNH aKL0f|fg0<?a%^HaLpxp"n >E!g Rf`N| g<"gRg <,g`x`,( E!Ƙ`"Rg<"g` "ggز<,f`~H |b Ha L@aIL0`pga$`0 @x`0< a$`a9820< `a$Q`a9(|lg$|ff2n!gd?0< a$V2`?a8|ff20a)`=F!zNu<k|FbA`NNм|Gg$|Gg&|Ge*|Gb$FNA!| 0`BGNu . zBGNup0.!BGNup8`p`(.4`xLdRj6**~|.tr.nhjhfdb`^\Z 8TRPNHDB><2<BNZfr~" M@MXMj.&.*...2.B.F.J.N.R.V.Z.^M>MT. ..T~|NxNvO.rpOPQ"QJQHdb`MvMMN0RSS|PNLJH0DB@><:86Dt.,*(&$(bF LL TjU U .6UUxUVV`V\]]axabcc~|cxvtrpef2f8hfdb`^\ZXVipRPNLkxkFDB@><:862fr|(&$" m^j  ,X|6d@*2l3f  N NNaJ$`DaH`DzaGJ`DaI`DaH`DzaG4`DxaI`DpaI`DhaH`D`zaG`DVaIR`DNaH$`DFzaG`Dp0. Jg S@fp`2 gRn JD@~NuT ~NuTp>0Nu an~NuLan~Nua5|ffNup`|a4F~Nua6JGg|g|f4ANuBNuDNu`a& 9a8Ю!BGNu . BGNuA$ BGNuH/B?< NA\,_-@#L?NuH/.#?< NA\OLNuaa3BGNu BGNua3FN~Nua38N~Nua3*N<~Nua3N~Nua3N~NuaXJGg|f N ~Nu|f30N ~Nua2N *~Nua2N :~NuN \~Nua2N v~Nua2N n~Nua2N ~Nua2N ~Nua2vNt~Nua2N~Nua2 n >p~Nup>0. VNu0. Va"n >p0. J`WD@n JS@~NuaC ~Nua2> n >CrfQ0p~NuB1 Q > ~Nua2a$0|g>?a2,Ha2a$",L>a2.C "$$n >Np0~.WNua2 a1a#a2C"/ W (P$n >N.W.Wp0~Nua1a#a1a1ta#$a1c ~Nua1|~Jg 0 n >NupNua1ja#ra1a18a#r$a1.c., n >"H`Q ~Nup~Nua1(a#0a1Pa0JgS@|fg<|lf/a0a#&$a1Teb , n >"H`Q~Nu$a1.e`pA`a0/ (n > =| N9J@kr2$O͵eņ&OUA?0JAf(O/ a14.W(_Nu?<NNTHBGNua0NuaNJGg"|g|f02N~NuN&~NuNGNua0,N&~Nua0N~Nua0N~Nua0N~Nua/N~Nua/zN~Nua/N ~Nua/N ~Nua/N ~Nua/N ~NuN f~Nua/N ~Nu<k|dg UN ~Nua/:|ffN GNuaF|g|gJGf/*NuN l~NuN ~Nua/.N ~Nua/ N~Nua/N$~Nua|g|gJGf.Nua{~Nua{~NuaȾ|g|gJGf.JjDNuNuNua|g2|gJGf.Jgjp~Nup~Nup>Nufg`fg`aT|ga- n >an  >~Nu n >aj  >~Nua./ (n >B4< g<+gD<-g4a(_Nu< g<.g <9b<0e alGNu~pNua(_`a(_Nua-?aa-|ff`2gtJ@gn4HBJBf:HHBn Jb:>SAgSA n >"H$n >ڳfQ  >~Nua-84 | b8r Bg `a-/|lgXt fSBf|ff n >`g1`0Q  >f n >0p~Nua,a-aa,~|lfa-a,.gSa-(|ffvJf.Wp~NuA"d."H&n >d$n >f/ggg _`X.Wp>Nu _S AR~.WNua+Ha`a+|ff$& .$afl @"Aanx$& .%"afXan H#LanV$& .%af:amH#,.%BB#B#B#B#B#B#B#B#L#anRAL #amH#L#CamL #amH#Rd>L#NH#L#NH#L #amT$<vNpk-G% ~Nua*HaRa*|ff$& .$ae^ @"Aamj$& .%"aeJalH#NH#Lam<$& .%ae alH#NH#,.%B .%adH# .$adH#`<k|rg|fJlg\/ <kJ.f6|g"a<.!z|rg|fVJlgT\`a*"f(W`XNuaJ`p`a;x0k|pf|g|g"|g*p`Va`\O.a) W |fa)/@|g /|`a)/@|rg|fJlg\/L <kJ.f|g"a<.!z|rg|fJlg\`<kafa:¼|f <k$Og p:`$O Z "Ё Jkn `m(Z`O|lg =F!zNup`n _CgCgCgp;`Ja`dO.a(ac W n!zfa(H |g <r`a(vH|rg|fJlg\/L<kJ.f|g"a<.!z|rg|ftJlgr\`<kafa9|f<kf` WU abLaj0$&abD W L Jk auDg k`au:gj(o`fO<|lg=F!zNua`jO.a(ab: WH n!zfa'H|g <rt`a'H|rg|fJlg\/L<kJ.f|g"a<.!z|rg|f^Jlg\\`<kafa8|f<kf` WULaaLab8&(*aat WHLJ k atrg k`athgj(o``O <|lg=F!zNup"`a&|@fJgX<k|g|g|g`<k|Dg|g|g N|pg a߂<.!z|rgμ|g0|BfX L g (@=|!zNu<k|g |`la` =F!zNu L <k|gJg\(@<k|Dg(|gv|g ʼ|pg J|g|ga<.!z|rg|f=F!zNu<k|g|Bg|`la>` U=F!zNuX `Jlg\<k|g&|Bgaތ<.!z|rg|g`f L g(@`ad|f `p>`JlgD\Jg:(@ \gިX<k|gޚa.<.!z|rg|f Jlg\`aU `Bn#<k|g*|Bg0|g6|g |`la^`Jlg\`Jn#gSn#`Jn#gX`Nu<k|@g|gƼ|`la`X<k|ga`Rn#`C`Nrplfhjhfdb`^\ZXVTJHFDLD>@:0*06640.," NuPNu\NuTNuXNuXJf> GNu g (@=|r!zNuAal(I=|r!zNu gB/ (@<k|g,aܼ<.!z|rg|fJlg\`Cf(_`ATa/ E0DP(I`<k|g|gT|dgp`0a Nu/a$ _|ff|g a#a^XNu/ (n >B4B4a(_XNuXa Nu"n 6 i6gJQfp@`*, . C0Yf@fNu"F(G`"n 6 igJQfp$`ifPINu<k|pg|vgUa"tJgdb|Dg||Ffb LI?a0S@g<k|lfA`0g /(I`z/ UA<k|rg|Bg|g|lf a`UE0DP / (@`8 LI?a0S@g<k|lfA`(I=|r!zNupt` <k|fBn P`$U-L R=| P`-L LNq<k|g |`la`=F!zNu|bG` JSNu<Nua`./ /a gGCpNHN0HNYO/NLHN&_`&_L>GCpN N0N NHN&_GCpN "/BgNaQB/?<NaQH?<N. aV$G?<N&_N_FC`N8<HTXdpr~ N aPacNLaQDacN 0N aPac`0NLaQ ac|0N N aPac> NLaPacZ N aXaPb N NLaPaWaPJ N aQaPHN aP`aQaPrHNLHN. ,/1Fpc dЁ/a$$H _ 1@C._`Q$GNB$bNuJ$bg\C$b QCrtvg.e6"H(( DfJg8 A"BeE#J$%hNu#h Nu(d"$ &`"b MNup`zE$bJgN"RE&Iѱg $I")"Af` %i IАE$bJg""RE&Hg $I")"Af`Б%i"Hf*HNu!n$b-H$b Nu/.$NuHa | mRn!J.$|gaJ.$~fd|g0.$nn$xn$joaa0/|m@=@ Bn =| 0.$nn$f=@ 0.$pn$h=@ pN.raaaLNuJ.$~f| g| fBn!aJ.$~g|V$~|f@AN2LR@6&2.$pa`vL$nn$xn$jm(B@n$z4n$zn$lmn$zH$nBD:.$zDE`"H$nNuJ.$|gaNu|W$|`A-H$B.$|B.$}B.$~=|$LH$faPBn$r=|$t=| pN.rBn =| p'N.rBn p.N.rpaJnfaaNuaH =| pEN.r?<NNT-@$?<NNT<f2<4<6<`&<f2<4<6<`2<@4<6<=A$=B$=C$I=A$Bn$B$Bn$Nu<.$rL$fHaL?a~A$-H -H =| H H JDk"n n >?A?@?Coo`n n >?A?B?CWWJEk$n n ?@?A ?B ?Aoo`"n n ?@?C ?B ?Co o p1N.rL@m Am8/adL@mAmaTaNua=@ Bn p N.r-n$xaNua `a`avL$f8.$ra anB$nNuaPH?=| p N.r=| pN.r=_ pN.rBn p,N.rLH p6N.rNu@SBASCNup?N.rNu=| p>N.rNuJ.$}gHp%N.r?.=n$ pN.r=| pN.rBn p,N.r=| p N.r .$nЮ$f"Ү$xH p6N.r=_ p N.rLNu|W$}`J.$}fP$}afNuJ.$}gaZQ$}NuL$nn$xj4.$jH„$xSB$x0aBH$nn$fn$hL $x8.$ra`ta`la8`da:`\a`T2.$pn$zj:.$zBDa$L$nNu=A$pNuL$n`L$nn$xj4.$jH„$xSB$x0=B$naH$nNua$x$z=@$n=A$p`?<?<NAX`-n$$A -H$`/=@$A -H$ _NuH-n$$20.$aLNuP$~`-n$$A -H$`zJ.$|ga-n$$NuRn!İ| fBn!H| fa 0< aLNu>G?n$=@ =_ =_ =_ p6N.j`arHa@afHa4aZHa(aNHpON1p0.BGL@ap0.BGL@a0.n$HBGL@a0.n$HBGL@a`$]a n$f>aa n$h?@aa z?@aa n6LaH =| pEN.r]a Jn$>ara E S@k4n$44n$4Q0N.j`aP=@ pN.jNua>Bn =@ pN.jNua(=@ pN.jNua/><?a/Qa` =@ LGH -_ L=@ S@k r4QBRNuaj=@ pN.jNuaX=@ Bn p N.jNuaB=@ p.N.jNua0=@ pN.jNua|lgBn =@ p'N.jNu?a=@ 0`a=@ p N.jNua=@ p9N.j?.pGN.j0._BGNuNan$?aan$?aa?aa?aa?aa=_ =_ =_ =_ =_ Bn E aTn =| =| p N.jNNa4n$?a\a&n$=@ =_ =| Bn 0<N.jNNa/a"a?aa?aa?aa?aa/aa?aa?aa?aa?aa=@ =_ =_ >=G <=F -_ 6:4820@ASBSCH FGSDSEH0 -_ p=N.jNa`aV|fNuJGgA|gA`2aaJNup`da(`aJGfNu|gM|gLp`>a`a|fNua`a|fNuJGg;b|f$rNu"PgR$O͵e$_"O O "n >`QN$_ O.X 2"n >`QNҼ|~b:E\e:;PNuzNuaH<k|~b:E\ea`=F!zNu|~b:E\eEGEAPN h b ` tnlJ VJ L J F J (< 2 . | | 0 2 taZ/at<ka|b aB"~Nua.`a0/aJ<ka|b a~Nua`a/a"<ka|b a~Nua`/a<kap|bJGfVHH~Nua`޾|g |g"p` @"A a?\$& aJVHH~Nu @"A$B a9$&( * aJVHH~NuHaĂ<ka|b|gaL aJzVHH~Nua,`&(*L$raJVHH~NuHa.<ka|ba4L8aJvVHH~Nua`/a<kap|bJGf\HH~Nua`޾|g |g(p` @"A a>\$& aIgkp>Nup~Nu @"A$B a8&( * aIgk`Haz<ka|b|gaL aIrgj`a"`&(*L$raIgk`|Ha"<ka|ba(L8aIjg\jX`Na`/a<kab|bJGf^HH~Nua`޾|g |g$p` @"A a=N$& aHgk` @"A$B a7&( * aHgk`Hap<ka|b|gaL aHhgj`a`&(*L$raHgzk|`rHa<ka|baL8aH`gLjN`Da`/a<kaX|bJGfWHH~Nua`޾|g |g"p` @"A a$& Ca8|<~Nu @"A$B ?a2&( * Ea1|<~NuHab<kaԺ|b|gaL ?Aa8&<~Nua `&(*L?a1Ea1$<~NuHa <ka||baL8B?a0<~Nua`/a<kaJ|bJGf"aCGNua`޾|g|g"pNS @"A ?a72$& a7<~Nu @"A$B ?a0&( * a1@<~NuHa^<kaк|b|gaL ?a7<~Nua `&(*L?a0a0<~NuHa<ka|baL8?a0<~Nua`a6Ha<kaL|b|ganL ?a7r<~Nua` @"A$BL?a0&(* " $ a0<~NuHa~<ka|baL8?a0<~Nua0`a5HaJ<ka|bF|g*|gJGf *La7\~NuL?a7<<~Nu _"|$_?a7<~Nua`Ha<kaZ|b*JGgaL?a7X<~Nu&L?a7^<~Nua`a/a<ka|ban"Jg ~NuaT`aV/ap<ka|ba>"Jg ~Nua$`pNSa/a8<ka|b a"aAJNua`a/a<ka|ba"aA <g Nup>Nua`aa<kaJ|bJ|f O.X"$ԀHBJBfhHBn Jb^4"n >$I`!Q4"n >`QЁNuaT`aar<ka|b|fRaJVHH~Nua"`ava@<ka|b|f aSHH~Nua`aDa<ka|b|faUHH~Nua`aa<kaN|b|faWHH~Nua`aa<ka|b|faTHH~NuaZ`aax<ka|b|fXaPRHH~Nua(`4&HCHCJCf((HDHDJDfH@J@gHAJAf"҃e ҄e<Nu<Nu$_a.WN&_ n >C"/gJgfSAgS@f`S@@NH@B@H@=@ J*n > 0 @ Bd0<9A'@C$BBQNuFC`N(.44Lp NS~ `*~L`*pBGNu0HBGNu BGNup0(2 P"n >`Q~Nup0. J"n >W|gn JD@~Nup NSFGCpN8:<>HPV\bhpv|Nu0Nu Nua1`a) Nua+:a)HNua`QNu1G$n >"P`QNu"n >`QBNu<kzgz|bC`NpNSj$>4~|zxtrpnl"&LB@@E&< g$@A0\f@fNu(K`pNu|`|`|` |`|`| g" @0@f0k|`g|gULNuCaf"`JEgJn ~j^p1a Q |B pA p`;`NHHIpT2AfЇH`aצLI$B00@f""H`BQ`rpNSa|0k|`g:|gVULNuaҁ|0k|`g|g4ULNua|0k|`g|gULNua`|0k|`g԰|gULNua>|0k|`g|gULNua|0k|`g|gULNu gh @0@f4|gB1H?<v=`B?<`?<al"n >B16H?Hn((?<NA\Bg/. >?<NNAPv=J@gv?NAPHBGLpNuaa |lgNu??<>NAXJkPNuaa`?<?|pfa/?<BNA Jk Nua?<?/<?<BNA JkBGNua?<?B?<BNA*?|B>BNAW/E>BNA Jk HHBGNua:?<?B?<BNA*?|B>BNA,/E>BNA Jkr BGNuHn p/<a?aa@ p?<@NA Jk>NuHn p/<a??<?NA Jkp. pBGNua0/ ?<9NA\J@kNua/ ?<:NA\gJ@kNua"n >n Jd>B1NuaxC $n >S@kQB/. >Hn((?<NA\C ?</ ?<NNAPJkh$_"J > Jl\C(F.(=g * `  J fSg f / ?<ONATJj|f"  >~NupNSC *.*BaL"n >2SAk paQ`?<NATJk"n >A:?</ ?<GNAPJk"n >Jf|\ >~Nu<k|pfaB?"n >S@k$ :Wg"n >`)H@A??<NAX0"n >B1/ ?<;NA\Jk@Nu?<NATHBGNu<k|pf~a??<NAXNuaR?Hn((?<6NAP .(4(2(*BGNua n >B0RaHoaלa n >B0"_/. >/ Bg?<VNA JkaNua/ ?<ANA\gJkNu/ <kar&_H/ a4<ka^&_H/ a aF&_H/ (Kaaa.a"n >E -J|dS@kQBa6"n >B1-I/ pZN1*_(_0.D@HJnfpBGL@a"n >Jf >SL@.aC $n >f >S G~aTaL@~aF`aPaB/ ?<CNA JkBGNua.a|pfaTa>az"n >B1??</. >?<CNA JkNAXJkzNua??<ENAXJkdNuBgaa?a?@?<FNA\Jk@NuaBgaHoaa.Bga BBHzFHo/aa?aaH@?<KNAL@BGaaJ_aJ_`a\??< NMXBGNu?< NMTBGNua8/ n >X@| o@ J@fp a: ah ar X@| lA`PM  > ~Nua/ n >a a" a, > ~NuX@a$:NuH@?a:Nu@@aNu4H 20 A0Nuaj/ n >a@ aH aR  > ~NuaD/ n >a( a a,  > ~Nu@a/NuH@a/NuX@@BGaa bNu?<,NATBGNu<k|pfa??<-NAXJk4Nu?<*NATBGNu<k|pftaߪ??<+NAXJkNuaߔ?aaa0@/a,C>N nl!zg0Nu8@//<`//<`//<??<@NA JkNu//<`?aްn Jg"n >B1 n!zfaU>-@ pHn r/<??<@NAJkD /. >/. p`/Jf/`a޶?aaH>/E p0@CNL@aa|lg0Nu2Vxv/ /<??<?NA Jkp. pBGNu/ /<??<?NA Jkp0. pBGNu/ /<??<?NA Jkt . pBGNu/ /<??<?NA JkP . pa2~Nu/ /<??<?NA Jk( . p". ta`~NuHn p/<??<?NAJk p0. pn Jd\"n >B1/ /??<?NAJk "n >Jf >S ~Nu|"n >/ J-I p/<??<?NAJk"oJg  e`Jg pg/I` > S~Nup//a?aa/@a a/@?<?NA Jk*Nup//aܲ?aaܨ/@aaܜ/@?<@NA JkNua܀?aάaP|g(|f n >a > `a& n >a > >|g$H /. >/??<@NA JkL0` n >.Spa`Q><.!z|g |rg|Bg|lg| g|tg`p a.TNuUp a$`Rp a"LaF|rg|g(I`2|f@`H @ pHn p/<??<@NA JkL0Nup NSad?a͐aH>/|aL@|lBH (n >Bn p<-fFn p`<.g <0m<9na@L0~Jn pgaL@aaz|lgTNuBn(T=|(VNuJn(Tj=|pkN1Jn(Vk BnpkN1=|(VBn(TNua8 INJ@g|gNW@NWLNuRn(Tfp`Sn(T n(Tfp=@pkN1`Rn(Vfp`Sn(V n(VfB@`aaH?aba0?a\a&?aRatHaBahHa6a\Ha*aPHL=_=_=_HpN10.HL@BGa0.HL@BGa0.HL@BGa0.HL@BGa0.HL@BGa` aـaˮ/av-@ WCp2QpN1 _ Cp0QNup~Nup3NSa0p~Nu0.H~Nua"J@k=@pfN1Nua J@k?=@pgN10nf=|rAưpf1TA|fNuJfprNSNuaؼ?aaز|lf?aئ-@0` a-n@=@=_pN1Nuaz?aʦap|lf?ad-@0` a-n@=@=_p N1Nua8?ada.|lf?a"-@0` aH-n@=@=_p!N1Nua?a"a|lfa8a-@a\` a-n n >H@B@H@B0-H=_p"N1Nuaצ?aaל-@=_=|piN1Nua׀?aɬav-@=_=|piN1NuaZ?aɆaHavaHajaHa^aH=o =|phN10.H~L@a0.H~L@a0.H~L@a0.H~L@aTN{a?aaHaa HaaHaaH=o =|phN10.H~L@a0.H~L@ap0.H~L@a`0.H~L@aPTN{a6?aba,?aXa"?aNa?aDa=@=_=_=_=_=|piN1Nua?aa4Haa(HaaHaaH=o =|phN10.H~L@a0.H~L@a0.H~L@a~0.H~L@anTN{aT?aǀaHapaHadaHaXa~H=o =|phN10.H~L@a 0.H~L@a0.H~L@a0.H~L@aTN{a?aaԸ=@=|=_piN1NuaԖ=@=|phN10.H~Nua|?aƨar=@=| =_piN1NuaP=@=| phN10.H~Nu<k|pfa*=@=| piN1NupNS=| phN10.H~Nua?aa@Haa4Haa(HaaH=o =| phN10.H~L@a0.H~L@a0.H~L@a0.H~L@azTN{a`?aŌaHa|aHapaHadaH=o =| phN10.H~L@a0.H~L@a0.H~L@a0.H~L@aTN{=|a/aaҾ=@-_=|piN1NuaҢ?aaҘ=@=|=_piN1Nuav=@=|phN10.H~Nua\?aĈaR=@=|=_piN1Nua0=@=|phN10.H~Nua?aBa ?a8a?a.a?a$a|ff=@=_=_=_=_pdN1p>0.NuaѼ?aaѲ?aaѨ?aaў?aaє=@=_=_=_=_peN1NuHaanL@NupNSaaH炀azaaH炀ajaaH炀aZaaH炀aJa/aDa/a:a/a0a/ /4"/($/&/(/ */,/.NH~L@8a~ /L@,a~ /L@ a~ / L@a@NuaЈ/a´a~?aªat?a aj?a–a`?aŒaV?a‚aL=@=_=_=_=_=_-_p*N1NupNSa/aFa?aB0-Hp4N1Nu~?a~>?aQan=@=_=_=_=_=_=_=_=|p3N1Nu~?a6>?a`Qa&=@=_=_=_=_=_=_=_=|p3N1Nu a/aa?|lgBoBn oLHp3N1JogLH=|p3N1-oBn=|dB=n$=n$p*N1-o=Wp2N1 oLHJogLH=|p3N1=|p3N1Nu?|a?@a8a?@ a,a?@ a a?@`a/a a=@-_p2N1NuBg`?<aͶ?aaͬ?aa͢?aa͘=@=_=_=_=_p3N1Nuav/aal?aab?aaX?aaN?azaD?apa:?afa0=@=_=_=_=_=_=_Bn-_p/N1Nua-@p6N1Nua?aa?aa0a`H炀aa aPH炀=o=o / =@ =@pFN1L@~0.HaܚL@~0.Ha܈N{aj?aa`|ff4=@=_pjN1~0.HNu?<`Bga2?a^a݀aH炀aJapaH炀a:a`aH炀a*aPaH炀 =@ / =@ /=@ /$=@=o0=o2plN1L@~0.HaۺL@~0.HaۨL@~0.HaۖL@(~0.Haۄ4N{aܾaH炀aaܮaH炀axaF?ara-I|l  R`B1p N10.HBGNua/a|dԮE "n >"SkQBA NHNuaǨ/aȰ|d|E "n >"SkQBA NH"n >$I JSgg` > S~NuaVJ@kV|bN@A N BGNuDFLPV\bhntzpNS NNuANuA$NuANuA.NuATNuANuA{NuA8NuANuApNuA^NuAZNuANuANuANu nNu0nNuANuA Nu MNuA{NNuASNuAѶNuA'NuANuANuATNuA NuANupNSpNSpNSpNSp=NSpNSpNSpNSpNSJjzdRAHAfB NuJAkRj"g HBNuJj.dRdRB>GGBfABB ABBNurpNuJBk`p$g$4 BBANu&jDRBkRAk2gA lDAJjRJjD2aJk2NuE @"A$< LevaaaGNu&<ԚxK(<z`&<;)(<\za| mJjprtNua?aJk4NuG 4 @"A$Baa a aaa_NuaL8`aL8aL8`Jj4dRAB$RAk"gA lDAJjDJgJjSNupJjpNuJjdRdRBA&(RBk,g :SE؄׃QB lJDBJjDgJjSNupJjpNua$<[ةvUC`f.kJjTeRGH?a*,$<vaaEaJjRA4g @"ArpjD@H@aa`a&<[ة(<7(qzUE`t.k|JjvTeRGH?axH&<xzaxL8aG ~a0JjRB6g @"A$Btpr0jD@H@aa`2H?a @"A$BaHadRAB$RAk,gA lDA⨴fgJjRJjDNupNuJjdRdRBA&(RBkg :SE؄׃QB ljDBJffgJjRJjDNu|n$$<ڢv`j| n&NuafE~*,ada^ @"A`Aa`fafG8~H?ava @"A$B`Ba`aBRG`a:gaANug Ea @"A~ "aaQNu*,ETa$&`aRG`agaBNug&Ga @"A$B?<Laa0SWfTNuHGaL8`$k*j.BUH$B,$/7i+Z*SFe4K`+>Zu! sǵk}1ۏt=.p{?2 k( ` h&4^TmԳ1ne}I<" 6FŏŏLG`g0VGf͖tЮbⰏs=%mecV,57SF€f/-Z\*x*n{PIЋ e|! sLK:Nװ:i2)2}*)Қ ?N󈈈L?Ӿzp e%7Xx}  XÀp T%0 FF X)}/Հ ` ` vH;`[FF$;`Nu@P$ k(C@ԥ* _2ɿ/ k:#x !$'+.158;?BBBaJAfNuJAgfSANua< g<@f J@gRS@Nu<Xf `@<Nf `4<|fa`(<gθ<|faa`<CfJ@gBS@RBn Jb Nu<{fFJ@g(H@@ }gaz`J@gL`RSANuH }gaR`LRSANu<1eҸ<9bD 0e 9bSAE E` *f"RSABc8:g@DEDa^SDPQNu $fRSA`@ LfRSABcDa0SD QNu Rf,RSA:BcDaSDkPQSE PQNuH@@?aSWgL` Nu<(f )ga\`<Af J@gS@<ae<zb`<af J@gS@<Ae<Zbx `p<*f JBg``<BfVJBgSSBNuH"`H 2E)8BBBa|JAfBaLHBBBHBJk4EFgFA)8 SBf`8Hav(<<g&<xza"aRF>LxaaL0A)8BBaJAfNuaH< g<Dg(<Eg <.g<dg <Zg<zf<DRB|(bNu<^fPNu<|g<g"<|fa`<+fJj H a|LNu<-fJjNu<1eH<9b@D 0e 9bSAE E`H@@?a0SWgL` Nu<(f )ga `aN< g<Xgj<Ngn<|gr<BgB<Zg<.g<JFf>Ek$aQg 5eR 9c0`>A)8E)a 0gSRGNuJFfT0gJGkGg k S@fJEg0jD@Ec00S@f0GkgS@f0g"H !0f S@fNu0gS@f0gS@f"H0 !0f S@fD0jD@H|e0B@H@d|e0B@H@ |e0H@0DF 00`f  `RFfNuNPJ  Z^`Xm \ {ϐmӐܐ:rV8set_uprVBfblank_sheetr:X vrrVrangerrrD X\rrVE mouser(jrVGNcommandr quit%pr8r\Vset_upr4r¼swprshprll¼swlshrll¼swlshr8rdj@9*This software only works in medium resolution.r6rd`HrJ: r" lft*ST-Sheet Version 0.01rH rJ:`"lft*A simple spreadsheet capable of handling manyr"lft*complex mathematical functions.HrJ:r"l ft*This program was designed and coded, in Computer Concepts Fast BASIC, as partL"l ft*of a GCSE,(mature), Computer Studies project.Ll"l ft*In its current state this program and associated documents are Public Domain.lj"lft*There is no copyright and you may copy and distribute it freely. If howeverjh"lft*you find it useful you may send 5.00 to the address below. In return youh`"lft*will receive the latest version, with new commands and features.`b"lft*An additional 5.00 will get you a documented source code listing.bX" lft*Please specify Version Number when you request a listing.Xb"lft*Please send donations, suggestions and comments to ... Neil Smith,b\"(lft*42 Hayes Road, Bromley, Kent, BR2 9AA.rH rJ:\"lft*Press a key.trdummy%pBrJ:rsw2%p¼sw|rsh2%psh|&p!rllsw2%lsh2%r<lxrsw2%llsw2%lsh2%r< lrlsh2%lsw2%lsh2%րd<x lrsw2%lsh2%lsw2%lsh2%r<ld  ~cell( lfl enter$( lfl command$( lfrזdummy$p l* f~&p r&prcell(&l&fpxwer (enter$(&l&fpזdummy$r `command$(&l&fpזdummy$l quit%pr mx%pxr my%pxr autocalc%pr display%pr frm$p*s^ZZZD.DDr6rVblank_sheetrll¼swlshrll¼swlshrr8rH^&pr&n @C,"v&z lft&^2"lv&ft>d&vAf2  HrVrangera$p*[3][vxv*|Error at cell v>dmy%vAfvdmx%fv* | See User Guide ][ Oh dear! ]dummypa$lfrcell(mx%lmy%fpxwer enter$(mx%lmy%fp* r command$(mx%lmy%fp* r(prc$p*-1E-8r|Vmouser(l(l(l(r(th(nh(th(nl@| omx%p mx%r omy%p my%r mx%pdd(xf|<fr my%pdd(|fxfr omx%j mx%f omy%j my%@G*΀Xr"lft>dAv my%ft mx%t* trXr display%p@G" enter$(mx%lmy%fl2ft* trrVcommandrllblr8r& "c$rll¼swlshrRH4G "c$lfrTG*=rVHexpressionjTH*'rVwordsrrVNinstructionrr autocalc%p@Hj*V_\recalcrVTreprintr*:r(l(l(l(r(pr:Vexpressionr "c$p "c$ld "c$fxfrd$p "c$r (enter$( mx%l my%fp "c$rr,flag%p&pd "c$frd "c$l&lfft@hd "c$l&lffn\h "c$l&vlfr*0h "c$l&vlfl*9@Khd$pc$l&xfrd$pd$v*(cell(vc$l&vlfv*,vddc$l&lffxAfv*))rd$pd$vc$ldc$fxd&vffflag%pr   "c$pd$r,flag%pr `command$( mx%l my%fp "c$rcell( mx%l my%fpd "c$frcell( mx%l my%fpxwe@Lހ command$(mx%lmy%fp* r enter$(mx%lmy%fp* rcell(mx%lmy%fpxwevBrVQprintdcell( mx%l my%fl frm$fl mx%l my%frrvVwordsrc$pc$ldc$fxfr enter$(mx%lmy%fpc$l fr command$(mx%lmy%fpc$l frcell(mx%lmy%fpxwe>Vprintdc$lmx%lmy%fr>VinstructionrRQrN "c$lfrTO^*RErROVO "c$lfrTO.*Nr autocalc%prT*Fr autocalc%pr€pTPh*BLrc$lfr*Ahc$lfl*Z@Vhorblankp`c$lfr*0hc$lfl*9@Vverblank`:autocalc%p@Vreprint:`TP*SArVVsaverTP*LOrVY:loadrTP*QUrV\jquit`TQP*DIrRc$lfrT*Nrdisplay%prT*Frdisplay%pr.T*FOrV]formatrr.VprintdJi$lxpos%l|ypos%fr&pdvxpos%z fzr&pdv|ypos%fzr&xl&l7lr8rHlXr"lftJi$l ftrHrll¼swlshrlLVhorblankrhor%pdc$lffxAL&p rcell(&lhor%fpxwer enter$(&lhor%fp* r command$(&lhor%fp*    FVverblankrver%pdc$lffF&prcell(ver%l&fpxwer enter$(ver%l&fp* r command$(ver%l&fp*    RVreprintr4r&pr&p R6cell(&l&fpxwe@Up6@VQprintd (enter$(&l&fl&l&f@BUNVQprintdcell(&l&fl frm$fl&l&fN  l6rVsaver >mypath$pv**.DATr Zmyfile$p*rT2lllr >mypath$l Zmyfile$l nstatusrV2ll& nstatusp@&PW4 >mypath$lfj*\r >mypath$p >mypath$ld >mypath$fxfrr temp$prp >mypath$r&pd Zmyfile$f buttonpr&tx@Wbuttonp*[3][File already exists.][ Continue | Cancel ]lf0&r buttonp@0V&pd Zmyfile$fr&p r&pVh&lcell(&l&fl (enter$(&l&fl `command$(&l&fhl,&rrp temp$rr,Vloadr >mypath$pv**.DATr Zmyfile$p*rT2lllr >mypath$l Zmyfile$l nstatusrV2ll& nstatusp@&PZl >mypath$lfj*\r >mypath$p >mypath$ld >mypath$fxfrr temp$prp >mypath$&pd Zmyfile$fr buttonpr&n@[ buttonp*[3][File doesn't exist.][ OK ]lf0&r buttonp@0&pd Zmyfile$fr&p r&pr&lcell(&l&fl (enter$(&l&fl `command$(&l&fl<&rVTreprintrrp temp$rr<Vquitrprrtdr*[2][ Are you sure ][ Yes | No ]lfp@ quit%p" autocalc%pr"lVformatr "c$p "c$lfr,flag%pxr&pl "c$l&lfj*.h "c$l&lfj*Zh "c$l&lfj*D@]flag%pV "c$l&lfp*.@^R,flag%p,flag%vV  &,flag%l@&\frm$p*s^vc$rautocalc%p@Vreprint\dB_:rdummyp*[3][Incorrect format | See User Guide ][ OK ]lfrrrdZVrecalcrrx%p rry%pZcell(rx%lry%fjxwe@`4cell(rx%lry%fpd `command$(rx%lry%ffl  ,PROG1.BSCPROG2.BSCPROG3.BSCPROG4.BSCPROG5.BSCPROG6.BSCPROG7.BSCPROG8.BSCPROG9.BSCPROG10.BSC<<<<<<<<<<A:\*.BSCab Hz/:NuH z0(2(@g4"P&1::g*g2g:ftgl`2g\`NgL`g<`.E\@f#`@Y@j0(Y@1@`,E0Y@j0(Y@XBhmBBhf1@LNu,X.6H*2( 6^VjTzVb&$N Hf($*  n| 60X2 `\V"8"&Z,NNN  $ L& " V ,>v" 2^nP ZV 4n  $ rT*0 0D>L  " >: RR8N".$B.d Dbn^jX2 8*  v2`ll|:D.D&|"(8BBBP&&LHJHNLHJH$., THJH*&.ZR PFHH@ (0\HxT0&TDL R$6.* $`I&` F 4 ST-SheetMJy f2*O*m-M - ЭЭ// Bg?<JNAO JkO a0a.A=X=P=| N6Jf`BnBnBNaa p N1JngAV-H=n0<#N1a>"< <NJg-H<-H@aNN/N/a/N.zLNuH0<?N.zLNuB@=@AD-HpNN1Nu0<`0<`H=n =|A-Hp!N1LNuA$ k"X"`Nu=|BnphN1LHH=|p3N1Nu=|A-HpN1NuJngA-HpN1 n(fpaa0. |g |ga>Jnf`&AL @!@!@C!I!I-I-I"Bh Bh"=h$B,B0B:BNu n,n^A@Rh0<(AQAh AhA@ShAPUhAPhQhAThZh*PhBNuH2IA!2I naL?NuH=@R2IA-p na,L?NuH0.RA pa0.RaLNuI8.L(t@0,$AaNu?:MGNI&K&PPJ4Pg RR`TTR| m.BDCJQgBQ:MG7PRDTT| m8.RL0.Ra0.RAH1NuBngPa=@HA1aJf -nv`H0.aaJf6 nv .r".za28.LGH/3@?<INA\L'v@0.2IK;aa@nRf-nv0.Ra 0.a a .BnNung` Nua>N^JgH?<NNT/?NAXJzfBra .r".z nvNua$Jg?AQ-H=|p4N10NuH@P nv"CXf"(fBLNu=@B.Ad-HCB<.:<PQA-HpZN1JngaJf&=|Aj-Hp4N1 nf`t0.a a8Jfb nv .r".za8.LGH/3@?<INA\L'v@0.2IK;-nv nv0.Ra0.0.Nu=n =|phN1Lnbf=|phN1LHH=|/=|plN1LHLH=n =|piN1NuLaB8.HĈDl4B8.nLDl68Bno0.B8Cnno 2.CnNuaL aaBn=|-LHplN1-n-n=n=|piN1LH$H$fNrL$NJ`,Ha(?A?C26/:/>/ a>?CLNuAnEG0C@n2E6@n6NuvNu=n=| piN1Nuaa=n=| phN1JngJngLL aZJBgdJCg^JgNH@0HB4Ԁ-@ -B -@ -B A-H A-H =| 0<1N.z` BDN0=n=| `ba`H=|=|)HplN1-n-nnnLNuBn=|phN1-n-nLB(C KCJBP@CTAUACCB@axNu=|--n-npdN1=nNunnBn=|--n-nplN1-n-n=npeN1Nu=npfN1=npgN1NuA-H=n=|piN1Nu Output Id?<NATA:Bg/ ?<GNAPJfS\*.BSCBNuAdC0<BAA|mRRQNuLBDN0IAN"<SAf"O /NuNPJ  !z!n!n"1n$NuJng"a$p=@RaAL-H-Ha`J/<?<HNA\Jg-@-@"-A" @@2<CSAf-H @aj></<?<HNA\JgJE%p-@"-A" @@2<CHSAf-H @aXG|(mB@Nu<NuJf.-n-n-n B/<?<HNA\-@-@Nu nJg2< BAfNuI8< H/?<INA\LSDfNuJg/.?<INA\NuH~T.,/?<HNA\JfnB` @ L~NuH?<NNT-@?<NNT|f=|=|=| `2|f=|=|=| `=|@=|=| 0.H=@LNuHA-H -H =| JDjD`D@ASBSCJDjH DDH `H DDH 0<1N.zLNu  02 46@ N f ~   {  "$&,. &%x7'6&H(8*G,.467YIXH@jXZZi\^dfY { k z   j p |   { &Z-H\JgB@BABBJg6 [fRAR@ ]fSA |fRB|g |fPNu|nJAfJ@g|nJf/< ?<HNA\JfpNu-@ n0<r:< n^n:<1A!|1|1EBB BBhRAQ nC0|g 21`0<1|. nn 0< 1| .1n1n,1n1n!n2<F4<1Q"n\ n-H"n\$n [g JfPNuRJfPNu ]g`B%nD-H$n`&nBG [g Jf`` nR ]g$ \g |g`B%n `B<F '`G-H ]f`AR"n#H\A[#HT"n80<a><0<?a>Q"nH0<$i gBAJgPA`3AQ"n$IHB@2<i3@5@Q nh1@D1hL41h$ 1h1hT<1h1hl1h  1h 0<"n a><"n0<?a>Q"n0)bh24<@3AQ"nH0<J f Q n4<2.A0(h@l 6h1CQ nh0<BhQ-n=|pN1B@Nu$I8< n^l8<BEJ g5EDQ3ENuBB$I2BC&i gBDJgPD`Dn6Q5CQNu-------------------- Desk Jg/.?<INA\A-HBnpN1B@Nu` 0 00}    0 @ P`p8ppp p0p@pPp`ppp}T ,(<22 2 F m@ d z    $x  $<Z< n00P<%P< D @ @(@8@X@hd@xxd@xd @xd @ @h `  "" Desk File About Runner-------------------- Load Program Run Program-------------- Show Info Dump Output QuitFast BasicRun-Time InterpreterComputer ConceptsProgram execution stoppeddue to:OKProgram InformationCANCELRUNNERFast ST BASICRun-time InterpreterRUNNER bits: Phil MartinInterpreter: Jeremy RustonGavin TheobaldPhil Martinand Nigel, who doesn't like to be mentioned!Version Number: 1.05c/00 Computer Concepts 1986Gaddesden Place, Hemel Hempstead,Herts. HP2 6EX EnglandTelephone: (0442) 63937PROG1 .BSC32___FFFFFFFFFFF99999Name:________.___Kbytes of Workspace :_____XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX_________________________________________________________________________________[3][A loading error has occurred. |you may try again or cancel.][ Cancel | Retry ][3][The file you tried to run|was not in Fast Basic format.][ OK ][3][The file you were trying|to access cannot be found.][ OK ][3][The pathname chosen could|not be found.][ OK ][3][Access not possible.][ OK ][3][Invalid drive letter.][ OK ][3][An error has occured.][ OK ]?p``p?%t%z,%t%% L% d% |% % % % % %!<%!T&"%%%%% % $!)$& "&:"%"&B"&E#&B#&Y#$#%#L'$'%'$'%'$'% &`#&g#&u$ &$$&$<&$T&$l'$'$% ",%<"D%X"\'8% 'Z%<'t%X(4%$(V%@(p%\'%((%D(%`$$aؼ-H/=@JAgp6N1L`LH pHHBnp3N1L pH=|Bn-Wp*N1=n-_p2N1=nL pHH=|p3N1`(Nu?(|ff6<UT`<If,C$g|<(xaf6SCUT``\<.f"C$gF<(xahf86UT`<Af P6; Ja6.gr)a(F|fr+a`~ApNuDodgy assembler token!BWLSRD--SCYf<` TQDNuDNuhWfd~VBCDDDADDIDDQDDXDDNDINDSLSRTSTTSRHILSCCCSNEEQVCVSPLMIGELTGTLELOHSRACHGCLRSETHKLRMPAMPIMPMMPCRBTBFBHIBLSBCCBCSBNEBEQBVCBVSBPLBMIBGEBLTBGTBLEBLOBHSBRACSIVSIVUORIORVENQUXGXTNCLUDEMPSREAINKSLSROVEAOVEMOVEPOVEQOVEULSULUBCDEGXEGOPOTPTRGRIRESETOLOROXLOXRSTETRTSBCDTOPUBAUBIUBQUBXUBWAPTFHILSCCCSNEEQVCVSPLMIGELTGTLELOHSPRASRAPVRAPSTNLKSPP $Zlqxڏ(9D bB.Bn A$$<2<`=| < gX< gb< gr<"g<$g<%g"`F p`8`b. p`pANux<0fRD`v`0m <n`SHCJCg 0<8a0a 0aHC0a`\0<:a0`vJ.g<ae <zb 0m<n< o < m鋆`SHCJCg0<,a0aHC0a`0<.`0<*a<"g< g2Sgt`<"gSSg`B0gBSgL`pANu0<a0 A$Nu0<  fR@`Sa`r0<  fR@`Sa`ZC ¼<ae <zb )<ae <zb f0HR$LJ.g<ae <zb g` gJ)fa(JS|@g\|BgV|gV|gP|Dgl|RgZ|Tg`|PgZ|FgN|Hgΰ|Jgư|Lg$|Ng2|Vg`|XgZ``"`B@a`rB@aB@aB@aa`XS|cBS0g@BS`8B@aa<0eμ<9c<Ae¼<Zc <_e<zbSg`TfJfJ)f`.B@a|< gSgt`<.f<0m<9n`<9n<0mH`NbS<g><g^L&H@J@g0<a H@aH@a`b0<a0a`PNZL&0<a H@aH@a`*N(&L0<4a H@aH@a`ȼ<AmL<znD<Zo<_m6&L<0m<9o<Am<Zo<_m<zox <|g$x <&gx<%gx<#g x<$gxS (fRD |gf|g|g| g| g0aB@aa`Ja( VDDmSgS`BS8DgBSNuJn f :f0<6aB@aR` fp(aB@A@av`* <fnp&a`RB@A@aP`* <fHp$a:RB@A@a*`* <f"p"aRB@Aa`fUg0NuXpAgNuDodgy token-K -H *H b-H <k|:o2|Fo`pANur |lr FFaVQ`C`NLbZrpnljhfdb`^\ 0D2*TJTga`2 A<:a`V|<`,r%az0aQ`.8|<`8,r%a`2<0aQzJk Q`0aQ`|<`,r$alzfSEj2<0aT`A;aBQ`0123456789ABCDEFr"a"ga<"fa`r"a2 gjR`d< a Mp&n Nu|<`,C6BC(kBARAj܄SAfJCg0av`JCfr0a`;B@'d H NANLEgaR`HLNANLEga&`r#a`2AAar|a `r2AAAar&a`\2AAAar%a`F2AAAa`6Xga`2 A`C`fga`|@gV|BgP|DgJ|PgD|Rg:|Tg8|Fg0|Hg2|Jg,|Lg|Ng|Vg2|Xg,`T`TTX`Tga6`2 A`X`No entry in DeTokKeyTab!!#(-379>FLSX]kmoqsz-137;?Y_w| &/8@JRWak} ",6:?INimqw !$(+.02579;=?AFKQW_fp     % . 6 ? G O U ] f n s   >    $ + 5 7 = C E J H P X ` h n w { "  CI #,4<D    $ . 7 : G N U h r { 7>   X   # ( - 2 7 < B G L P T Y ] c h m r x %   $ ) 3 : B I@gNuXB@ANu@THENBELSEDGOTOFGOSUBHREMJ\LDATANRESTOREPWHILERSWITCHTCASEVPROCXFNINKEY$INKEY`!b#d(f)hSNDREGjLOGBASEl,nPHYSBASEpHELPr:t;vERRORxERR$zERR|SETMOUSE~RECTSCREENWIDTH?@[]SCREENHEIGHT>ENDUPDATEENDIFENDSWITCH{~CALLCHAINCLEARGRAFRECTCLOSE#DIMENDPROCDEFAULTDEF|ABSENDRUNTXTRECTPRINT#INPUT#PRINTVDU(TIME12$*TIME24$TIMEESCAPEHEX$READAPPLREADPOLYGONNOTONOFFLENRESERVESCREENFREESCREENFREEACSASNATNDEGEXPINTLOGLNPIEPIRAD%TANCOSSINSQRREPEATUNTILFORMAT$(\DOFORM^SETWINDTITLE`SETWINDINFObGETWINDWORKdGETWINDCOORDSfSETWINDCOORDShGETWINDPREVjGETWINDFULLlHSLIDEnVSLIDEpTOPrGETFIRSTtGETNEXTvSETDESKxHSLSIZEzVSLSIZETOSTEPNEXTIFRETURNINPSTATOUTSTAT&INPUTINPFORRS232LINEENDSGRAFMODELINETYPELINEPATLINEWIDTHLINECOLLINE FILLPERIM FILLSTYLEFILLCOLFILLPATFILLCIRCLEMOUSERESERVETXTXBASETXTYBASETXTWIDTHTXTHEIGHT GRAFXBASE"GRAFYBASE$GRAFWIDTH&GRAFHEIGHT(OUTXBASE*OUTYBASE,OUTWIDTH.OUTHEIGHT0OUTDUMPDOUTHANDLE2OUT4HIDEMOUSE6SHOWMOUSE8CLS:HOMECHR$@GET$RGETREC#VGETBYTES#BGETDINKFPAPERHTXTSIZEJTXTEFFECTSLTXTXPOSNTXTYPOSPPALETTERPOINT(TGRABTPUTREC#XPUTBYTES#VPUTWAITBUTTONWAITEVENTWAITTIMERWAITMESSAGEWAITMOUSEXWAITZPC\<<^>>`DIVbMODdEORfORhANDj<>l<=n<p=r>=t>v+x-z*|/~^EOF#EXT#BPUT#BGET#MAKEDIRDELDIRLISTFILE$PATH$DRIVEMAPDRIVEDISKFREEDISCFREERENAMEDELFILEFSELECTOPENINOPENOUTOPENUPPTR#FILEATTSFILETIMEFILEDATEBLOADBSAVEMENUTAKEMOUSERELEASEMOUSEDSQRPOLYMARKMARKTYPEMARKSIZEMARKCOLPOLYLINEINSTALLPERFORMTRASHSEGFREESEGNAME$SEGMENTBLIT{something}WENDSETCOLLEFT$(RIGHT$(MID$(ASCINSTR(EVALEXEC}|}&}%}#}$$}$}DUMPVARSDUMPPROGLOCALCURSONCURSOFFCURSCOLCURSLEFTCURSRIGHT CURSUP CURSDOWNDUPDEV#REDIRECT#LAUNCHMEDIACHANGEVARCOUNTFIELD '"TAB($SPC,DATEUK$.DATEUS$0SYSTIME2SYSDATE4TRACE6TRACKING8KEY:ALTTRANSBLIT@SYSVARBMANDEL(DJULIA(FSEARCHLISTJeremyHy-_$-L =@ Jng|g |+g|f.n!vNu=@ V.n F|g|+g|g |gJn Pf&NT/ .$a` .$a`NX aNu(n R` NuNuT4T@TLTVT`TjTtPHyU`8:@R8..,$" @>N"  B\B\BNuXNuTNu\NuPNuBJf0 @NuT La"L1INuTY9JNuP Hx P` Ha Hb Hc Hd He Hf Hg Hh Hi Hj Hk Hl Hm Hn Ho H   @AB &  b P2Q2R2S2T2U2V2W2X2Y2Z2[2\2]2^2_2 d j p  ؀ ± xNH.N N A NW BB HGA !! Lp ?1 d  H @ D Nw :F x PHB 0Nw Nw Nw 2Nw 6Nw XQ HHA |P Q R S T U V W X Y Z [ \ ] ^ _   J Nw @NG J NW p+`Ba n$} gaT$O͵@eRn ~Dn ~aBn B B. B a.| J.g ?.!za=_!za gB. z<FC_4h(gJ. f@g"4BBPBA<FC4hJ. g(4(. g . f4(. fp*aJfzJhk. . J. gE h. N=F faaxۮ ۮ `Dn ~Sn ~J. g p aNBn Jn ~fXJ gaP(n -L 0. =@ H`J. gJ. gtaB fBn jzaJ. f . -@ -n z n $}gaSJaJNuDeep and crisp and, J. g*H瀀E taQp aNT. aNLTn LNuQ 4. J. fn aH (n UA 0<a| p< gfJ. f<\W ɰ<"fn ɰ<:fJ. g@< gJ. g2.$nn$xn$jl&aMRn `4. n RB n a`L0NuP :fp/ara/ac . faaNZr`f . f*abBNzJ. g E f$$aۮ ۮ `8Jg& f n >x8SDp. a2Q`aa. aa nl!zgt _NuP :fp/a. °<W ´. ga B z nl!zgzNua`6|kAC xangZRQa J. gtJ. gn nl!zfta_=@ xJ. gTJ. jN n ~fFJ. gtaG f6`& Bz aFG f& Bza6G fBBB[z a&. Nu nl!zf`_dNup-`P :fp/ara_F-@ -@ -@ |lfa_0-@ zNuP :afp/arJ. gtaN . zJg R-@ zJ. gH(n Uap<~ . zanL@J. g p[aJE ztaQp]aJTn a^. aѮ zNu:fp/a@r<<V$O͵eDn ~/. /. HN{XL-_ -_ Dn ~B P Nu:fp/arJ. fJ. f,a. NuJ. gBB. ZB. Nup*aNuk::.fp/ar . fJgJ. gJ. faB`TaF`F . f,?a Nu0 . g@|> Nu . f @|> Nu . gj<Nu j<Nu:fp/aragp.aX@`:hfp/araJ. fJ. fa. NuJ. ga|. Nuk:&fp/ar` . f |> Nu . f2J g:fp/adra`4:fp/aNra`:fp/a8ra`J. fP:fp/ar4FZBBaJ. f. ZB. Nuagp.aX@. Nu:^fp/ar . f S gp.a`kj:5fp/ar . a U . g 6@f:4NugHH°f(Nu/ Ea $_< Nu0<`` 0<_`0<[Sn Բ<fzNuzNuJ. f4BB. ZBJ. f:fp/ar`:fp/ar` F . a|4`:lfp/ara`k:Pfp/ar` . f-n p-@ G a0<|> Nuk:fp/araP`P . f 0<s|> Nu . f 0<t|> Nu:fp/aHr<fa` . f2J g:fp/ara`:fp/ara`:|fp/arax`:ffp/araa. Nuk@:Hfp/ar . a  a ,4. Nu0<}` 0<|`0<yzNuk:fp/apr` . f 0<|> Nu:fp/aJrJ. g J. gH` J. f@a. Nu. `ڌ. `:fp/a ra@. Nu:rfp/a r`:`fp/a ra`:Qfp/a r`:8fp/a r. . a ,4Nuk< . jv . j: fp/a nr . fp*a ^` . f Jfp/a J|G a0>|G a$4F^B8JBG<jrfrYANu . g"J. fp*a : fp/a r<<@` . gp*a : cfp/a ra F< NuBBBNuG `G ` G ` G `+ +<kgj<gj<n/ E a v$_<g@`:< j < k0g6g< kg8` . g.a ,`( . f$`a ,4`a @4` a *4+4t+B+BNu . a . k$Nu4Nu: fp/a Nr`kp: fp/a 8r<f . g . ff . 4` . gN . . g4`x4pXZdQ4` . g" . g . o . n 0<|> Nu: 2fp/a r<fJ. fJ. ga<. . 4NuJ. fa2. . 4Nu: fp/a Lr . a` Bn pn p` Bn pn p4. pBBNu: fp/a ra`: fp/a ra`: tfp/a r`0: \fp/a raF` 751`6: 6fp/a rB. Nu: "fp/a ra . a=@ h2Nu: fp/a nr. Nu: fp/a Zr`40<Nu0<Nu: fp/a JBn B n Q ` F;j*J fP -L P ad ~ . ab`pI` J f-L FJgNu`p@f(fa rNu<kR. ra&_'A| . f|r A||`0@|@gC x`<JFk@|Jg|@k8razfl<f^Aa\|rAA`8|gd|lg\|rgT|df<|Zf| |||` raf|||F`Ua`r||`r||A|`|!jN|kFF / 2"g )(fSS`" Id" IdR<|Zf| |||`L|@kF|k,F|Pj |(kF(<m||F|Ja|fgl|lf<kBAaf0k|ffƲ<g <gr:.fp/arSF + fR+`+R++`r+`j$_?Z XJf|(" Id2`¼|;k2`a`2Ƽ|*g*| k |,kf|g22`|"k2Nu"f, NdNuE ֳf p'@`2P / I HpaOL'@(_`F|jp/aB+z <wgR+<g z <f||E`rxQ p2|xfP p`&||g UHDJDgJp@|HD'D`4<ra@f2<j*~HDRDHDJ. pgfkRQQ p2`?F|@f8<FJk2I` |dp/a<Pd<(k(J_?<Nu<<NuH$g EtaL$Nu/ Eta$_NuJ. g/ Eta$_aBn n |. NuH pg$< gJ. g2.$nn$xn$jl a8Rn `LNuERROR: WARNING: Privileged instruction Odd-byte address Absolute reference Null branch Tn a@0<:ka86Nu<gj$$g$Ff*Nu$HBJBgFBfNuHH°fNu4H°fNup.aBNuJ.g H`aLaJ. gE f4<gj`$a ۮ ۮ NuJ. g0E f&S0. U@n fp a7Bn tanpaQJ. g&HHn f/?. x?<@NA JkadLNuJ. fNuE f"n &SQNuA; EHNun k*g(n S/J. g0.$x n$jl p a6Q Nu$n >B4UBWf +g -f <,<Nu<NuWLDHMFC_H J. gl??. a .! g8Jn g p a6|Bn Eta|! n $Harp a6VBn 4J. ga6J. f4J f-L =B LpNu.n FNu 7aJaKaB0Cd (:gBH?<NATJk_A@d|:eBgHnf?<GNAPJk_|LJf|\f !\fR$IAf*.*BLNu-_ p?<NATJk_2?R@?Hn ?<GNAPJk_A Jf|\BA p'?Q/. pNu-_ pA!&p'1Q?<NAXHn ?<;NA\Jk^/. pNuaIXa$O͵@e^/ L 6H`2II(t"l@-L 6-I :XL/. bB b?.!z?. P/. RBn P/. LA$,r ?Q |W-H L?.=@a,/.!vRna:Sn-_!v=_A$Bp 1Q-_ L-_ R=_ P=_!z-_ bLH 6(_Nu-O!v`݀aHa0H N LL0NuaHpaA@JPfp~Nup~NuSk nNup3`٤aH>a n >C&@p0CQ0Dn ~/ . /. /. ?/ N *_0aV0/ N L*_0-_ -_ _ Dn ~(_P B zNup4`a7`a7`aGba6=@$a6NuHy`Hy`Hy`Hypa Sk?a6 oNa60QXNu<k|rg|Bg|gUaFNu=F!zNu<kJ.f$O͵,e|FbA`jNa`޼|Gg|Gg|Ge|GbFNA!|Hp``zp#`p2`pH`<k=F!zNuT=|r!zNu=|r!zNu"D"b\%J%*~|zxtrp48xj8Ftb^\? :pV|RNLPpFLB|<\|>)2:>;x"># B[8888888"9~9D9j99:,;f;x;~;;;;;B>H77Rzxvtrpnljhfdb`^\ZXVT\P]2]DJ^_ DB_D__:86[`0.ab>jj&j."=>R>b>v=@ >x >j6 bXbzj dFdriijkkTkkleRdrggJ7Dv lVlzlm.mn no,opoopqq@q]>Vr99:rzsHJHFtFtttvvvFvvv0wxw|xHx&$zyyz gh8Tb~ >,>@?"?6?@@>?z<tV@Z@@f@@@AA0AdAB &<k|pfaC _ NuHn z`<k|pfaB=@!NuNRNNARpra`HaB@@?a4aB@??<NN\NuaB@?Bg?<NN\~Nup`0. JaQ.n B(n 6`<kaSH<k|pfaC$L@`RPps`Әp`Ӓ<k|pfaB(ab"9at-@!Nu<k|g|f`t<k|gb|f`Pp ` aAa- nl!zgNu<k|pflaA-@ -@ NuaRH<k|lfaAЁa+ L@BGaQtNup%`Һp&`Ҵp'`Ү<k|mؼ| b2;`HtX L0T@fvHpaALRCXR/H0aOi/ nl!zg nf!zfL"L(HaRg(I ЂЁ/ a+,$_$LB00@f00@"H`#QR`BXQ<k|lgB=F!zNua@|H //L?!|D!,_N,_@!H?!|L0Nu=\!zNua@HH@J@fH@|eaOz/ (n 6NX(_Nup9`zaQrH(n b f (n 6a`<|lg|Lg>|fTaa@|lg|fU-L bL@aO<k|lg=F!zNuT` g/ (@aXY-L b(_` AT<k|rg.|Bg(|g"a*E0DP/ (IaY-L b(_`U"n 6X `<k|Lg@|g|`la`T<j(f`X<k|Lg |`la`TNup<`Xa>`PpA`Ja?/ ?.!z(n > N9J@kr2$O͵e&OBgBgUA?0JAf(O/ a<.!z|rg|fӤ.W=_!z(_Nu<k|g|g|8fӂ`<k|g|g|8g|:f``pq`Ϧa>F/?< NN\NuBga>4?a0`a>*?@?<#NN\Nua>/a0Da> _a Fa \Nua= @a 4pa HBGNu?<?<NAXJkSD`Z<kaO,Ha/<kaOLGf=FE`N$"4`002`  "`L !iH`gg`f`f`(n 0. `Ζp>0.!Nup>0.!Nu<k|pfa==@!Nu/.$A-H$`B:.!BD<k|rg|g|Bg|g|lg|tg| gּ|"g|$gUH a=|L0|ga26@kg?0< SCa'Q02p n >`a'Q<.!z`l=F!z0< a' g-@$Nux`LJn!g>r2.!g4!HADAg(n!0< `a'jQ`<k|rg|g|BgBDBE`=F!z`0< a'4`H a;2L00< `a'Q`H a;L0|lg$|ff|2n!gd?0< a&2`?H a;|L0|ffL20a,R`nH JDf.|ga;" n >a{ n >pR@JfL0Nu n >aw`a;.aL0Nu.$}?P$}a*Bn#aQ,.ga@< gJ<g*<cְ<g2.#|ga&$A!Rn#`Jn#g0<a&Sn#`a%2.#A!B0a*0@$}Nu<kzx|f<k|*g| g|"g6|$g|lg|tgؼ|rg^|gV|BgNH aKL0f|fg0<?a%^HaLpxp"n >E!g Rf`N| g<"gRg <,g`x`,( E!Ƙ`"Rg<"g` "ggز<,f`~H |b Ha L@aIL0`pga$`0 @x`0< a$`a9820< `a$Q`a9(|lg$|ff2n!gd?0< a$V2`?a8|ff20a)`=F!zNu<k|FbA`NNм|Gg$|Gg&|Ge*|Gb$FNA!| 0`BGNu . zBGNup0.!BGNup8`p`(.4`xLdRj6**~|.tr.nhjhfdb`^\Z 8TRPNHDB><2<BNZfr~" M@MXMj.&.*...2.B.F.J.N.R.V.Z.^M>MT. ..T~|NxNvO.rpOPQ"QJQHdb`MvMMN0RSS|PNLJH0DB@><:86Dt.,*(&$(bF LL TjU U .6UUxUVV`V\]]axabcc~|cxvtrpef2f8hfdb`^\ZXVipRPNLkxkFDB@><:862fr|(&$" m^j  ,X|6d@*2l3f  N NNaJ$`DaH`DzaGJ`DaI`DaH`DzaG4`DxaI`DpaI`DhaH`D`zaG`DVaIR`DNaH$`DFzaG`Dp0. Jg S@fp`2 gRn JD@~NuT ~NuTp>0Nu an~NuLan~Nua5|ffNup`|a4F~Nua6JGg|g|f4ANuBNuDNu`a& 9a8Ю!BGNu . BGNuA$ BGNuH/B?< NA\,_-@#L?NuH/.#?< NA\OLNuaa3BGNu BGNua3FN~Nua38N~Nua3*N<~Nua3N~Nua3N~NuaXJGg|f N ~Nu|f30N ~Nua2N *~Nua2N :~NuN \~Nua2N v~Nua2N n~Nua2N ~Nua2N ~Nua2vNt~Nua2N~Nua2 n >p~Nup>0. VNu0. Va"n >p0. J`WD@n JS@~NuaC ~Nua2> n >CrfQ0p~NuB1 Q > ~Nua2a$0|g>?a2,Ha2a$",L>a2.C "$$n >Np0~.WNua2 a1a#a2C"/ W (P$n >N.W.Wp0~Nua1a#a1a1ta#$a1c ~Nua1|~Jg 0 n >NupNua1ja#ra1a18a#r$a1.c., n >"H`Q ~Nup~Nua1(a#0a1Pa0JgS@|fg<|lf/a0a#&$a1Teb , n >"H`Q~Nu$a1.e`pA`a0/ (n > =| N9J@kr2$O͵eņ&OUA?0JAf(O/ a14.W(_Nu?<NNTHBGNua0NuaNJGg"|g|f02N~NuN&~NuNGNua0,N&~Nua0N~Nua0N~Nua0N~Nua/N~Nua/zN~Nua/N ~Nua/N ~Nua/N ~Nua/N ~NuN f~Nua/N ~Nu<k|dg UN ~Nua/:|ffN GNuaF|g|gJGf/*NuN l~NuN ~Nua/.N ~Nua/ N~Nua/N$~Nua|g|gJGf.Nua{~Nua{~NuaȾ|g|gJGf.JjDNuNuNua|g2|gJGf.Jgjp~Nup~Nup>Nufg`fg`aT|ga- n >an  >~Nu n >aj  >~Nua./ (n >B4< g<+gD<-g4a(_Nu< g<.g <9b<0e alGNu~pNua(_`a(_Nua-?aa-|ff`2gtJ@gn4HBJBf:HHBn Jb:>SAgSA n >"H$n >ڳfQ  >~Nua-84 | b8r Bg `a-/|lgXt fSBf|ff n >`g1`0Q  >f n >0p~Nua,a-aa,~|lfa-a,.gSa-(|ffvJf.Wp~NuA"d."H&n >d$n >f/ggg _`X.Wp>Nu _S AR~.WNua+Ha`a+|ff$& .$afl @"Aanx$& .%"afXan H#LanV$& .%af:amH#,.%BB#B#B#B#B#B#B#B#L#anRAL #amH#L#CamL #amH#Rd>L#NH#L#NH#L #amT$<vNpk-G% ~Nua*HaRa*|ff$& .$ae^ @"Aamj$& .%"aeJalH#NH#Lam<$& .%ae alH#NH#,.%B .%adH# .$adH#`<k|rg|fJlg\/ <kJ.f6|g"a<.!z|rg|fVJlgT\`a*"f(W`XNuaJ`p`a;x0k|pf|g|g"|g*p`Va`\O.a) W |fa)/@|g /|`a)/@|rg|fJlg\/L <kJ.f|g"a<.!z|rg|fJlg\`<kafa:¼|f <k$Og p:`$O Z "Ё Jkn `m(Z`O|lg =F!zNup`n _CgCgCgp;`Ja`dO.a(ac W n!zfa(H |g <r`a(vH|rg|fJlg\/L<kJ.f|g"a<.!z|rg|ftJlgr\`<kafa9|f<kf` WU abLaj0$&abD W L Jk auDg k`au:gj(o`fO<|lg=F!zNua`jO.a(ab: WH n!zfa'H|g <rt`a'H|rg|fJlg\/L<kJ.f|g"a<.!z|rg|f^Jlg\\`<kafa8|f<kf` WULaaLab8&(*aat WHLJ k atrg k`athgj(o``O <|lg=F!zNup"`a&|@fJgX<k|g|g|g`<k|Dg|g|g N|pg a߂<.!z|rgμ|g0|BfX L g (@=|!zNu<k|g |`la` =F!zNu L <k|gJg\(@<k|Dg(|gv|g ʼ|pg J|g|ga<.!z|rg|f=F!zNu<k|g|Bg|`la>` U=F!zNuX `Jlg\<k|g&|Bgaތ<.!z|rg|g`f L g(@`ad|f `p>`JlgD\Jg:(@ \gިX<k|gޚa.<.!z|rg|f Jlg\`aU `Bn#<k|g*|Bg0|g6|g |`la^`Jlg\`Jn#gSn#`Jn#gX`Nu<k|@g|gƼ|`la`X<k|ga`Rn#`C`Nrplfhjhfdb`^\ZXVTJHFDLD>@:0*06640.," NuPNu\NuTNuXNuXJf> GNu g (@=|r!zNuAal(I=|r!zNu gB/ (@<k|g,aܼ<.!z|rg|fJlg\`Cf(_`ATa/ E0DP(I`<k|g|gT|dgp`0a Nu/a$ _|ff|g a#a^XNu/ (n >B4B4a(_XNuXa Nu"n 6 i6gJQfp@`*, . C0Yf@fNu"F(G`"n 6 igJQfp$`ifPINu<k|pg|vgUa"tJgdb|Dg||Ffb LI?a0S@g<k|lfA`0g /(I`z/ UA<k|rg|Bg|g|lf a`UE0DP / (@`8 LI?a0S@g<k|lfA`(I=|r!zNupt` <k|fBn P`$U-L R=| P`-L LNq<k|g |`la`=F!zNu|bG` JSNu<Nua`./ /a gGCpNHN0HNYO/NLHN&_`&_L>GCpN N0N NHN&_GCpN "/BgNaQB/?<NaQH?<N. aV$G?<N&_N_FC`N8<HTXdpr~ N aPacNLaQDacN 0N aPac`0NLaQ ac|0N N aPac> NLaPacZ N aXaPb N NLaPaWaPJ N aQaPHN aP`aQaPrHNLHN. ,/1Fpc dЁ/a$$H _ 1@C._`Q$GNB$bNuJ$bg\C$b QCrtvg.e6"H(( DfJg8 A"BeE#J$%hNu#h Nu(d"$ &`"b MNup`zE$bJgN"RE&Iѱg $I")"Af` %i IАE$bJg""RE&Hg $I")"Af`Б%i"Hf*HNu!n$b-H$b Nu/.$NuHa | mRn!J.$|gaJ.$~fd|g0.$nn$xn$joaa0/|m@=@ Bn =| 0.$nn$f=@ 0.$pn$h=@ pN.raaaLNuJ.$~f| g| fBn!aJ.$~g|V$~|f@AN2LR@6&2.$pa`vL$nn$xn$jm(B@n$z4n$zn$lmn$zH$nBD:.$zDE`"H$nNuJ.$|gaNu|W$|`A-H$B.$|B.$}B.$~=|$LH$faPBn$r=|$t=| pN.rBn =| p'N.rBn p.N.rpaJnfaaNuaH =| pEN.r?<NNT-@$?<NNT<f2<4<6<`&<f2<4<6<`2<@4<6<=A$=B$=C$I=A$Bn$B$Bn$Nu<.$rL$fHaL?a~A$-H -H =| H H JDk"n n >?A?@?Coo`n n >?A?B?CWWJEk$n n ?@?A ?B ?Aoo`"n n ?@?C ?B ?Co o p1N.rL@m Am8/adL@mAmaTaNua=@ Bn p N.r-n$xaNua `a`avL$f8.$ra anB$nNuaPH?=| p N.r=| pN.r=_ pN.rBn p,N.rLH p6N.rNu@SBASCNup?N.rNu=| p>N.rNuJ.$}gHp%N.r?.=n$ pN.r=| pN.rBn p,N.r=| p N.r .$nЮ$f"Ү$xH p6N.r=_ p N.rLNu|W$}`J.$}fP$}afNuJ.$}gaZQ$}NuL$nn$xj4.$jH„$xSB$x0aBH$nn$fn$hL $x8.$ra`ta`la8`da:`\a`T2.$pn$zj:.$zBDa$L$nNu=A$pNuL$n`L$nn$xj4.$jH„$xSB$x0=B$naH$nNua$x$z=@$n=A$p`?<?<NAX`-n$$A -H$`/=@$A -H$ _NuH-n$$20.$aLNuP$~`-n$$A -H$`zJ.$|ga-n$$NuRn!İ| fBn!H| fa 0< aLNu>G?n$=@ =_ =_ =_ p6N.j`arHa@afHa4aZHa(aNHpON1p0.BGL@ap0.BGL@a0.n$HBGL@a0.n$HBGL@a`$]a n$f>aa n$h?@aa z?@aa n6LaH =| pEN.r]a Jn$>ara E S@k4n$44n$4Q0N.j`aP=@ pN.jNua>Bn =@ pN.jNua(=@ pN.jNua/><?a/Qa` =@ LGH -_ L=@ S@k r4QBRNuaj=@ pN.jNuaX=@ Bn p N.jNuaB=@ p.N.jNua0=@ pN.jNua|lgBn =@ p'N.jNu?a=@ 0`a=@ p N.jNua=@ p9N.j?.pGN.j0._BGNuNan$?aan$?aa?aa?aa?aa=_ =_ =_ =_ =_ Bn E aTn =| =| p N.jNNa4n$?a\a&n$=@ =_ =| Bn 0<N.jNNa/a"a?aa?aa?aa?aa/aa?aa?aa?aa?aa=@ =_ =_ >=G <=F -_ 6:4820@ASBSCH FGSDSEH0 -_ p=N.jNa`aV|fNuJGgA|gA`2aaJNup`da(`aJGfNu|gM|gLp`>a`a|fNua`a|fNuJGg;b|f$rNu"PgR$O͵e$_"O O "n >`QN$_ O.X 2"n >`QNҼ|~b:E\e:;PNuzNuaH<k|~b:E\ea`=F!zNu|~b:E\eEGEAPN h b ` tnlJ VJ L J F J (< 2 . | | 0 2 taZ/at<ka|b aB"~Nua.`a0/aJ<ka|b a~Nua`a/a"<ka|b a~Nua`/a<kap|bJGfVHH~Nua`޾|g |g"p` @"A a?\$& aJVHH~Nu @"A$B a9$&( * aJVHH~NuHaĂ<ka|b|gaL aJzVHH~Nua,`&(*L$raJVHH~NuHa.<ka|ba4L8aJvVHH~Nua`/a<kap|bJGf\HH~Nua`޾|g |g(p` @"A a>\$& aIgkp>Nup~Nu @"A$B a8&( * aIgk`Haz<ka|b|gaL aIrgj`a"`&(*L$raIgk`|Ha"<ka|ba(L8aIjg\jX`Na`/a<kab|bJGf^HH~Nua`޾|g |g$p` @"A a=N$& aHgk` @"A$B a7&( * aHgk`Hap<ka|b|gaL aHhgj`a`&(*L$raHgzk|`rHa<ka|baL8aH`gLjN`Da`/a<kaX|bJGfWHH~Nua`޾|g |g"p` @"A a$& Ca8|<~Nu @"A$B ?a2&( * Ea1|<~NuHab<kaԺ|b|gaL ?Aa8&<~Nua `&(*L?a1Ea1$<~NuHa <ka||baL8B?a0<~Nua`/a<kaJ|bJGf"aCGNua`޾|g|g"pNS @"A ?a72$& a7<~Nu @"A$B ?a0&( * a1@<~NuHa^<kaк|b|gaL ?a7<~Nua `&(*L?a0a0<~NuHa<ka|baL8?a0<~Nua`a6Ha<kaL|b|ganL ?a7r<~Nua` @"A$BL?a0&(* " $ a0<~NuHa~<ka|baL8?a0<~Nua0`a5HaJ<ka|bF|g*|gJGf *La7\~NuL?a7<<~Nu _"|$_?a7<~Nua`Ha<kaZ|b*JGgaL?a7X<~Nu&L?a7^<~Nua`a/a<ka|ban"Jg ~NuaT`aV/ap<ka|ba>"Jg ~Nua$`pNSa/a8<ka|b a"aAJNua`a/a<ka|ba"aA <g Nup>Nua`aa<kaJ|bJ|f O.X"$ԀHBJBfhHBn Jb^4"n >$I`!Q4"n >`QЁNuaT`aar<ka|b|fRaJVHH~Nua"`ava@<ka|b|f aSHH~Nua`aDa<ka|b|faUHH~Nua`aa<kaN|b|faWHH~Nua`aa<ka|b|faTHH~NuaZ`aax<ka|b|fXaPRHH~Nua(`4&HCHCJCf((HDHDJDfH@J@gHAJAf"҃e ҄e<Nu<Nu$_a.WN&_ n >C"/gJgfSAgS@f`S@@NH@B@H@=@ J*n > 0 @ Bd0<9A'@C$BBQNuFC`N(.44Lp NS~ `*~L`*pBGNu0HBGNu BGNup0(2 P"n >`Q~Nup0. J"n >W|gn JD@~Nup NSFGCpN8:<>HPV\bhpv|Nu0Nu Nua1`a) Nua+:a)HNua`QNu1G$n >"P`QNu"n >`QBNu<kzgz|bC`NpNSj$>4~|zxtrpnl"&LB@@E&< g$@A0\f@fNu(K`pNu|`|`|` |`|`| g" @0@f0k|`g|gULNuCaf"`JEgJn ~j^p1a Q |B pA p`;`NHHIpT2AfЇH`aצLI$B00@f""H`BQ`rpNSa|0k|`g:|gVULNuaҁ|0k|`g|g4ULNua|0k|`g|gULNua`|0k|`g԰|gULNua>|0k|`g|gULNua|0k|`g|gULNu gh @0@f4|gB1H?<v=`B?<`?<al"n >B16H?Hn((?<NA\Bg/. >?<NNAPv=J@gv?NAPHBGLpNuaa |lgNu??<>NAXJkPNuaa`?<?|pfa/?<BNA Jk Nua?<?/<?<BNA JkBGNua?<?B?<BNA*?|B>BNAW/E>BNA Jk HHBGNua:?<?B?<BNA*?|B>BNA,/E>BNA Jkr BGNuHn p/<a?aa@ p?<@NA Jk>NuHn p/<a??<?NA Jkp. pBGNua0/ ?<9NA\J@kNua/ ?<:NA\gJ@kNua"n >n Jd>B1NuaxC $n >S@kQB/. >Hn((?<NA\C ?</ ?<NNAPJkh$_"J > Jl\C(F.(=g * `  J fSg f / ?<ONATJj|f"  >~NupNSC *.*BaL"n >2SAk paQ`?<NATJk"n >A:?</ ?<GNAPJk"n >Jf|\ >~Nu<k|pfaB?"n >S@k$ :Wg"n >`)H@A??<NAX0"n >B1/ ?<;NA\Jk@Nu?<NATHBGNu<k|pf~a??<NAXNuaR?Hn((?<6NAP .(4(2(*BGNua n >B0RaHoaלa n >B0"_/. >/ Bg?<VNA JkaNua/ ?<ANA\gJkNu/ <kar&_H/ a4<ka^&_H/ a aF&_H/ (Kaaa.a"n >E -J|dS@kQBa6"n >B1-I/ pZN1*_(_0.D@HJnfpBGL@a"n >Jf >SL@.aC $n >f >S G~aTaL@~aF`aPaB/ ?<CNA JkBGNua.a|pfaTa>az"n >B1??</. >?<CNA JkNAXJkzNua??<ENAXJkdNuBgaa?a?@?<FNA\Jk@NuaBgaHoaa.Bga BBHzFHo/aa?aaH@?<KNAL@BGaaJ_aJ_`a\??< NMXBGNu?< NMTBGNua8/ n >X@| o@ J@fp a: ah ar X@| lA`PM  > ~Nua/ n >a a" a, > ~NuX@a$:NuH@?a:Nu@@aNu4H 20 A0Nuaj/ n >a@ aH aR  > ~NuaD/ n >a( a a,  > ~Nu@a/NuH@a/NuX@@BGaa bNu?<,NATBGNu<k|pfa??<-NAXJk4Nu?<*NATBGNu<k|pftaߪ??<+NAXJkNuaߔ?aaa0@/a,C>N nl!zg0Nu8@//<`//<`//<??<@NA JkNu//<`?aްn Jg"n >B1 n!zfaU>-@ pHn r/<??<@NAJkD /. >/. p`/Jf/`a޶?aaH>/E p0@CNL@aa|lg0Nu2Vxv/ /<??<?NA Jkp. pBGNu/ /<??<?NA Jkp0. pBGNu/ /<??<?NA Jkt . pBGNu/ /<??<?NA JkP . pa2~Nu/ /<??<?NA Jk( . p". ta`~NuHn p/<??<?NAJk p0. pn Jd\"n >B1/ /??<?NAJk "n >Jf >S ~Nu|"n >/ J-I p/<??<?NAJk"oJg  e`Jg pg/I` > S~Nup//a?aa/@a a/@?<?NA Jk*Nup//aܲ?aaܨ/@aaܜ/@?<@NA JkNua܀?aάaP|g(|f n >a > `a& n >a > >|g$H /. >/??<@NA JkL0` n >.Spa`Q><.!z|g |rg|Bg|lg| g|tg`p a.TNuUp a$`Rp a"LaF|rg|g(I`2|f@`H @ pHn p/<??<@NA JkL0Nup NSad?a͐aH>/|aL@|lBH (n >Bn p<-fFn p`<.g <0m<9na@L0~Jn pgaL@aaz|lgTNuBn(T=|(VNuJn(Tj=|pkN1Jn(Vk BnpkN1=|(VBn(TNua8 INJ@g|gNW@NWLNuRn(Tfp`Sn(T n(Tfp=@pkN1`Rn(Vfp`Sn(V n(VfB@`aaH?aba0?a\a&?aRatHaBahHa6a\Ha*aPHL=_=_=_HpN10.HL@BGa0.HL@BGa0.HL@BGa0.HL@BGa0.HL@BGa` aـaˮ/av-@ WCp2QpN1 _ Cp0QNup~Nup3NSa0p~Nu0.H~Nua"J@k=@pfN1Nua J@k?=@pgN10nf=|rAưpf1TA|fNuJfprNSNuaؼ?aaز|lf?aئ-@0` a-n@=@=_pN1Nuaz?aʦap|lf?ad-@0` a-n@=@=_p N1Nua8?ada.|lf?a"-@0` aH-n@=@=_p!N1Nua?a"a|lfa8a-@a\` a-n n >H@B@H@B0-H=_p"N1Nuaצ?aaל-@=_=|piN1Nua׀?aɬav-@=_=|piN1NuaZ?aɆaHavaHajaHa^aH=o =|phN10.H~L@a0.H~L@a0.H~L@a0.H~L@aTN{a?aaHaa HaaHaaH=o =|phN10.H~L@a0.H~L@ap0.H~L@a`0.H~L@aPTN{a6?aba,?aXa"?aNa?aDa=@=_=_=_=_=|piN1Nua?aa4Haa(HaaHaaH=o =|phN10.H~L@a0.H~L@a0.H~L@a~0.H~L@anTN{aT?aǀaHapaHadaHaXa~H=o =|phN10.H~L@a 0.H~L@a0.H~L@a0.H~L@aTN{a?aaԸ=@=|=_piN1NuaԖ=@=|phN10.H~Nua|?aƨar=@=| =_piN1NuaP=@=| phN10.H~Nu<k|pfa*=@=| piN1NupNS=| phN10.H~Nua?aa@Haa4Haa(HaaH=o =| phN10.H~L@a0.H~L@a0.H~L@a0.H~L@azTN{a`?aŌaHa|aHapaHadaH=o =| phN10.H~L@a0.H~L@a0.H~L@a0.H~L@aTN{=|a/aaҾ=@-_=|piN1NuaҢ?aaҘ=@=|=_piN1Nuav=@=|phN10.H~Nua\?aĈaR=@=|=_piN1Nua0=@=|phN10.H~Nua?aBa ?a8a?a.a?a$a|ff=@=_=_=_=_pdN1p>0.NuaѼ?aaѲ?aaѨ?aaў?aaє=@=_=_=_=_peN1NuHaanL@NupNSaaH炀azaaH炀ajaaH炀aZaaH炀aJa/aDa/a:a/a0a/ /4"/($/&/(/ */,/.NH~L@8a~ /L@,a~ /L@ a~ / L@a@NuaЈ/a´a~?aªat?a aj?a–a`?aŒaV?a‚aL=@=_=_=_=_=_-_p*N1NupNSa/aFa?aB0-Hp4N1Nu~?a~>?aQan=@=_=_=_=_=_=_=_=|p3N1Nu~?a6>?a`Qa&=@=_=_=_=_=_=_=_=|p3N1Nu a/aa?|lgBoBn oLHp3N1JogLH=|p3N1-oBn=|dB=n$=n$p*N1-o=Wp2N1 oLHJogLH=|p3N1=|p3N1Nu?|a?@a8a?@ a,a?@ a a?@`a/a a=@-_p2N1NuBg`?<aͶ?aaͬ?aa͢?aa͘=@=_=_=_=_p3N1Nuav/aal?aab?aaX?aaN?azaD?apa:?afa0=@=_=_=_=_=_=_Bn-_p/N1Nua-@p6N1Nua?aa?aa0a`H炀aa aPH炀=o=o / =@ =@pFN1L@~0.HaܚL@~0.Ha܈N{aj?aa`|ff4=@=_pjN1~0.HNu?<`Bga2?a^a݀aH炀aJapaH炀a:a`aH炀a*aPaH炀 =@ / =@ /=@ /$=@=o0=o2plN1L@~0.HaۺL@~0.HaۨL@~0.HaۖL@(~0.Haۄ4N{aܾaH炀aaܮaH炀axaF?ara-I|l  R`B1p N10.HBGNua/a|dԮE "n >"SkQBA NHNuaǨ/aȰ|d|E "n >"SkQBA NH"n >$I JSgg` > S~NuaVJ@kV|bN@A N BGNuDFLPV\bhntzpNS NNuANuA$NuANuA.NuATNuANuA{NuA8NuANuApNuA^NuAZNuANuANuANu nNu0nNuANuA Nu MNuA{NNuASNuAѶNuA'NuANuANuATNuA NuANupNSpNSpNSpNSp=NSpNSpNSpNSpNSJjzdRAHAfB NuJAkRj"g HBNuJj.dRdRB>GGBfABB ABBNurpNuJBk`p$g$4 BBANu&jDRBkRAk2gA lDAJjRJjD2aJk2NuE @"A$< LevaaaGNu&<ԚxK(<z`&<;)(<\za| mJjprtNua?aJk4NuG 4 @"A$Baa a aaa_NuaL8`aL8aL8`Jj4dRAB$RAk"gA lDAJjDJgJjSNupJjpNuJjdRdRBA&(RBk,g :SE؄׃QB lJDBJjDgJjSNupJjpNua$<[ةvUC`f.kJjTeRGH?a*,$<vaaEaJjRA4g @"ArpjD@H@aa`a&<[ة(<7(qzUE`t.k|JjvTeRGH?axH&<xzaxL8aG ~a0JjRB6g @"A$Btpr0jD@H@aa`2H?a @"A$BaHadRAB$RAk,gA lDA⨴fgJjRJjDNupNuJjdRdRBA&(RBkg :SE؄׃QB ljDBJffgJjRJjDNu|n$$<ڢv`j| n&NuafE~*,ada^ @"A`Aa`fafG8~H?ava @"A$B`Ba`aBRG`a:gaANug Ea @"A~ "aaQNu*,ETa$&`aRG`agaBNug&Ga @"A$B?<Laa0SWfTNuHGaL8`$k*j.BUH$B,$/7i+Z*SFe4K`+>Zu! sǵk}1ۏt=.p{?2 k( ` h&4^TmԳ1ne}I<" 6FŏŏLG`g0VGf͖tЮbⰏs=%mecV,57SF€f/-Z\*x*n{PIЋ e|! sLK:Nװ:i2)2}*)Қ ?N󈈈L?Ӿzp e%7Xx}  XÀp T%0 FF X)}/Հ ` ` vH;`[FF$;`Nu@P$ k(C@ԥ* _2ɿ/ k:#x !$'+.158;?BBBaJAfNuJAgfSANua< g<@f J@gRS@Nu<Xf `@<Nf `4<|fa`(<gθ<|faa`<CfJ@gBS@RBn Jb Nu<{fFJ@g(H@@ }gaz`J@gL`RSANuH }gaR`LRSANu<1eҸ<9bD 0e 9bSAE E` *f"RSABc8:g@DEDa^SDPQNu $fRSA`@ LfRSABcDa0SD QNu Rf,RSA:BcDaSDkPQSE PQNuH@@?aSWgL` Nu<(f )ga\`<Af J@gS@<ae<zb`<af J@gS@<Ae<Zbx `p<*f JBg``<BfVJBgSSBNuH"`H 2E)8BBBa|JAfBaLHBBBHBJk4EFgFA)8 SBf`8Hav(<<g&<xza"aRF>LxaaL0A)8BBaJAfNuaH< g<Dg(<Eg <.g<dg <Zg<zf<DRB|(bNu<^fPNu<|g<g"<|fa`<+fJj H a|LNu<-fJjNu<1eH<9b@D 0e 9bSAE E`H@@?a0SWgL` Nu<(f )ga `aN< g<Xgj<Ngn<|gr<BgB<Zg<.g<JFf>Ek$aQg 5eR 9c0`>A)8E)a 0gSRGNuJFfT0gJGkGg k S@fJEg0jD@Ec00S@f0GkgS@f0g"H !0f S@fNu0gS@f0gS@f"H0 !0f S@fD0jD@H|e0B@H@d|e0B@H@ |e0H@0DF 00`f  `RFfNuNPJ  Z^`Xm \ {ϐmӐܐ:rV8set_uprVBfblank_sheetr:X vrrVrangerrrD X\rrVE mouser(jrVGNcommandr quit%pr8r\Vset_upr4r¼swprshprll¼swlshrll¼swlshr8rdj@9*This software only works in medium resolution.r6rd`HrJ: r" lft*ST-Sheet Version 0.01rH rJ:`"lft*A simple spreadsheet capable of handling manyr"lft*complex mathematical functions.HrJ:r"l ft*This program was designed and coded, in Computer Concepts Fast BASIC, as partL"l ft*of a GCSE,(mature), Computer Studies project.Ll"l ft*In its current state this program and associated documents are Public Domain.lj"lft*There is no copyright and you may copy and distribute it freely. If howeverjh"lft*you find it useful you may send 5.00 to the address below. In return youh`"lft*will receive the latest version, with new commands and features.`b"lft*An additional 5.00 will get you a documented source code listing.bX" lft*Please specify Version Number when you request a listing.Xb"lft*Please send donations, suggestions and comments to ... Neil Smith,b\"(lft*42 Hayes Road, Bromley, Kent, BR2 9AA.rH rJ:\"lft*Press a key.trdummy%pBrJ:rsw2%p¼sw|rsh2%psh|&p!rllsw2%lsh2%r<lxrsw2%llsw2%lsh2%r< lrlsh2%lsw2%lsh2%րd<x lrsw2%lsh2%lsw2%lsh2%r<ld  ~cell( lfl enter$( lfl command$( lfrזdummy$p l* f~&p r&prcell(&l&fpxwer (enter$(&l&fpזdummy$r `command$(&l&fpזdummy$l quit%pr mx%pxr my%pxr autocalc%pr display%pr frm$p*s^ZZZD.DDr6rVblank_sheetrll¼swlshrll¼swlshrr8rH^&pr&n @C,"v&z lft&^2"lv&ft>d&vAf2  HrVrangera$p*[3][vxv*|Error at cell v>dmy%vAfvdmx%fv* | See User Guide ][ Oh dear! ]dummypa$lfrcell(mx%lmy%fpxwer enter$(mx%lmy%fp* r command$(mx%lmy%fp* r(prc$p*-1E-8r|Vmouser(l(l(l(r(th(nh(th(nl@| omx%p mx%r omy%p my%r mx%pdd(xf|<fr my%pdd(|fxfr omx%j mx%f omy%j my%@G*΀Xr"lft>dAv my%ft mx%t* trXr display%p@G" enter$(mx%lmy%fl2ft* trrVcommandrllblr8r& "c$rll¼swlshrRH4G "c$lfrTG*=rVHexpressionjTH*'rVwordsrrVNinstructionrr autocalc%p@Hj*V_\recalcrVTreprintr*:r(l(l(l(r(pr:Vexpressionr "c$p "c$ld "c$fxfrd$p "c$r (enter$( mx%l my%fp "c$rr,flag%p&pd "c$frd "c$l&lfft@hd "c$l&lffn\h "c$l&vlfr*0h "c$l&vlfl*9@Khd$pc$l&xfrd$pd$v*(cell(vc$l&vlfv*,vddc$l&lffxAfv*))rd$pd$vc$ldc$fxd&vffflag%pr   "c$pd$r,flag%pr `command$( mx%l my%fp "c$rcell( mx%l my%fpd "c$frcell( mx%l my%fpxwe@Lހ command$(mx%lmy%fp* r enter$(mx%lmy%fp* rcell(mx%lmy%fpxwevBrVQprintdcell( mx%l my%fl frm$fl mx%l my%frrvVwordsrc$pc$ldc$fxfr enter$(mx%lmy%fpc$l fr command$(mx%lmy%fpc$l frcell(mx%lmy%fpxwe>Vprintdc$lmx%lmy%fr>VinstructionrRQrN "c$lfrTO^*RErROVO "c$lfrTO.*Nr autocalc%prT*Fr autocalc%pr€pTPh*BLrc$lfr*Ahc$lfl*Z@Vhorblankp`c$lfr*0hc$lfl*9@Vverblank`:autocalc%p@Vreprint:`TP*SArVVsaverTP*LOrVY:loadrTP*QUrV\jquit`TQP*DIrRc$lfrT*Nrdisplay%prT*Frdisplay%pr.T*FOrV]formatrr.VprintdJi$lxpos%l|ypos%fr&pdvxpos%z fzr&pdv|ypos%fzr&xl&l7lr8rHlXr"lftJi$l ftrHrll¼swlshrlLVhorblankrhor%pdc$lffxAL&p rcell(&lhor%fpxwer enter$(&lhor%fp* r command$(&lhor%fp*    FVverblankrver%pdc$lffF&prcell(ver%l&fpxwer enter$(ver%l&fp* r command$(ver%l&fp*    RVreprintr4r&pr&p R6cell(&l&fpxwe@Up6@VQprintd (enter$(&l&fl&l&f@BUNVQprintdcell(&l&fl frm$fl&l&fN  l6rVsaver >mypath$pv**.DATr Zmyfile$p*rT2lllr >mypath$l Zmyfile$l nstatusrV2ll& nstatusp@&PW4 >mypath$lfj*\r >mypath$p >mypath$ld >mypath$fxfrr temp$prp >mypath$r&pd Zmyfile$f buttonpr&tx@Wbuttonp*[3][File already exists.][ Continue | Cancel ]lf0&r buttonp@0V&pd Zmyfile$fr&p r&pVh&lcell(&l&fl (enter$(&l&fl `command$(&l&fhl,&rrp temp$rr,Vloadr >mypath$pv**.DATr Zmyfile$p*rT2lllr >mypath$l Zmyfile$l nstatusrV2ll& nstatusp@&PZl >mypath$lfj*\r >mypath$p >mypath$ld >mypath$fxfrr temp$prp >mypath$&pd Zmyfile$fr buttonpr&n@[ buttonp*[3][File doesn't exist.][ OK ]lf0&r buttonp@0&pd Zmyfile$fr&p r&pr&lcell(&l&fl (enter$(&l&fl `command$(&l&fl<&rVTreprintrrp temp$rr<Vquitrprrtdr*[2][ Are you sure ][ Yes | No ]lfp@ quit%p" autocalc%pr"lVformatr "c$p "c$lfr,flag%pxr&pl "c$l&lfj*.h "c$l&lfj*Zh "c$l&lfj*D@]flag%pV "c$l&lfp*.@^R,flag%p,flag%vV  &,flag%l@&\frm$p*s^vc$rautocalc%p@Vreprint\dB_:rdummyp*[3][Incorrect format | See User Guide ][ OK ]lfrrrdZVrecalcrrx%p rry%pZcell(rx%lry%fjxwe@`4cell(rx%lry%fpd `command$(rx%lry%ffl  ,PROG1.BSCPROG2.BSCPROG3.BSCPROG4.BSCPROG5.BSCPROG6.BSCPROG7.BSCPROG8.BSCPROG9.BSCPROG10.BSC<<<<<<<<<<A:\*.BSCab Hz/:NuH z0(2(@g4"P&1::g*g2g:ftgl`2g\`NgL`g<`.E\@f#`@Y@j0(Y@1@`,E0Y@j0(Y@XBhmBBhf1@LNu,X.6H*2( 6^VjTzVb&$N Hf($*  n| 60X2 `\V"8"&Z,NNN  $ L& " V ,>v" 2^nP ZV 4n  $ rT*0 0D>L  " >: RR8N".$B.d Dbn^jX2 8*  v2`ll|:D.D&|"(8BBBP&&LHJHNLHJH$., THJH*&.ZR PFHH@ (0\HxT0&TDL R$6.* $. V>.. STWMAN ASC ?LTYPE PRG C2What is a Word Processor? Whether you're a student facing a term paper, a business professional with frequent reports to write, or an aspiring novelist, ST Writer can help you beat those deadlines -- with time to spare. No more tedious typing and retyping of drafts; ST Writer lets you edit and reorganize your copy until it's just right. What exactly can ST Writer do for you? One advantage is that you never have to press the [Return] key to end a line of text while typing -- the program does it for you automatically. Also, you can change all or any incidences of a given word in your text to another word -- for instance, you can instantly change the word "pleased" to "glad" anywhere it appears in your text with just a few keystrokes. ST Writer lets you center text or print it flush against the right margin, and you can print with left and right justification. You can mark a block of text and then delete, copy it, or move it to anywhere else in the text (or to another file!). Made a mistake? Just press the [Undo] key and start fresh! There's lots more, and you'll find out about it by reading this manual. Quickly and step by step, this guide shows you everything you need to know to use ST Writer. The first section tells you how to load ST Writer into your ATARI ST computer, and presents an overview of the program. The second section gives you a brief text to enter, edit, and print, along with how-to instructions for each step; after printing your first ST Writer document, you'll also learn how to store and retrieve what you write using a disk drive. By working with a longer passage in the third section, you'll learn about the advanced editing, formatting, and printing features of ST Writer. Finally, you'll find a complete, alphabetical Reference Guide to all the features of ST Writer in the back of the guide. Getting Started Here's how to load your ST Writer word processing program into your Atari ST computer. 1. With your computer turned off, turn on your monitor and disk drive(s). Insert your ST Writer disk. If you do not have TOS in ROM, you will have to insert your TOS System Disk instead. Turn on your computer. 2. When the GEM desktop appears, remove your TOS System Disk (if you have used it) and place your ST Writer disk in the drive, or if you have two drives, place the ST Writer disk in the second drive. Open a window for the disk drive by double-clicking on the icon for that drive. 3. Run ST Writer by clicking twice on the icon (or text filename) labelled STWRITER.PRG. Note: You can run ST Writer in any of the ST's three resolutions: low, medium, and high. Low resolution gives you 22 lines and 40 columns; with medium resolution, 22 lines and 80 columns, and with high resolution you get 25 lines and 80 columns. Also, using high resolution gives you the option of 37 screen lines. Simply use the GEM desktop to set the resolution you desire before running ST Writer. You may also wish to change the default screen colors and key repeat rate from the desktop before running ST Writer, although you can change these once ST Writer is running if you are in GEM mode (GEM mode will be explained later). What's on the menu? Take a minute now to look over the selections available and see what you can use each one for. While working with ST Writer, you can return to this menu at any time by pressing the [Esc] key in the upper left corner of your computer keyboard. CREATE File - Start writing a new text file. DELETE File - Erase a file that you've stored on diskette. EDIT File - Revise a file that you've just printed or loaded from diskette. FORMAT Disk - Format a data diskette for storing text files you write with ST Writer. INDEX of Files - Call up a listing of the text files on a diskette. HIRES Flip-flop (high res only) - switch high res display between 22 lines and 37 lines. LOAD File - Load a file from diskette into your computer. PRINT File - Print a text file on the printer, the screen, or to a disk file. SAVE File - Save a file on diskette. RECEIVE AtariWriterTM - Receive file transmitted from 8-bit Atari Computer using Atari 850 Interface Module and null modem cable, or load in an intact AtariWriter file obtained by other means (eg., from a bulletin board). TRANSFORM Colors - reverse screen colors -- black to white and vice-versa. QUIT - Stop using ST Writer and exit to the desktop. Talking to ST Writer...and making it run. With the ST Writer menu on the screen, type C for Create File. Take a few minutes to become familiar with the edit screen that now appears. The small flashing rectangle (or square) near the upper left corner of the screen is the cursor. It shows you where you are on the screen while you're working with ST Writer -- whether you're writing, editing, or responding to the prompts and questions that appear in the Message Window at the bottom of your screen. Many of the questions that ST Writer asks you require a yes or no response. You can answer by typing Y or N. If ST Writer finds a mistake in an entry or command, or detects a problem in your computer system, it displays an error message in the Message Window. In most cases when you see an error message, you must press a key before continuing. In this guide you'll find several instructions such as "press [control P]" or "press [Shift Tab]." To execute these keystroke combinations, hold down the first key while typing the second. You may already be familiar with this technique; if not, you'll soon get the hang of it. Clean copy in minutes When they first learn to use a word processing system, many people want to tell their friends about it. So here's a letter for you to type, edit, and print that won't just teach you about ST Writer -- you can also use the finished copy to show a friend what a fine word processor you are using. But first, a couple of features of ST Writer that you'll need to understand to type your letter. With ST Writer you don't use the Return key on your computer keyboard the way you do on a conventional typewriter. When you're typing a word that will overflow the right margin of the screen, ST Writer automatically moves the cursor -- and the word -- to the beginning of the next line. Press [Return] (or [Enter]) at the end of each paragraph, or to insert blank lines in what you're writing. ST Writer inserts an inverse video "less-than" sign (<) (colored red in low and medium res) at that point to show the [Return] and moves the cursor to the left margin of the next screen line. To mark the beginning of a paragraph, press [Control P]. ST Writer displays an inverse video (red in low and medium res) letter P at that point on the screen. Now you're ready to go. Select Create File from the ST Writer menu, if you haven't already. The display switches to the editing screen. For now, ignore the Print Formatting Block at the top of the screen. Just enter today's date on the first line, fill in the name of the person you want to write to after the word "Dear," and type away. And don't worry about typos -- you'll be able to fix them in a jiffy when you edit with ST Writer. Today's date [Return] [Return] [Return] Dear .........[Return] [Return] [Control P] As you can see, I'm not writing this letter on my old typewriter. Instead, I'm breaking in my new ST Writer word processing program, composing and editing on my monitor screen. When I've finished writing, I can print a copy -- or dozens of copies -- just by pressing a few keys on my computer console. [Return] [Control P] And no more typos -- or at least, no more retyping to get rid of them. I can easily delete or change letters, words, sentences, or paragraphs. Or say I use a word or phrase several times in a piece of writing, and decide later that I want to change it. I can have the computer automatically search out every use of it and substitute something different. [Return] [Control P] ST Writer will print the things I write just about any way I want. I can vary the margins, in- dent paragraphs or blocks of text, and change line spacing just as with a typewriter, but more easily. I can also print pages with justified right margins. [Return] Now add a paragraph of your own if you like, preceded by [Control P] and followed by [Return]; then add a closing and press [Return] again. Quick editing with ST Writer Now that you've created your first text file, you can go back and fix any mistakes you made. And if you want to rephrase anything to make it more your style -- by all means! No need to return to the ST Writer menu and select Edit File; you can edit a text file while still in the Create File mode (select Edit File to revise a text file that you've retrieved from diskette, as explained in "To load a text file"). While editing, you'll probably want to move the cursor quickly around the screen from one problem area to the next. Refer to your Quick Reference Guide (see file QUIKREF.TXT) for the Cursor movement controls you can use to do this. To start editing at the top of your letter, for example, press [Shift F1] to move to the top of your file. F1 is the first key in the row of ten function keys at the top of your keyboard. Now you can use [down arrow] to scan quickly through what you've typed, and [left arrow] and [right arrow] to move the cursor to anything you want to change or correct. When you reach the last line of text on the screen, just keep moving the cursor down -- the text will scroll up to show more of what you've written. You can also page through your text file, up or down, by pressing [Shift up arrow] or [Shift down arrow]. Press [Control A], or [Control (left arrow)] to move to the beginning of a line, and [Control Z], or [Control (right arrow)] to move to the end of a line. To move instantly to the end of a file, press F1. To correct a typo or replace a word or phrase, you first must either delete the wrong characters or words, and type in the correction, or press [Insert] to enter the "type-over" mode, allowing you to type directly over the incorrect text. Be careful, though, not to type over wanted text, as once this is done, the typed-over text is not retrievable. Pressing [Insert] again returns you to the insert mode. Refer to the Delete text commands in your Quick Reference Guide. After deleting what you want, just type in your correction or change. ST Writer automatically makes room for as much new material as you want to add. To insert a whole new sentence, paragraph, or more, just position the cursor where you want to add text and type in the new material. Whenever you delete a line or block of text, the last line or block deleted is retained in the failsafe text buffer of your computer. To restore the deleted text, press [Undo] to insert the deleted text at the current cursor position. From screen to paper You're now ready to print your clean, edited letter. Make sure that your printer is properly connected to your computer and turned on. Press [Esc] to return to the ST Writer menu, and select Print File by pressing [P]. Then press [Return] four times at the four prompts with which ST Writer presents you -- they will be discussed in detail later in this manual. Next ST Writer looks for a printer configuration file on your disk (see Printer Configuration File in Reference Guide). Now ST Writer formats, then prints your letter. To halt printing at any time, press the [Esc] key (or [Control S] to pause) on your computer keyboard. You may have to experiment a bit, adjusting the paper in your printer before printing your files, to get the correct top margin on your printed pages. The top margin on your letter should be about one inch. How much can you write with ST Writer? You can enter between 180,000 up to about 3,800,000 (depending on system) characters, or bytes, in ST Writer's text editor. While editing or creating a file, the amount of remaining free memory appears constantly in the Message Window. The free edit space is shown in bytes. A byte is roughly equivalent to one typed character. You can figure on about 1500 bytes for each standard double-spaced page. It's a good idea to leave yourself an adequate margin of free memory in every file you write, just in case you want to add to a file later on. When your computer is close to running out of free memory, the message "WARNING - memory low" (at 500 bytes left) or "!!!WARNING!!! Almost out of memory" (at 200 bytes left) appears in the Message Window. When this happens, it's a good idea to stop writing and save what you've written -- you'll need a margin of free memory if you decide to revise or add to the file later on. After saving the text, start a new file to continue the document you're working on. To save a text file Here's the procedure for saving a text file. Try it now with the letter you've written about ST Writer. First return to the ST Writer menu and select Save File by pressing [S]. ST Writer prompts you to enter the Save filename. Insert a formatted diskette (if your disk isn't formatted, you can have ST Writer format it for you -- see Format Disk in the Reference Guide). Then type a filename or Path name for your text file. Filenames may be up to eight characters in length, optionally followed by a period and an extender of up to three characters (e.g. STWRITER or STWRITER.TXT). A path name indicates the name of a folder that is to contain the file, as well as the file name, separated by a slash (e.g. LETTERS\STWRITER). See Path name in the Reference Guide for further information. All alphanumeric characters (A-Z, a-z, and 0-9), except a space, and punctuation can be used in ST Writer filenames. If you enter lower case letters, they will be converted to upper case. After entering the filename, press [RETURN]. If while saving a file ST Writer finds that there's not enough space on your diskette to accommodate the file, the program gives you the message Disk is full. Press any letter to return to the main menu and try another disk -- format one if necessary. If you want to lock (prevent overwriting) a text file that you've saved to diskette, see Locking files in the Reference Guide. It's always a good idea to make a backup copy of every diskette you store files on -- just so you'll have a duplicate in the event that something happens to your original diskette. Long documents -- anything that will more than fill your computer's memory -- must be created and saved in segments, with each segment assigned a different filename. This is where the filename extender comes in handy. You can tie together the various segments of a long piece of writing by giving them all a common filename, and use the extender for each to keep track of their proper order. As you saved each segment of a document named REPORT, for example, you could name successive segments REPORT.1, REPORT.2 and so forth. You can easily print the various segments of such a document in any order you wish; see Chaining print files in the Reference Guide. To load a text file Using ST Writer to load a text file from a disk drive into your computer's memory is much like saving a file. You just move the file in the opposite direction. Here's the procedure; try it now with your letter about ST Writer. Though you've just saved the letter, it also remains in your computer's memory. To load it back in from your disk drive, first return to the ST Writer menu and select Create File by pressing [C]. ST Writer asks, Erase file in memory, Y/N? Type Y. ST Writer erases the letter from your computer's memory and presents you with an empty edit screen. Now return to the menu (press [Esc]) and select Load File by pressing L, at which point ST Writer asks, Load File:. Insert the data diskette that contains the file you want to load and type the complete filename or path name for that file and press [Return]. If the file loaded is not an ST Writer file, you will be asked if you want any embedded tabs changed to spaces (5 spaces per tab). If you simply press [Return], they will be converted. If you are trying to maintain the same tab spacing and are planning to "SAVE ASCII", you may wish not to have the tabs converted. If so, just don't try to print the file if you chose not to convert the tabs, since any lines containing the tab character [Control I] will be blank. If while loading a file ST Writer overflows your computer's free memory, the loading process is halted and the message Buffer full, file not loaded appears on your screen. That part of the file that was loaded prior to this message is erased from memory. A word processing wonderland To show you more of what you can do with ST Writer, this section gives you another text file to type, edit, format, and print. You may recognize it. Go to the menu and select Create File. If there's a file in your computer's memory, ST Writer asks, Erase File in Memory, Y/N? Type Y to erase the file from your computer's memory. Again, ignore the Print Formatting Block at the top of your screen for now -- you can experiment with various formats after you've typed and edited the text file. Just type the passage below (from Alice in Wonderland) as it appears, but do not type the paragraph numbers in the left margin -- they're for ease of reference during the editing you'll do later on. Before you begin typing, here's a tip and a reminder. To begin underlining some text, p.  `Q.. EXAMPLE MMG KpRPERS_DBSPRG MpTPERS_MANTXT Rp$SAMPLE PDB Up Please find enclosed the insurance documents for your house contents policy which is due for renewal on 31st December 1999. We apologise for the massive increase in premiums, this is due to the large number of recent claims for gold studded dog collars which have been stolen in your postal district. With reference to your claim for a stolen gold studded dog collar, we can not find any reference to it in our disclaimer. We therefore require a valuation report from a reputable jeweller, and a sample of the gold, prior to any payment being made. Once again, we apologise for the large rise in premiums, but unfortunately as I am sure you are aware inflation is currently running at 10%, so therefore, your premiums have not been increased by the standard 5%. Instead, we have assumed inflation will increase dramatically in the next 12 month period, and have therefore decided to raise our insurance premiums by only 35%. We have already deducted the next 12 premiums direct from your Bank A/c. Yours sincerely, A. Ripoff. ` bAONop~A NȤBm <r4<A퀄N2f2A퀄ai/?pNprNEFpN"EVpNNA퀜 24NNprNE\pN"ElpNNN&<:<adNьab$NNprNEspN"ElpNN <r4<A큔adNьaaNNpr;NpNEpN&pr=NEpN" <r4<ALada`/ <r4<ALadxa`6<$2<azA//A//NgdprNEpNp rNEpNp rNEpNp rNEpNp rNEpNprNEpNA//A//NgdprNE)pNNu <r4<ALa^gbpazpazprazptPr`az E;pJNNpazpazprazEpBNN6<p]tSr|ay`fpazpazprazp4<r_ayEpNNNpaz\pazfprazjEpCNN6<0<4<r{ay: <r4<ALaba^/ <r4<ALaba^6<?$2<ayJNup axr!fLpajAa_d <r4<Aa\gA0B0` <r4<Aa\gA0B0` <r4<Aa\gA0B0` <r4<Aa\`gA0B0`v <r4<Aa\8gA0B0`p <r4<Aa\gA0B0`J <r4<Aa[gA0B0`$ <r4<Aa[gA0B0`N^HH/N]HHgN$/ <r4<ALa`a]]HH/N$/ <r4<ALa`a\^HHgA0B0`PN$/ <r4<ALa`a\]HH/N$/ <r4<ALa`fa\^HHgA0B0`N$/ <r4<ALa`*a\P]HH/N$/ <r4<ALa`a\(^HHgA0B0`N$/ <r4<ALa_a[쐟]HH/N$/ <r4<ALa_a[Đ^HHgA0B0`$N$/ <r4<ALa_ba[]HH/N$/ <r4<ALa_:a[`^HHgA0B0`N$/ <r4<ALa^a[$]HH/N$/ <r4<ALa^aZ^HHgA0B0``N$/ <r4<ALa^aZ]HH/N$/ <r4<ALa^taZ^HHgA0B0`NrV^HH/N$/ <r4<ALa^(aZNmBNmBN$/ <r4<ALa]aZ^HHgA0B0`|N^HH/N$/ <r4<ALa]aYАmBN?mBN$/ <r4<ALa]xaY^HHgA0B0NuEXpDN/ < OK NXr"_tau+AjEpJN/ aw.A킄 24NCDawA킌 24NCJawA킔 24NCPavA킜 24NCVavA키 24NC\avA퀄0B0 <r4<A퀄auf< <r4<A퀄aUgA퀄atDA퀄aVr#Npa|a{ aufGpr$NA>rNA>NJBWHH/A>N BfJAfЀWHHgpr$NADrNpr$NAJrNAJN&<x:<aT0gpr$NAPrNp r$NAVrNp r$NA\rNA\NJBWHH/A\N BfJAfЀWHHgBmA퀄0B0 <r4<A퀄atPflA퀄aUnrЁrNA퀄aU\("mNZrNA퀄aUD("mNZ/A퀄aU0("mNZ"_akgA킴0B0atfG <r4<A킴aSJ/A>NA\aRADNA킄aRAJNA킌aRAPNA킔aRrAVNA킜aR`A\NA키aRNgEpa}/Ep a}r"_tap+AjpjfA>NA\ 00ADNA킄 00AJNA킌 00APNA킔 00AVNA킜 00A\NA키 00A퀄0B0 <r4<A퀄arf,A퀄aS/A퀄aS("mNZ("mN"arfGE@p a|raaVpayXA\axp,axA킄axp,axA킌axp,awA킔ax|p,awA킜axnp,awA키axZA퀄0B0 <r4<A퀄aqf4paxp"awA퀄aR("mNZahp"awp,awaqfGpa_XANVA//A//NgdA탊aqNuaxA//A//Ngd <r4<ALaVJaRp/ <r4<ALaV0aRV6<$rdalA//A//Ngdp rNEpavA퀜awLp)a{agA//A//Ngdp rNEpavNANNANNA 00 <r4<AaOgA0B0`A퀜CaOg A퀜C""Nu <r4<A퀜aO\g*EpLaz/ < OK a{Pr"_tamx+Aj`A퀌aQ8~ANȈN9pr)Nau <####a{NA퀜anNNA퀜anA퀼 004-mA퀜C""` A퀼C""EpIA탺apN>pjfA퀜anDNuA퀜aPR~ANȤA퀜aPR~ANȈA퀜aPtR~ANȤavbA//A//Ngd <r4<ALaTaP:/ <r4<ALaSaP 6<$rdajprNEXpatprNEop/atA//A//NgdprNEpatpr"NEpatnprNEpatZp rNEpatFp rNEp at2p rNEp atprNEp at Bm:p1AaxA퀜 24a|pC$anEpAZanEpA`anEpAfanEpAlanEpAranA//A//Ngdpr'Npat*as( -f m!HAA//A//Ngdac&N4BAa\h <r4<A4a;Z/ <r4<A4a;DgLaN(a^* <r4<A4a;"gA퀜C퀄""`&A//A//Ngdabaa&prNA&<:<a9 a5a5b+@`a~&<:<a8a5a5B+@Bm:Nu4-BfaN9A//A//NgdpraxEapDaYpaYEåpaYpaYp]aYN;4pazADa5 <r4<ADa3 / <r4<ADa2gAa4+@NI`Z <r4<ADa2/ <r4<ADa2gA퀌a4L~AazpA퀄0B0A퀌 24A퀄aRf8A퀄a4/Aa4/A퀄a4*("mNl("mN"aRfGAC퀼""A//A//NgdEíp@A탺aS|N>N;4A//A//Ngdpraw*EapDaXDpaX EåpaX:paXp]aX`0 <r4<ADa1gaDEp3a\|/EEpa\nr"_taOJ+AjaDXpjfdA퀄0B0A퀌 24A퀄aQf*Aa2/A퀄a2/a\*("mN6aQfGA큜0B0N;4`x <r4<ADa0gA0B0N;4`J <r4<ADa0gA퀜C""N;4` <r4<ADa0/ <r4<Aa0gAaNN;4` <r4<ADa0L/A퀜Ca/gAaOxN;4` <r4<ADa0/ <r4<Aa/g& <r4<Aa0tA 00N;4`P <r4<ADa// <r4<Aa0bA퀜a/:g <r4<Aa/N;4 <r4<ADa/pg@NuaW A//A//NgdprAatEp aUprCat~Ep aUA//A//NgdpratTEp aUjprat@E paUVpr at,E4paUBpr6atE;paU.pratEpaUp r asEBp aUpr asEp aTprasEp aTprasEp aTprasELp aTA//A//Ngdpr(asvpaUJaT\prasdp aU8aTJpr'asRpaU&aT8pr=as@paUaT&pras.p aUaTp rasp aTaTp ras p aTaSp rarp aTaSp rarp aTaSprarpaTaSprarp>aTaSprarp>aTaSprarp>aTraSNuA//A//Ngdpr)artaS <####aXaxDA 24ayaxBprarHAa./z("ma}aDLAa./z("ma}0(QDaTaRpr(arAa.V/z("ma}ZaDAa.aqAa. /z("ma}aCAa-/z("ma|0(rDaS|aRdpraqlAa-/z("ma|aCpAa-/z("ma|0(rDaS2aRp raq"Aa-x/z("ma||aC&Aa-^/z("ma|b0(rDaRaQp rapAa-./z("ma|2aBAa-/z("ma|0(rDaRaQp rapAa,/z("ma{aBAa,/z("ma{0(rDaRTaQ

HxHxx"maxnad/x"max^/NEAacx"max ` <r4<Aa'g/0-H/pЭfDAaMd"_a8p a9C탴aAp+@r` vf, mC탴aA$m $m"aeA탴a7p+@r`t DŽvfBf`d ҄vfJ -fAaLp a8/0-H/pЭfDrҭfAaM"_a7bC탴aA\p+@r`p vf+|Єvprf$m A탴aLDCaA&pv]HH/pvnB$m SfnB ̈́vWHH/$m Sf^HHgRf`: ˄vWHH/ -fnBpvWHH/ -f^HHgSf0<faED ĄvWHH/ Ȅvfp. Єvfp. vWHHgpAaKp a7g0-HSAaKBCa@$``LtA`f&aEXA킄azaDpXaIZraKa5,a>hfGaE.aCaE&aCA클0B0pjf4A$0B0aDpaCpMaCpaCpxaCA\aD4aDA킄aVaDvz(-"mama4aCz(-"mampaIa4p.aCfz(-"mama4pz(-"mam0(J@o&aDfA킄aVaDz(-"mama46`A$a<z(-"mamj0(J@o&aD"A킄aDVaCz(-"mamBa3`A$a;z(-"mam&0(J@o&aCA킄aVaCz(-"mala3`A$a;|z(-"mal0(J@o&aCA킄aVaCx"maja1paA| <r4<A킔a/??x"maj0(a8:&a\apa@x"maj^a1 aA, <r4<A킔aR/??x"maj20(a8:&a a a@x"maja0a@A킔aa@z(-f"maia0a?z(-f"maipaEa0p.a?pz(-f"maia0za@A킔aa@*z(-f"maia0Xa@dA킔aa@z(-f"maia06a@BA킔ada?z(-f"maida0a@ A킔aBa?z(-f"maiBa/a?A킔a a?z(-f"mai a/A킔arFЁa?aMa/a?a>|a?a>ta?a>la?A킔aa?PEĊpa>z(-f"maha/va>Pz(-f"maha/`p,aCza/Ra?^p-aCla/DAt0B0 <r4<Ata84f,a?,A킔aNa>AtaB("mah8a.a86fGa> <Pxa=A\a>FAt0B0 <r4<A킜aAta7fa>a=ra7fG <r4<A키a/ABa)EĽpaA~/EpaApr"_ta4L+Aja)Zpjf /0-HfAa?"_a)p a*C탴a3p+@r`pvWHH/ <r4<Aa -fgBAaS("maba?a0<ea7"p+@r``pvfzAa>Ca2J0-aaL&<x:<aBAl 00AlaDa@"HAa( /Ala,Ra@"_a'pPa=C탴a1p+@r` ҄vfAa/pPa@(CaG$m "-f$mҒaUp0<fa6TA퀄0B0 <r4<A퀄a0|f*A퀄araU6A퀄a("ma`a'>a0fG$m "-f$mҒaU0<ea5pPa?C탴a1"p+@r`pvWHH/pvWHH/ <r4<Aa4 -fgBAa("ma_a ԄvfACa.,`&p vfBf+|Єv` vfN]prfpPA탴a9Ca-pv]HH/pvnBpOfnB ̈́vWHH/pOf^HHgRf`: ˄vWHH/ -fnBpvWHH/ -f^HHgSf0<fa2 ĄvWHH/ Ȅvfp. Єvfp. vfp. DŽvWHHgAa 0/A("ma[`8A탊a,T0<fa1A//A//NgdpraPE[p0a1praP|Eŋp0a1praPhE[p0a1~praPTEŻp0a1jp raP@E[p0a1Vp raP,Ep0a1Bp raPEp0a1.p raPE[p0a1p raOEKp0a1praOE[p0a0praOE{p0a0praOEƫp0a0praOEp0a0praOE[p0a0praOxE p0a0praOdE[p0a0zpaPADa xA//A//NgdA탊a*NuN_ <r4<A큼a /Aa g:Ara$ptAaM/ A큌a  pa pa!C탖a*&A태a3A태C탖a#/ A큼a  <r4<A큼ap/tA큼adgp*a3C탖a8SA탖a4"HA태aCa)A탊a)(NuN` <r4<A큼agNaNuN` <r4<A큼agbp.a3xC탐a8>Jf <.PDBa3vC탐aFC탐a)@`.pA탐a4p.a gEEpa2C탐aC탐a)NdRNuA탊a(hA//A//Ngd?<NAT+@npAЭna2EHpa xC탖a(A태a2TA태C탖a"|/ A큼a  <r4<A큼a /tA큼agp*a2C탖a7LSA탖a3x"HA태aVC탐a(PA탊a'NuA탐agxAaVVA//A//NgdA퀄0B0 <r4<A퀄a&fA퀄araKpa-a,a' fGp r!aKEOpa,pr$aKEap a,A탐rapa8a8A퀜 00A퀌ar ~AaM <r4<A퀜agA퀜0B0A퀜C""A퀄0B0A퀜 24A퀄a&,fbpa7Aa8A퀄a:/z("maV>a8A퀄a /z("maV$a8A퀄a/z("maV a8npa7>A퀄a/z("maUa8NA퀄a/z("maUa84A퀄a/z("maUa8A퀄a/z("maUa8pa6A퀄ax/z ("maU|a7A퀄a^/z ("maUba7A퀄aD/z ("maUHa7A퀄a*/z ("maU.a7A퀄a/pAa0z("maTa$fGpaxpaA큔aBm NuA//A//NgdA퀄0B0 <r4<A퀄a$rfA퀄araI,pa+a*a$fGp r!aIEOpa*&pr$aHEnp a*A탐rapa+ A퀜a*np,a)A퀄0B0A퀜 24A퀄a#f>pa*p"a)A퀄a/z("maSap"a)p,a)p"a)~A퀄a/z("maSap"a)^p,a)Xpa*p"a)LA퀄a/z("maSaRp"a),p,a)&p"a) A퀄an/z("maSra&p"a)p,a(pa*,p"a(A퀄apa)pp"a(2A퀄a/z ("maRa8p"a(p,a( p"a(A퀄aT/z ("maRXa p"a'p,a'pa)p"a'A퀄a"/z ("maR&ap"a'p,a'p"a'A퀄a/z ("maQap"a'p,a'a!fGpaXBm Nua.Aa*Aa*pa,pba/ maa,|"_abaHpa,lpcal/ mara,X"_a>a$`.2a b?HnF?<6NAP0.PTHNu 24&8:BfJBg f DfpNuJEgpNu 24&8:BgnpNu<ngfDcpNufAcpNu 24&8:BgmpNu<ngfDdpNufAdpNu 24&8:JBgfDf EfpNuJEgpNupa JkpNupNua,AHPB?HQ?<NNAP _NuDExa*`bDEa"`ZaR11!Nua11!Nu 24&8:DE`6 24&8:DB`&a&8:DE`DEx`a` 24&8:HnghDBHngXDE~<En g6@ABDFGcGcGb8(vHDl`G8BCHC` GHD8HD쬵k&Dуd QRB BbJjDBNu DENupN֓DjdDA@ cAр[SBoJjDBNurptNuH@g0J`Ѐ[rGoJjDBNu0ftNu@[rB oH@JjDBNu $HkBk Bj*DBNupNuDBBkBjDBDNuf gp`C 246jDCCe0 C/jC C@j C jr0H@{0>H@Nur{0Nu{0NutNu 246j(:<DCaf AfBfNu`Va 00Nur$o, b4< J@k @[H@NuH@RBNu4<Ѐ[NuDg8k2 b4< J@k @[H@DBNuH@RBDBNu4<Ѐ[DBNu4H@Ѓdh`^HCH@:">H@`H2g&HCH@:<HC>H@Ѓd(`HCH@:H@r` gDBgkDE`HDBDEaBDBNugDBa8DBNutNua 11!Nux`xa`a` 24&8:HoHoEBJAgJDfr:g,|HC҅H@:ۆ<HC>H@Ѓd`vHCH@:H@`fgDBgkDE` DBDEaDBNugDBaDBNutNuHoHoEBz:g|HC҅H@:ۆ҄ۆ<HC>H@ЃdHA@B@H@хk HAҁHAрSB BbNuJBj^tNuk(g.JBjDBAр[SBDBjNutNuAр[SBkNuJlNu0gH@rJBkB JkЀ[`DBЀ[`J.;gP:pr4<Nup`@zxa2`Ba411!Nux`4 24&8:`& 24&8:`a&8:` &8:@ABJEoHnfNup`@tNugDEDBHngDBEBkQ*HEJDg?<>0rHGGdHGGdSWDуdi?<>0rHGGdHGGdSWDуdi ?<>0rHGGdHGGdSWDуd&2 H@kփAр[SBkփejRAd RdQRBJjDBNutNu?<,>CEdGH@0r`xJCgz?<0rÐdSWЃdi?<0rÐdSWЃdid?<0ÐdSWЃd&2 H@kփAр[SBkփejRAd RdQRBJjDBNutNu?<0riR?0i?`?<`"_K|MIgO:HQ <-H*,`N,>d d3 d# d# # d# # # # d ALH dAL H LH d AL`H L|0H>L|H>d~# # # # A`@ALH L|H>L|H>L|PH>L| H>L|H>L|H>L|H>L|`H>L|0H>L|H>QL|Nu$H$&"BA -KaXA"f B &nNuH>dd2d"d""d""""d LHC dLHLH C@d LHL|H| L|H|PCd~""""C`:LHL|H| L|H|PL|H|L|H|L|H|L|H|L|H|@L|H|pL|H|L|H|CQL|Nu`Na8A-Hhp apMa=@F?<NNTT@A0r p0Q`pdr ta0.F=@=@ACp,2QAp 2Qaa:``peahp`(p?a(arapaHz?< NA\?<LNAfCR2A0A82r22a"<v$0<NBLNurt=@:=A@=B2::(   F..26"8@"PQ1!P1P!0PP`0  q#p"AӘQNuA Nu|^|  R^,T:Hz(` NvHz ?<&NN\Nu9PgNuWPNuaaaZa O: n*NNuNuNupc?a0QNurdAd6Ag,B(dB(dH Ac<atgBAp`NuNu?<OA`d?<IA`Z0<H IaLt Ig Og Ug Ag Rg*afNup`a~p`60afHRaZ>Er$Wgr STD:gr COM:g r LPT:f2FA$_0=@D~CA0< BhaB2"pNu$_AF Ge><QBAFpNuahgzp=` a\gzp=@AĄCdE^GIjK<MFQNPRFISU[WKXZy\S]_^`Rb cyd݉Pf9:gnhdj7kYl mznoqm>r us ttuavwaTaRFBd&8*L?a<aSF Be BgQRB`RAdR e <rRF&0xaCձfEv+0JFjDFv-Hƌd0BFHF 0HF0ANuprt|`HQ2.d Aeg>r C 5e&!R 0c 9c0`<R"_`VC0 Ef"_Nuaa/ CFr  g 00VJAgB @ nN @mHJ@j0.4DBUBk0QSAg Q.`S@k 0`0BAF "_Nu.WAkQA 0g`prt|P;Q:  g +g -f .g40  b 0e 9b da6`RF` .f 0e 9b daSF` Eg efX +g -f 0e 9oSH`00  b&Hz0  b E Do`ZJjDDDS4<.aJFkSFk4arQa`&HaFFaZQ&8*L/a:,H܆jDBJ.:gtBn:Nu(:HE:a`4JVHHarЁЀ`z@`z8H@0`z(a^*d2d2d"d""d""""d"`""""""""""""""""QjNup"X2g6C/ !UAk$!Q"_Nu @$@JfS a`QNu$Aa`QBNuHza`HzaH `pHPHQ0(ika $I _aIUd4Id4Id$Id `$$$$Q _Jf,aId4Id4Id$Id `$$$$Q @NuSa^IdIdId`Q @Nup `-/ a&$I> _aG` VNuag`af`ae `ac` acpNuadpNu/ a$I> _a4Ae4v` VfANuHP0(R@kBa $I _aIUd4Id4Id$Id `$$$$Q @JfNuNup `,ahSAfNuag`af`ae `ac` acpNuadpNua4SAkfUANuH HPhkJa& $I _aIUd4Id4Id$Id `$$$$Q @JgSL`QNup `,:aȰAf` VNuag`af`ae `ac` acpNuadpNua4@m4v` Vf@Nu/HP0(X@kHat $I _a\IUd4Id4Id$Id `$$$$Q @Jf$Nu $Nup `+aYAfNuag`af`ae `ac` acpNuadpNuaSAkEF$p VfWANuth`tpa ".Nutj`t@H|`t)`t` tr`t2`t@-A=B|`H@-@|p`HAHBHCHDHEHFHG-HfAD-HH@-@H|p`V&<x:<aaJjNuHP"X2AF-H AerQBp|a`rHpx`6H$X4 Y0CF @depdQBC B2et2QBpZAF-HA-HaA"HJfS  _apAa"QAF"HJfS  _aPAF`QLJ@Nuz`z `z8.^n\Dn\@Hp tr=ED`n\n^HB=@Bnp rt=|D`n\n^n\n^A0000000000prt`Bp'rta n2rt6(SC0(S@apaB\papava0pa _a\4$FAFp_@[000][vx`* [g" ]g |g QSx` xQSrQ][vx`* [g" ]g |g QSx` xQStQ]BAF0-H,=@p4aL2HNu 24DBaDB11!Nu 24DBa DBNu 24x6o<Ce(FC BdЄeNu B/dHDDdRdQRBNu&<:<`g BbUC BcjNu BcHDDdSkg RBAрjNuNu0ftNuB H@"jNu Lx6oFCe0FC BdЄe!Nu B/dHDDd`A*p4. g=BNuA*pBQBX".g paBNuprapHP?<NNT~U@g~tb3ARpr0 0BBB R@ @fAR0000PB0Tp`00000\0X0Tp`T@00000P0BXpnT0raVA0p1| 1AQBX0$HTH0P P0Tp`0NuH(Fa$L(FNuSk [0NupNupa`!p>`HPaa _&X Pf/|~Kzag @ ep 2tC^"2 S@HQC)ػR"_d BTAA3ApCR4$I2a222B"0@2A\xva@gF2#M 443BS@ -f HQC)ػR"_d@BAAb8RGRC`3RSG5G5C J1DcaRF Fe `RG GdNuXARSF1F41R1h4x1EDg"<Rp-A`&~dGdEH<Nup` 0@F@AJhg PLNu`LJg(HPBHh/??<@NAXLf ѨLNuJkp%`aJBja!| ??<>NAXOJkpNu0< aF`0< CF2p`p a0`p CFp`aCF"p`Hza `Hz"J`pB.@=|DNua.@FpAR@C`N @H` @HHyaۼa"H`Hy`Hy 24`@H` @HHyaۄa"Hav`Hy`Hy 24`aX`$aR@ApDrAeA`?a0J@g*?CJap0g?C2paxSWfTNuB.@=|DNuB.@a=GDgNup`&a`aCF"E p`4Jg$_a: HN$_a: HN$_aBHN$_a؄BpHN$_aB0HN$_axBpHN$_alN$_ab؄N$_aXN$_aPN$_aF 0HN$_a:؄00HHN$_a,p0HN$_a 24N$_a:p 0HgpN"X I"_(*UGk*<(؆QNp`p`p` p`pJPg` $_a!HN$_a؄1HN$_aHN$_a 00N.@<.DAp$I"t Q k"RGef~`SG * g *fSG`<.DjZ\FkBJn`g Fgd Fg^HS&I.aQ`p???<NM\Qj&_NuHQ/?4(g8HP b6 a^$_// Z4HQ`S@Q _Q _a, _Nua$`p`AFtЀvQBNuAFt0 9c^QBNuAFt 0QBNua`a`aCF 0gS JfS`z@a Acr `@a A cr `@a\ A cr `N} $H`Ha>LHP?.d=hdN} =_d2 "@$Y4Ad2`0Q @NuH@&g( b⸃bLHaLC 0$Ir `Q"Jr0XDQD@CtEe PA`fRشf`e"J*c j|0"cRLJgR $I.f) 5e*0!.g -g  g 9f 0b`RB` 1`p `@`r ??a"P02R@H`2Q Nur ?HQa _/ ?a0 _4gSB@c:Ad,J@gB@BmS@,. RB6Vg(R F"GQpNufJ@fRB`fS@kVft0HNuaaJjtNuaHPa pJk NuCg.BJ@g  g &g, $g %gN}NutNuRpt`2Rpt`Rptr ae OgX Xgn HgSRB ae Fb$0k  c_  c b退`tSHkaNuRB0 b b瀀`RB0 fрd`ap`ap`ap3`B\Nu>.D<jRGg>VGg:TGjp`HPa0CF$IpR@  f _aHd2Hd2`"QNu` 6<.DHSGFaAEg f< &_Nua`(Nu.dfa dB\=n`r>.D<jRGg:VGg&TGjp` <.DaAFa$JkNup#` z fa2a ` z f a"a AFa  f#\JkzNu0:g0.D<jRGg(VGgTGjp`<.Da&` z faa x` z f aa `AF "g pR@0 ,g  g  fHp`:pR@0  g  g "fR@0 ,g  g  fHpRU@"_  f#\$H _a>`QNupR@0 ,g"  g  fa~ (fR~Nua ~ `a~NuaJkHQ ! gRf _NuXX~Nu0j \@??<NMXJk .dgp Nu`\<.DHSGFa ,g gAEf< &_Nu ."Ff +"g ,g`HU2<.,HdY=ANu?<*NAT.p a Ha INu.k2@a.0H@av.`2H@af/0@aZ/Yda@HA`Y6 :fRS@g.t;ak&AA :fRS@g t;akIA??<-NAXNua0g2.k.tak$6g .fS@gt atkAg A .fS@f.Nut a\kAg6 /fS@gtaFkJAgކA /fS@g4<;a.kAjA AbAPjAdYA??<+NAXrNurxS@k0  bS@k .g( :g"0  b DBb BdeS@jJANuSR@JANup`p`HP  if"Y(d.ЀЇЀHq.؄؇؄AHĘ aHPa"_ WBhad"_ _`l$Pt4(gRBB&D%(Nu"X Pf(d.ЀЇЀ.؄؇؄HqHAHaH HQaҾ _"_BBa]tv`$P4(gRBC%(\cNua$ZXNuHzxlJj xo`xdJjxc, EJDD`DDD Dz$X Pf-K&e "&J$IpSNup` L4 fd$R$&k(*ڄNdNjRofNu.#He(*NdN$&Rgp$(؁*Ne*(NdN(*Ro2(NdS(So&*NdB*RRNf$f$SD`S(l//"a R"mxNupЂmlNu@AB`tzH?FHSaH>&IUGj&_NuSGkpg g gt Pf Ug DfQ*R`P*R` Cf Ofa>aRa` Tffa&H*.` Lf Tfa DBL8*./a&.` Rf Tfa` Ff Dfa/HazHL*.aL8a:9*Dg L*:aL8*aƺH*L*.a֤DBL8a:9*Pg L*FaɾL8*"a|H*".aHJ9*RfprtaѬ` Bf KfaDB`< Mg Dfb Ag Rf MV AVaHaJg L8*apH*aJg L8*"aVH*"Jgp`Z Sf Xg YfaJBfpH*F`DatJBftH*:`/a.Nu/aŀ.NuL*"an^?L*an\2NuJBkRBa>dRNuSB`tNuL?FH8FBn~NuSGk g ,g ;gSRG K /a>.JkȞHNurd A*LNu9*Rf <r4<NutNuH*NuH*"NuH*.Nu 24JBkCkNuCktNu 24JBoSBNugRBNu2(gbc  P"H`Nu/0Ha2  _ PSAvjx E(Wf* ae zb Q @NuBnp`pBnp`p=| p|=Fn@=@b=n`ranHj=Ah~`:a JfBH@ RfF.f Kg" Mg sg tg Pg Hf~`xSGjtRGFcn>`jAF gp gj g grffnnpenbfJ.fj6pRGFc$SG` J.fjpRGFcRF` Ff`> `?~ap a0p a*0Nu|``CpE`bf`FgRGJGgSGSFFgCpE`Yf`Nua@Jf gH@ fa(@ fza0 b @ Ee0Nua.gNu4.rf?Hya|NM\Nu=|D`LjazEfpadppa`AFEg0PaEfaFRE`ܾEfp a@a8?nnnp a2RF`<annoS@f nhfSnl=Ah=FnNup` papq4.rf?HyaNM\Nu=|DHa.LNu|A0"P2(@e2<EF`QHP=|DJ@g$abAF$HpR@ 0 f _a`QNuHPp?ap a| _2<|0`HP$ZXAB6<Q _NuHzF`Hz~a$_HaC`2Hz*`Hzba$_HaC`2E`EFHaCZA`E`E*HaxC>A *FM3x?Fc>֞VSGk Vf>FNuTNuHpr,.܆އ܄ޅ܆އ(sh*sx<3h>3x?Fc>֞VSGk66Vf >FLNuTLNu,.܆އ܄ޅ܆އ*sh'xh'x:sh7xh7xNu,.*rh%xh%x܄ޅ܄ޅ*sh'xh'x:sh7xh7xNuC&pHQ/Hy@NA NuC pa:NuHQ/Hy?NA Nu&g4 FgagJAga2< R@AdSf0Nu0ap Ce`&g4 FgaJBjagPAe CbRa R@Sf0Nu FgRag JBja㒰AeaJAg RP0 pNu`h Fg6aHgJAga @eaRRP Nup NHѨB?<?/?<BNAO JkLLNu&8aJBjaJAg Df*ڃkd0Nu DfրBH??/?<BNAO LJk!@NuHBHh Hx??<?NAO LJo ѨLNuk:fp`^k: g ѨNuBHPHQ/??<?NAO _JoѨfNuBHPHQS/??<@NAXLfѨNuJkp%`rSRH0a=GDg:LFa@c.܆܆ ISk"X0HHa:a>L`Nup`p`&nAt6<X0QNurSRH0ab=GDgkLFa I-Ka"`c.܆܆BGP`agRSj QNu`:HPG<.Dx agJBja*AeajJAgZRP0 ögR@Ae`U  fSC̗ &n _a:ER@Hd2Hd"Hd `""""Q\J@Nu _HzHP`pNu _S@Gd@GHpp/0NuGNp?a0` ?a2@@a0` a Nu4.`Af n2LR@RANu4.`g S@SAHNutbpbr??pahpYab0a\0`VzpE*ZgP*\`LJg&B.C`a8aD*9*ffap-I,=|p4aHz*9*fg ENp9*Z`Ŏ _a &nO:NMIgK|$<Nu[1][Error +111][Return]Ez g g>Jf`Ar Hjr-D@Hd0H@H 0H@0CNuAF"H [1][fSEfNuD@v`v??NMXJNuJ@k??<NM"UAf J@fH@Nuaފj0fpNu\@`av`]@><CF Ipa<0HNuaZ`]@><CF Ipa Nu?|`?a80R@f|0aHJFkHPat _Nupo`@HSHP&I>g\SG??<NMXJk Q _t&_Nu&_`aJANuag `af`apNuapNuC`C``C` C`CJhfJfRRRRRRRHP? @CFH~8:E#P&<2 `b$bYEf`"RAf rЁЀ`&Ѐe "ЀeЁdp`XJAkfgRer?DDЁaAa 8$HX :CFE` YEjT"_$P"2trDDd0d d d` QjNu`aDa DNu na^ K"ng42 $`gk2&Hg Af deђ$`ebѐXf&nNu AgebѐA``-Kx$ n&$n""Hg8" &Ak cѐ S`g"" k#&Acё2+SAI3 Q&f-I"&nNu-Kx$&ր n&$n""HgR" k&Ac b S` S`g4" k#&AcbrkX`ޑ2+SAI3 Q&f-I"&nNuaP n2L6(n\n^HHHNua0 n20(n\HNua n20(n^HNua n20(HNua~:ffNuarNua J[HHNu:nfa@ z^0NuJg6$:Pf,H?<"NNT&@p/&ra :,ga &Lr`r??Q@HyNM\0Nu#Nu-Hb=hzBnfNua` nbafp0nfc`ݒNua/ ? nb"XfRnfSnzkx _g !g &g. \g.aڼ`RnfSnzkN`0"_fCpH`20"_`pR@RnfSnzk \f2"_gAc@@H?a0`^p?a\0H"_`Nup?aJLn`ڶHn nb"XfRnfSnzk _g,vxz| +g2 -g, *g $g& #g$a`RnfSnzk`` `RCSnzk _f Snzj`h #g $g *g.g ^gH +g^ -gX.fXxRDSnzkL #g ^g +g4 -g. _f.RSnzj`RESnzk ^g +g -fRSnf nb? JEf0DH2HgR@?=nxvjDnxL8n@aa<z Ndz* I0`  fEQNdS|$Ne Jnvj|- nb XfRnf0nfc|.g8 _g>.g@ +gN -gR $f ,fHQ!ahRnf"_p$RHQaX"_`Rnf`)  g *fp `Jnvjp-`Jnvkp `=_fSnfRnzNuHLn=BvjDBN{LxC*E0RJCfRCR@r2HAARACd ` Efr0Sb Eg4 5e.!A*e0R 9c0`R1R@0c JEr+J@jr-D@UEoJYEc0SEnHJEf0SEH@HdREf0SEH@H 0 0REfH@C* nb XfRnf0nfcJ.g _g .g +g -g HQaL`Rnf`Jnvjp-`Jnvkp `=_fSnfRnzNu"H YJQfNu YH瀀aJLP|HPGC&֛֛֛֛֛(HDDCBg6Cv6C[RCF8[[[aL6C[RCF8:GFWfTL L-KA `$I\bfBjQNu$YbfBjQNu؄*؄؅CH`؅X`$_  IaHR"H @`̘؄*؄؅AHNu؅X`$_ IaװHR"H`Hk*BkBjHDBdRNuRBfpNupNuRBfpNuDBBkBj DBdRDNuf fJAjNup`(UE  SORRY!| |Load or Create some|records first.ABORT SORRY|High or Med rez OnlyPERS_DBS.CFGThe System Date is not Correct, Please Enter todays date.Day: Month: Year: Loading ....Personal DatabaseOne Moment Please,Checking Data Validity. |You Have Modified Data|Save Amended Database?Yes|NoPERSONAL DATABASEPD (Shareware) versionSETDEFAULTS Records: #,### Free Memory: #,###KFree Disk Space:1990 : BAY COMPUTERSTel:(0524) 831162[A] Add NEW Record[V] VIEW/MODIFY Records[P] PRINT/SEARCH Records[L] LOAD Database[S] SAVE Database[T] TEXT PROCESSOR[Q] QUIT programma 96,84 tt 180 fd 5 tt 90 fd 12 bk 12 tt 180 fd 5 tt 90 fd 10 tt 180 fd 5ma 114,94 tt 90 fd 17 tt 0 fd 1 tt 270 fd 12 tt 0 fd 1 tt 90 fd 15ma 95,168 tt 180 fd 10 tt 90 fd 12 bk 12 tt 180 fd 10 tt 90 fd 10 tt 180 fd 10ma 113,188 tt 90 fd 17 tt 0 fd 2 tt 270 fd 12 tt 0 fd 2 tt 90 fd 15REGISTER AS A USER NOW! | ONLY 10 |LATEST VERSION & MANUAL 1990 : BAY COMPUTERS| |3 Teasel Walk, Morecambe | Lancashire, LA3 3QQPress [Return] for no-change or [Esc] to clear.PROGRAM CONFIGURATION (System Variables)Address Label Print Quality: (0=Draft, 1=NLQ) Left Margin for Labels:Label Height (No. of Lines): Left Margin for Documents:Paper length (No. of Lines): (Norm=66, A4=70) Paper Type (Feed system): (0=Continuous, 1=Single Sheets)Required Name & Address (as Printed at top of Letters) | SAVE NEW |DEFAULT VALUES YES | NO (Max = Select Record No: ** SORRY ** |The PD (SHAREWARE) version | is Limited to 10 Records [F1] - Duplicate Field as Previous Record [F10] - Exit Edit Mode ENTER SEARCH CRITERIA (Press return for default, or edit as required)Search Records (From):(To):Surname:Address:Telephone:Infoline 1:Infoline 2:All SELECT SORT FIELD (Use Cursor keys & Return to select)Abort Record No Surname Infoline 1 Infoline 2 SELECT OUTPUT DEVICE: Screen Printer Mail Merge Disk (Export) PRINTED OUTPUT STYLE Listing Adr Label Sorting Currently Printing Selected Data:\*.EXPCurrently Saving Selected Data Use Mouse to Select Record [F10] for Menu [SPACEBAR] for next screen Sorry, No records match the Search Criteria. Use Mouse to Select Record [SPACEBAR] for Main Menu ** End of data marker **SELECT DOCUMENT TO USE LETTER-HEADED PAPER| |Do you wish your Name/Address|printed at the top rightYES|NOPRINTING DOCUMENTS [Esc]-Menu [Undo]-Delete [M]-Modify [L]-Addr Label []-Page-[ [F1] - Reset Field As Installed [F10] - Exit Edit Mode | WARNING|Delete this record?| Please ConfirmTitle(Mr/Mrs/Ms/Dr):F/name:S/name:Post Code:Comments: |Save Amended Record?Print a Label Test PatternMx1Dear Is Next Sheet Aligned?Press any key when ready | NEW DOCUMENTCOMPOSE|LOAD|ABORTHELP available |EXIT EDIT MODE PRINT|SAVE|ABORT |What shall I do|with this document? Px0EDIT|SAVE|ABORTPRINT|EDIT|ABORT ** CONTROL KEYS ** Use Cursor keys to move cursor as required [Insert] insert a newline [Cntrl]+[Y] remove current line [Cntrl]+[C] Centre Text [Shft]+[F1] mark line of text [F1] Duplicate marked line [F10] Exit Edit Mode ** Press any key to return to EDIT MODE ** MMG:\*.MMGPDB:\*.PDBOne moment please,Loading Data.Saving Data. b2 40:pV &L4 * : B\B$@$&HZ$T.ڰ(Ld428*r\X\ T$T  f\((@P\"&Xb08$pv2F  j  .| l>*$xV INTRODUCTION This 'Personal Database' is the first in a series of modules that will enable you to simplify and speed-up the retrieval of information. This module is designed for the home user who wishes to retain a file of Names & Addresses, and use that file either just for reference, printing address labels or printing customised letters (Mail merging). Output can be directed to the screen, printer or disk (exported). SYSTEM REQUIREMENTS Any ATARI ST Computer At least 520K Memory Floppy Disk or Hard Disk Any Epson Compatible Printer (Optional) Hi-rez (MONO) or Med-rez (Colour) Monitor or TV PROGRAM CONFIGURATION Personal version ------------------------------------- Field Title Max length 1 Mr/Mrs/Ms/Dr etc 8 2 Forename(s) 12 3 Surname 17 4 Address line 1 30 5 Address line 2 30 6 Address line 3 30 7 Address line 4 30 8 Post Code 10 9 Telephone No. 14 10 Infoline 1 60 11 Infoline 2 60 12 Comments line 60 OPERATION MAIN MENU The main menu will automatically be displayed whenever the program is run, it is from here that all operations are controlled. Above the main box of options is shown the current version number of the program, This program is constantly under revision and therefore you must register to ensure that you have the latest version. Registered users will automatically be notified of all upgrades. Also in the bottom right of the screen there are some useful indicators which display: 1. Number of records currently in memory. 2. Amount of free memory, available for new records. 3. Amount of free space on current disk in use. [A] Add NEW Record: By selecting this option you will be presented with a screen showing the new record number, and all the blank data fields. The computer in now in 'EDIT MODE' and data can be typed in where required, the following keys are also operational:- [Cursor-UP] Move cursor to previous field. [Cursor-DOWN] Move cursor to next field. [Cursor-LEFT] Move cursor left in field. [Cursor-RIGHT] Move cursor right in field. [Return] Move cursor to next field. [Clr Home] Move cursor to start of field. [Insert] Insert space at current cursor position. [Delete] Delete character at current cursor position. [Backspace] Delete character prior to cursor position. [Esc] Delete entire field. [F1] Duplicate field from previous record. [F10] Exit 'EDIT MODE' [V] VIEW/MODIFY Records: This option should be used to examine data in any one record, Print a one-off address label, Modify a record, or to generally page between records, at your own pace. This option can only be selected if there are is least 1 record in memory. On selection of this option you will be presented with a dialogue box, which will request which record is to be shown on screen. You may press [Return] without selecting a record number, for the first record to be shown. Should you select a record larger than the maximum, then the last record will be shown. The following keys are operational:- [Esc] Return to Main Menu. [Undo] Delete record shown. [M] Modify record shown,'EDIT MODE' as in ADD NEW Record. [L] Print an Address Label. [Cursor UP] Show First record. [Cursor DOWN] Show Last record. [Cursor LEFT] Show Previous record. [Cursor RIGHT] Show Next record. [Shift]+[Cursor LEFT] Show Previous record minus ten, (Go back by 10). [Shift]+[Cursor RIGHT] Show Next record plus ten, (Go forward by 10). ADDRESS LABELS When selecting to print an address label you will be asked whether you initially require a test pattern, (to check the alignment of labels). [P] PRINT/SEARCH Records: This is a very complex option as a variety of outputs can be obtained, but providing you take each step individually, then all will become clear! This option should be used for finding all records that may contain a specific search string, printing address labels for more than one record at once, Printing Mail merged letters, or just sorting the data (ie. Alphabetical order). OPTION BOX 1: In this box you should enter all the search criteria as required, relevant to the field to search. Should specific data search be required on any part of the address, then all the address lines will be searched for the address search string as entered. You can search for all or any part of a required string for example; if the surname field was searched for 'jo', then the following would all match 'Johnston','Mojon' and 'Smythe-Jones'. The default string 'All' means where applicable this field need not be searched, as all records will be acceptable. KEYS: [Esc] Will clear the default to allow manual entry. [Return] Accept as shown, move to next field. OPTION BOX 2: In this box you should select the field on which the data should be sorted (ie. The order in which the selected records are presented). Use the cursor keys to highlight the field required and then press return. OPTION BOX 3: In this box you should select where you wish the selected records to go. Use the Cursor keys to highlight the device required and then press return. In the event that you had ten smith's then all ten would now be listed on the screen. You can now use the mouse to select any of the listed records, by doing so, the selected record will be shown in full on the screen and the keyboard will function as in the 'VIEW/MODIFY Mode', with the exception that by pressing [Esc] you will be returned to your list. Should you select 'Printer' then you will be given two further choices either to print a 'LIST' of all the selected records, or print 'ADDRESS LABELS' for all the selected records. Should you select 'MAIL MERGE' then you will be shown the GEM fileselector and prompted to select the document you wish to use. The next choice will be to select whether you require your address printed at the top left corner of the document or not (for example, not required on letter headed paper). [L] LOAD Database: This option will provide you with a GEM Fileselector, use this to select the datafile you wish to load. The datafile must be of the correct format to avoid errors. [S] SAVE Database: This option will again provide you with a GEM Fileselector, use this to select the name you wish your datafile to be saved as. [T] TEXT PROCESSOR: This will allow you to compose or edit a document (letter) that may be used in the mail merge option, for example to send a standard letter to all people on the database, or a perhaps just a selective few. Should you wish to use your document in a mail merge operation, then you should ensure the document is saved, prior to returning to the main menu. Whe editing a document pressing [HELP] will show all the special function keys available to assist editing. [Q] QUIT program: Use this option to exit the program and return to the Desktop. Prior to quitting the program will check whether the datafile has been modified in any way, If it has you will be asked if you wish to save the datafile prior to quitting. PRICES: PD Version ???, From all leading PD Libraries STANDARD VERSION 10.00 CUSTOMISED VERSION 20.00 The PD version is SHAREWARE, and has a built-in limitation of 10 Records. All REGISTERED USERS will be supplied with the STANDARD Version accompanied by a fully comprehensive printed manual. (c)1990 BAY COMPUTERS 3 Teasel Walk Morecambe Lancs. LA3 3QQ Tel: (0524) 831162 1,"MR","BRIAN","CAMPBELL","3 Teasel Walk","Westgate","Morecambe","LANCS","LA3 3QQ","0524 831162","Author of this program & ST Pools Predictor","Hardware, Software, Programming, General Advice","Bay Computers",ress [Shift F3], which inserts an underline character. To turn underlining off, press [Shift F3] again to insert another underline character. All text between pairs of underline characters, including spaces between words, will be underlined. You can underline as you type, or return to a document after it's typed to underline passages. Don't forget to mark the beginning of each paragraph by pressing [Control P], and the end of each paragraph by pressing [Return]. 1 "Why," said the Dodo, "the best way to explain it is to do it." (And, as you might like to try the thing yourself, some winter day, I will tell you how the Dodo managed it.) 2 First it marked out a race-course, in a sort of circle, ("the exact shape doesn't matter," it said,) and then all the party were placed along the course, here and there. There was no "One, two, three, and away!" but they began running when they liked, and left off when they liked, so that it was not easy to know when the race was over. However, when they had been running half-an-hour or so, and were quite dry again, the Dodo suddenly called out, "The race is over!" and they all crowded round it, panting, and asking, "But who has won?" 3 This question the Dodo could not answer without a great deal of thought, and it stood for a long time with one finger pressed upon its forehead, (the position in which you usually see Shakespeare, in the pictures of him), while the rest waited in silence. At last the Dodo said, "Everybody has won, and all must have prizes." 4 "But who is to give the prizes?" quite a chorus of voices asked. 5 "Why, she, of course," said the Dodo, pointing to Edith with one finger; and the whole party at once crowded round her, calling out, in a confused way, "Prizes! Prizes!" 6 "But she must have a prize herself, you know," said the Mouse. 7 Edith had no idea what to do, and in despair she put her hand in her pocket, and pulled out a box of comfits (luckily the salt water had not got into it), and handed them round as prizes. There was exactly one a-piece, all round. 8 "Of course," the Dodo replied very gravely. "What else have you got in your pocket?" it went on, turning to Edith. 9 "Only a thimble," said Edith sadly. 10 "Hand it over here," said the Dodo. 11 Edith thought it rather absurd to give away her thimble just so the Dodo could give it back to her. But she handed it over, just to humor the old bird. 12 Then they all crowded round her once more, while the Dodo solemnly presented the thimble, saying, "We beg your acceptance of this elegant thimble"; and, when it had finished this short speech, they all cheered. Advanced editing with ST Writer If you recognized the passage you just typed -- it's from Lewis Carroll's whimsical Alice in Wonderland -- you may be aware that it contains some errors. Here are some ST Writer techniques for putting it in order. Each of these major functions is also highlighted in your Quick Reference Guide. Deleting blocks of text With ST Writer you can delete a long passage from a piece of writing without having to erase it letter by letter or line by line. In your passage from Alice in Wonderland, for example, paragraph 11 doesn't belong there and should be deleted. To delete a block of text you must first place markers at the beginning and end of the text to be deleted. First position the cursor under the first character of the passage you want to delete -- in this case, under the paragraph marker before "Edith thought it..." -- and press [Shift F5]. ST Writer inserts an inverse quotation mark at that point on the screen. Next, move the cursor down to the end of what you want to delete -- in this case, under the paragraph marker at the beginning of paragraph 12 (in order to include the [Return] symbol at the end of the passage you want to delete) -- and press [Shift F5] again. ST Writer places another inverse quote mark at that point. To erase the text block, press F5. The block will be erased without any prompts. However, if you change your mind about deleting the block, you can bring it back simply by pressing the [Undo] key. In fact, you can insert the deleted block anywhere in your text by moving the cursor to the desired location, then pressing [Undo]. Each time you delete a line or block of text, a failsafe text buffer (a temporary holding section of memory) is reinitialized and the deleted text is placed in the buffer, and remains there until the next deletion. The failsafe buffer holds about 40,000 characters. If a block is too large for the buffer, the prompt Too large for Cut Buffer, cut anyway? appears. Pressing Y will delete the block without saving it in the buffer. Moving blocks of text There's also a paragraph in your passage that's out of place -- the Mouse's remark in paragraph 6 should follow paragraph 7. To put things in order, you don't have to delete the out-of-place paragraph and retype it where it should be. ST Writer will move a block of text for you. The procedure for moving a block of text is much like that for deleting a block of text. Press [Shift F5] at the beginning of what you want to move and again at the end. ST Writer places an inverse quotation mark at each point. Finally, place the cursor where you want to reposition the text to be moved -- in this case, under the paragraph marker that begins paragraph 8 -- and press [Shift Insert]. ST Writer deletes the specified text block from its old place and inserts it where it belongs. Search and replace with ST Writer In your passage from Alice in Wonderland, the girl who hands out the prizes is of course not Edith, but Alice herself. But with ST Writer, you don't have to go back and change each use of Edith to Alice. ST Writer will search out and replace any specified string wherever it appears in a text file. To use this search-and-replace function, first position the cursor at the top of your file (a quick way is to press [Shift F1]), then press [Shift F7]. When ST Writer prompts you to enter the Replace : string, type in the word Edith and press [Esc]. Using the [Esc] key to terminate search strings allows you to search for strings that include the [Return] character. This is the text for which ST Writer must search. Next ST Writer prompts you to enter the text you want to substitute for the search string with the prompt With :. Type in the word Alice, then press [Esc]. ST Writer now searches the entire text for the word Edith, and replaces it with the word Alice wherever it occurs. This is known as a global unqueried search-and-replace, which means that all occurrences of the search phrase are replaced without further prompting. ST Writer can also perform a case-by-case replacement operation, in which you are prompted to confirm each substitution. Press F7 to perform a query search-and-replace operation. Notes on Search-and-Replace When you enter a word or phrase to be searched for, you must type it exactly as it appears in your text file. When the string is a single short word, like son, that might appear in your file as part of longer words, it's a good idea to type in blank spaces before and after it. If you do this, however, be sure to include the same blank spaces before and after the phrase you're substituting for the search string; and keep in mind that ST Writer will not recognize occurrences of such a search string that are immediately preceded or followed by punctuation marks. You can also use the search-and-replace function as a search-and-delete tool. To do this, simply press [Esc] when ST Writer asks for a replacement string. ST Writer will delete the search string and close up the resulting blank space, whether you proceed with a case-by-case or global search. Getting your text files in shape With ST Writer you can print what you write in just about any shape you want by using a variety of formatting commands. Some of these commands, entered in the Print Formatting Block at the top of your screen, control the overall formatting of your text file. Others, entered within your text file while you're creating or editing it, are used to specify variations from the overall format. Others still are used to specify some special formatting features of ST Writer. In the next several pages, you'll find instructions for using all the formatting commands, along with some suggestions for using most of them to shape up your passage from Alice in Wonderland. The formatting commands are also outlined in your Quick Reference Guide. Print Preview As you experiment with various formatting commands, you might wish to observe the results of these commands on the final printed form of your text without waiting for an actual printout. You can preview your final document on the monitor screen by printing the text to the screen instead of paper. To do this, press [Esc], if necessary, to return to the ST Writer menu, then select Print File. You are prompted Enter Printer, Disk, Screen, spooLer? Type S, press [Return] twice, and your text will be printed to the screen exactly the way you've formatted it. Stop and start the scrolling text by pressing [Control S] to stop and any key to restart, or escape to the menu by pressing [Esc]. Overall file formatting By now the Print Formatting Block at the top of a text file should be a familiar sight. Each of the inverse video (colored in low and medium res) letters in it represents a command that will affect the overall formatting of the file. The number to the right of each letter is the formatting value for that command. Shown below -- and in the Print Formatting Block each time you begin a new file -- are the default values for overall formatting. ST Writer will use these values to format your file unless, of course, you change them. To set your own formatting values, just move the cursor into the Print Formatting Block (pressing [Shift F1] is the quickest way), delete the number displayed for the value you want to change, and type in the new value. Try reformatting your passage from Alice in Wonderland to some new values, as suggested on the next two pages, or to values of your own choice. B12 Bottom margin: 12 half-lines, or 1 inch D4 Paragraph spacing: 4 blank half-lines (double spacing) between paragraphs G0 Print style: 10 characters per inch (CPI) I5 Paragraph indentation: 5 spaces from left margin J0 Justified right margin: OFF L10 Left margin: 10 spaces from left edge of page R70 Right margin: 70 spaces from left edge of page S2 Line spacing: 2 half-lines, or single spacing T12 Top margin: 12 half-lines, or 1 inch Y132 Page length: 132 half-lines, or 11 inches Line spacing, S, is set in terms of half-lines. For double-spaced printing, delete 2 and type in 4. For triple spacing, set this value at 6. Only even numbers can be used. (Entering odd numbers will cause ST Writer to use the next highest even number.) Paragraph spacing, D, is set in terms of blank half-lines between paragraphs. For single spacing between paragraphs, delete 4 and type in 2. Only even numbers can be used. Paragraph indentation, I, is measured in character spaces from the left margin. For more or less indentation than the default value of 5 spaces, delete the 5 and type in the value you want (up to 20). The number may be negative for outdenting. For block-style paragraphs, without any indentation of the first line, enter the number 0 (and make sure that your paragraph spacing is greater than your line spacing). Top and bottom margins, T and B, are measured from the top and bottom, respectively of each page. So, to change them both from one inch (12 half-lines) to one and a half inches, set them at 18 instead of 12. Only even numbers can be used. Left and right margins, L and R, on the other hand, are both measured from the left edge of the page. For wider margins, try substituting 15 for 10 as the value for L, and 65 for 70 as the value for R. You'll probably want to experiment a bit to find the left and right margins you prefer, depending on the print style you select (see below) and the kind of printer you have. ST Writer will accept values 1 through 188 for the left margin and 11 through 198 for the right margin. If you have a 40-column printer, be sure to set your right margin within the range of 2 through 40. The justified right margins command, J, works like a simple On/Off switch. The default value of 0 gives you nonjustified (ragged) right margins. For justified right margins, delete the 0 after the J and type in 1. Page length, Y, does not determine the number of lines printed on a page (that's set by your top and bottom margins). Rather, ST Writer uses the page length setting to determine where the next printed page will begin. Keep your page length set at 132 for 8 1/2 by 11-inch paper. 224 is ST Writer's maximum page length (for 14" paper length and printer setting of 8 lines per inch [Note: default lines are 6 per inch]). Only even numbers can be used. To print out a text file continuously, without page breaks, set your top and bottom margins to 0. In print styles, G, also known as fonts, your choices depend on what kind of printer you have. The default print style of ST Writer is 10 CPI (PICA), represented by the 0 next to the G in the Print Formatting Block. To format for condensed print, delete the 0 and type in 2; for italics, type in 4; for ELITE, type in 8. Although the print styles you select are not represented as such on your screen in print preview, the number of characters displayed per line is normally the same as it will be in your printed file. For double-column printing, you must enter formatting commands and values for the margins of the second (right-hand) column of print. Enter these commands and values at the top of your text file to format the entire file for double-column printing -- just insert them as if you were adding text at the beginning of the line just below the Print Formatting Block. To set the left margin for the second column, press [Control M], then type the number of the margin setting you want (measured in character spaces from the left edge of the page). To set the right margin for the second column, press [Control N] and type the number of the setting you want. To discontinue double-column printing, set the second left margin [Control M] to 0 (zero). You cannot change print pitch while printing double-column. Of course, you may also have to adjust your settings for L and R, which control the margins for the first (left-hand) column of print in double column printing. Always be sure that your first-column right margin and second-column left margin do not overlap. Also, do not make the T or B margin settings different for the two columns. Formatting variations within a file You can specify variations in the format wherever you want within a file by entering commands directly in your text. In addition, ST Writer offers a number of special formatting features; for these, too, you enter commands directly in your text. You can enter these commands singly or in combination, when creating or editing a text file. For best results, enter new format commands on a separate line (that is, don't type text on the same line), type a space after the numeric value for each command, and press [Return] to start subsequent text on a new line. Note: the one exception to this case is Print style, ([Control G]), with which you can include text on the same line. For example, you can italicize a single word on a line. Follow the [Control G] with the number (0 through 15) for the print style followed by a hyphen (or any character except for a number. This delimiting character will not be printed in the text. However, remember, you cannot change print pitch while printing double-column. You may do bold, italics, or elongated print in double column, nevertheless. To specify variations from the overall formatting values displayed in the Print Formatting Block, use the commands shown below, followed by the new value. ST Writer displays the appropriate letter (in inverse video) and number wherever you enter one of these commands. (These letters and numbers will not appear on your printed pages.) Bottom margin [Control B] Double-column printing: 2nd-column left margin [Control M] 2nd-column right margin [Control N] Justified right margins [Control J] Left margin [Control L] Line spacing [Control S] Paragraph indentation [Control I] Paragraph spacing [Control D] Print style(font) [Control G] Right margin [Control R] Top margin [Control T] At the end of the portion of text that you want varied from the overall format, use the same commands to re-enter the original overall formatting value -- or whatever new value you want for the text that follows. The special formatting features of ST Writer also require you to enter commands directly in your text. Again, you can enter these commands singly or in combination with other formatting commands, while creating or editing a file. ST Writer displays the appropriate letter or letters in inverse video wherever you enter one of these commands. Elongated print With some printers, including the ATARI SMM 804 Dot Matrix Printer, ST Writer enables you to print text in elongated characters, which are twice normal width. Any print style can be elongated. To format a portion of text for elongated print, press [Shift F9] at the beginning of that portion of text and [Shift F9] again at the end. If you like, try this feature in combination with the next feature described to add a striking title to your passage from Alice in Wonderland. When you examine a formatted text file in print preview, elongated characters are displayed as normal. But keep in mind that when printed they'll be twice as wide as normal, so anything more than half a line of text that you format for elongated print will run over to the next line. Centering text To center lines of text -- a useful option for titles and headings -- press [Control C] at the beginning of each line to be centered. At the end of the line, press [Return]. (If you decide to center a line while editing, don't forget to insert a [Return], if necessary, at the end of the line.) If you like, add a centered title in elongated print at the top of your passage from Alice in Wonderland -- something like: [Control C][Shift F9] Alice Gets a Surprise [Return] [Control C] For Her Prize [Shift F9] [Return] Always be sure that no line of text to be centered exceeds the overall line length determined by the left and right margins that you set. Blocking text right To have a line of text print out flush with the right margin of the page, press [Control C] twice in succession at the beginning of the line to be blocked. Each line to be blocked right must be ended with a [Return]. If you like, try this out by adding something like this at the end of your passage from Alice in Wonderland: [Control C][Control C] -- from Alice in Wonderland [Return] [Control C][Control C] by Lewis Carroll [Return] Always be sure that no line of text to be blocked right exceeds your overall page margins. Headers, footers, and page numbering A header is a line or two of text that is printed at the top of every page of your final printed output. A footer appears on the bottom of each page. If you want, ST Writer will place headers or footers of one or two lines on each page of your printed text files. By using a page numbering command in combination with a header or footer command, you can also have ST Writer number your printed pages. To specify a header, press [Control H], then type the text of the header and press [Return]. Enter [Control H], then the text and a [Return] for each separate line of a two-line header. To specify a footer, press [Control F], then type the text of the footer and press [Return]. Enter [Control F], then the text and a [Return] for each separate line of a two-line footer. Headers appear two and four half-lines below the top of the page, and footers two and four half-lines above the bottom of the page. Therefore, to use headers or footers, the top [Control T] or bottom [Control B] margin settings must be at least 8 to leave room. By default, headers and footers are aligned to the left margin of the printed page; however, you can also have them centered or blocked right (aligned with the right margin) by following your headder or footer command with a center text command ([Control C]) or block text right command ([Control C][Control C]) just before your text (and on the same screen line). If you want your headers or footers printed in elongated print, enter a [Shift F9] before and after the header or footer text. If you want headers or footers on every page of your text file, beginning with the first page, enter the appropriate commands and text at the beginning of your file on the screen line or lines just below the formatting commands and values displayed on the first line. If you want headers or footers to begin on a page other than the first page, or if you want to change the text of a header or footer within the file -- say, for a multisection document where you want headers or footers that match each section -- you can enter the appropriate commands and text within the file. In this case, however, be sure to enter the commands and text (preceded if you like by elongated print, center text, block text right, or new left and right margin settings commands) as the only material on a screen line. No header or footer text line should exceed the overall page margins that you've set (and remember that elongated print is twice as wide as normal). Any header or footer text that exceeds your page margins will be dropped when ST Writer formats and prints your file. To discontinue printing headers in your file, type [Control H] [Control H] [Return]. Use two [Control F]'s for discontinuing footers. To number your printed pages, type the @ symbol ([Shift 2]) at that point in your header or footer text where you want page numbers to appear. ST Writer displays a @ symbol to show you where your page numbers will be printed. If you want page numbers only, just enter @ as your entire header or footer text. By default, ST Writer numbers the page where a page numbering command is entered as 1, and subsequent pages in order. To specify a different starting page number -- a useful option when you're combining separate text files into a larger document -- press [Control Q] after the [Return] that concludes your header or footer text, then enter the starting page number you want. ST Writer accepts starting page numbers of 1 through 999. A negative number (e.g. -1) instructs ST Writer to alternate blocked RIGHT headers and footers with blocked LEFT headers and footers. To add a blocked right header with a page number to each page of your passage from Alice in Wonderland, enter this at the beginning of your text file: [Control H][Control C][Control C]ST Writer Exercise - @ [Return] You may specify a different print style [Control G][number][hyphen], or different left [Control L][number] or right [Control R][number] margins within your header or footer without affecting the print style or L or R margins within your main text body. The header or footer disregards double column instructions, creating a line length up to the entire width of the page. Indexing and deleting text files There are two more selections on the ST Writer menu that can help you manage your text files: Index of Files and Delete File. Before trying these options, save your passage from Alice in Wonderland -- it will make for a more interesting index and, along with your letter about ST Writer, will give you a choice of files to delete! For an index of files on a diskette, insert the diskette into your disk drive. If your system has two drives, use either one. Then select Index Disk Files from the ST Writer menu. ST Writer then prompts 'P' to printer, 'S' to screen: S -- press [Return] to accept the default (screen print), or P to send the index to your printer. Next ST Writer prompts you for a Path name: and prints the specifier for the current drive, that is, the drive from which you loaded ST Writer (or from which you last obtained a directory). For instance, if you loaded ST Writer from drive A:, you're prompted Path name: A:. You can change the drive specifier by pressing [Backspace] a few times and entering the new specifier. If you want a directory of a specific folder on your disk, enter the drive specifier, then a reverse slash (\), then the name of that folder. Then press [Return], at which time ST Writer displays a list of files and folders on the diskette. Folders and files created with ST Writer will be indicated as such in the listing. Also shown is the number of bytes occupied by each file; any file that you've locked (using the GEM desktop) is noted with an asterisk (see Diskette Management in the Reference Guide). When there are more than 21 files on a diskette, ST Writer scrolls your directory upward on your screen to show you every entry. To halt this scrolling, press any key; press any key again to restart the scrolling. For a printed directory, simply type P at the first prompt, and make sure your printer is connected and turned on. To delete a file on diskette, you follow much the same procedure as when you save or load a file to or from diskette. First make sure that the diskette containing the file that you want to delete is in your disk drive, then return to the ST Writer menu and select Delete File. When ST Writer prompts you to enter the File to be deleted:, type in the drive specifier followed by a colon and the filename and extender of the file you want to delete, and press [Return]. As a precaution, ST Writer prompts Type 'Y' to delete file:. When you respond by typing Y, ST Writer erases the specified file from your diskette. Some further features of ST Writer Like Alice, the Dodo, and the Mouse, you've probably now been "running half-an-hour or so" at least with ST Writer -- but don't stop yet! Briefly described, here are a few additional features of ST Writer. You can find complete instructions for using each one in the Reference Guide. Byte count at cursor position. You can tell at a glance where you are in the file by pressing [Alternate =]. Although this number represents all characters including formatting data and comments, you can get an idea of how far you are in the document. Chaining print files. If you have a disk drive, this feature allows you to chain text files together in any order to be printed as if they were one file. Duplicating text. This feature enables you to take a word, sentence, or more from one part of a text file and duplicate it wherever else you want within the same file. Format disk. You can use this selection from the ST Writer menu to prepare a blank diskette for storing your text files. Form printing. Especially handy for business or form letters, this feature lets you leave blanks in a text file -- for names and addresses, account numbers, and the like -- and fill them in with specifics each time ST Writer prints the file. You can, if you like, create a separate DATA file containing the words or phrases, each separated by a carriage return. Just be sure that they match the spaces left in your form, and are in the correct order. The DATA file must be printed to disk with top and bottom margins set to 0 (zero), L set to 1, R set to 198, G set to 2 and Y set to twice the number of lines in the file (maximum Y is 224). Alternatively, you can also use mailing addresses created and sorted by DB Master One. Simply print the sorted addresses to a disk file. The computer will prompt you asking for the file name of your DATA file if you indicate that STWRITER is to use a disk file as the data source. If you do not wish to use a data file as a source of your insert data, you may simply type in each specific as you are prompted to by the computer. Merging text files. This feature allows you to merge an ST Writer text file on disk together with the file currently in your computer's memory. Files not saved in ST Writer format should be first loaded separately, saved, then merged with the desired file. Page eject. Basically a formatting command, this feature enables you to halt printing on a given page and space to the top of the next page before resuming printing. It can be useful when you're formatting and printing a multisection document where you want each section to begin on a fresh page. By typing a number greater than zero after [Control E] you can specify a conditional page eject, with the number representing the number of lines to appear on the same page. If they will not fit, they will appear in a block on the following page. This feature is useful for printing tables and material with fixed numbers of lines. To work with paragraphs and formatable blocks of print with variable numbers of lines, one would first need to print the entire document and count by hand the number of lines in the paragraph which are not be broken at a page break. Page wait. Also a formatting command, this feature allows you to print your text files on individual sheets of paper -- a convenient option when you want to do your printing on bond, letterhead, or your personal stationery. If this command is active when printing to the screen, scrolling will halt when the screen is full. Pressing any key except [Esc] continues scrolling. [Esc] cancels printing. Printer controls. You can send special decimal-code commands to your printer by entering them directly in your text files -- a useful option if you have a printer that ST Writer does not support, and do not have a printer driver. Section headings. Use this feature to number section and subsection headings in the body of a text file. Special characters. You can access the special characters in the international character set by typing [Alternate X]. A letter [A] appears near the bottom right of the screen indicating alternate character mode. Use the table in STWCODES.DOC to find what key combinations to use to print the character you want. Foreign characters can be obtained directly without using the [Alternate X] function by using the deadkey function. Type [Control][Clr Home], and a "D" appears in the status line near the bottom of the screen. You can get foreign characters by using the following combination of key strokes: First type ",',~,`,^,_,-, or /, then the vowel or letter that the mark is used in combination with. For example, to get a small umalut u, type ["] first, then [u]. If you merely want a quote mark ["], you must either exit the deadkey mode by typing [Control][Clr Home], or by typing quote ["] twice in succession while still in deadkey mode. In addition, you can also include characters with ASCII values between 0 and 31 in your text file. Note, however, that most of these characters are unprintable, and may do strange things if you attempt to print them on the printer. Nevertheless, you can get them by typing [Control X] before and after the character. For example, to get a [Control J] (ASCII 10) to be in the text, type: [Control X][Control J][Control X] These characters will not be counted as taking up space on a line like normal characters. The [Control X] is needed to tell the formatter in ST Writer Elite that these are NOT formatting characters, but ones which need to be sent to the output device. All control characters can be printed by using [Control] plus a letter key with the following exceptions: To get: Use: ASCII 0 (null) [ Return ] [ Control A ] [ Control U ] [ Control U ] [ Shift F5 ] [ Control X ] \[ Control X ] [ Control Z ] [ Control : ] [ Escape ] [ Control [ ] or [ Control ; ] ASCII $1C [ Control < ] or [ Control \ ] ASCII $1D [ Control = ] or [ Control ] ] ASCII $1E [ Control > ] or [ Control ^ ] ASCII $1F [ Control ? ] or [ Control _ ] Subscripts and superscripts. Especially useful when you're writing about mathematical or chemical formulas or including footnote numbers in your text, subscripts and superscripts can easily be included in your printed text files. Tabs. With ST Writer you can set and use Tab stops much as you do with a conventional typewriter. Tab stops can be especially useful when you're setting up columns or tables in a text file. GEM mode. By popular request, features of Digital Research's GEM (Graphics Environment Manager) have been added to ST Writer. This allows use of drop down menu items, Dialog Boxes, File Selector Boxes, and use of the mouse. The GEM mode is activated by pressing one of the mouse buttons. An "Alert" box appears allowing you to select or reject GEM mode. If you are happy with ST Writer as it already is, click on "CANCEL". Clicking on "OK" will produce a blank screen with the familiar GEM menu bar at the top. You can make your menu selections from here using the mouse. In GEM mode, keyboard menu commands will no longer work. S T W R I T E R R E F E R E N C E G U I D E ALTERNATE RIGHT AND LEFT BLOCK HEADERS/FOOTERS. To have ST Writer take headers and footers set for right blocking, and on alternate pages block them left, use a negative number after the [Control Q] (page number start) command. This is useful for pages which will go "back to back" as in a textbook or newsletter. ALTERNATE CHARACTERS. Use the Alternate key in combination with the X key to toggle the alternate characters set. A capital 'A' will appear near the bottom right of the screen indicating alternate character mode. Pressing [Alternate X] again returns to normal characters. Since the keys are not marked for alternate characters, you can often find the proper key to use by subtracting 128 from the ASCII value of the alternate character you wish to type, and finding the corresponding key on the keyboard. For example, to print the 'pi' symbol, press [Alternate X], then type a lower case 'c'. For some characters, it will be necessary for you to refer to the ST Writer Key Code Table. Note: If you have pressed the [CapsLock] key, a capital 'C' will indicate this at the bottom right of your screen. Also see SPECIAL CHARACTERS. BLOCK TEXT RIGHT. To block right, or print a line of text flush with the right margin of the printed page, press [Control C] twice in succession before typing the line, and [Return] at the end of the line. When editing, insert [Control C] twice at the beginning of each line to be blocked right, and be sure that each such line ends with [Return]. Always be sure, also, that no line of text to be blocked right exceeds your overall page margins. CAPITALIZATION. See Upper and lowercase characters. CENTER TEXT. To center a line of text, press [Control C] before typing the line, and [Return] at the end of the line. When editing, insert a [Control C] at the beginning of each line to be centered, and be sure that each such line ends with [Return]. Always be sure, also, that no line of text to be centered exceeds your overall page margins. CHAINING PRINT FILES. You can use this feature to tie together any number of files, in any order that you wish, to be printed as if they were one file. This is especially useful when you want to print a long document that you've written and saved in segments with distinctive filenames or extenders. Here's how to chain two files named REPORT.001 and REPORT.002, for example. While writing or editing REPORT.001, position the cursor at the end of the file and press [Control V]. Then type REPORT.002 (include the drive specifier, if necessary, before the filename) and press [Return]. It does not matter whether you enter the filename or specifier in upper or lower case. While printing these chained files, ST Writer would display the message CHAINING REPORT.002 as it finished with REPORT.001 and proceeded to find and format REPORT.002 prior to printing it. After printing, the first file is reloaded from disk. Each file in a chain will be formatted according to the formatting commands and values within it. So if you want consistent overall formatting throughout a chain of files, be sure that the values in the Print Formatting Block are the same in every file. A header or footer entered in the first file in a chain will be carried through subsequent files -- unless, of course, you modify it -- and a page numbering command entered in the first file will give you consecutively numbered pages throughout the chain. Note: You cannot load a file, edit it, then print it out while chaining to another file -- if you try, the message Cannot chain appears after the first file is printed. In order to chain properly, save the first file before printing it out. This is because when you load a file and then edit it, ST Writer will not let you load another file without verifying that you want to erase the existing text. COMMENT. Use [Control K] before and a comment in your text which you do not wish to have printed out. Terminate the comment with a [Return]. Since [Control K] also is used to cancel a search command, you may still search for a [Control K] character in your text. Use a [Control +] combination of key strokes for this. CONDENSED PRINT. See Print styles (fonts). CREATE FILE. Select this from the ST Writer menu to begin writing a new text file. While in the Create File mode, you can write, edit, rewrite, and enter or change formatting commands. Each time you select Create File, ST Writer refreshes the default values for formatting in the Print Formatting Block at the top of your monitor screen. DEADKEY FUNCTION. This function is toggled on and off with [Control][Clr Home]. If the character you wish to use has an accent mark, for example, type the ['] character followed by the appropriate vowel. DEFAULT VALUES. Each time you select Create File, ST Writer refreshes the default values for formatting in the Print Formatting Block at the top of your monitor screen. ST Writer will format your entire file according to these values unless you change them, or modify them by entering the appropriate formatting commands and values within the body of the file. Here are the default values: B12 Bottom margin, 12 half-lines (1 inch) D4 Paragraph spacing, 4 blank half-lines (double spacing) G0 Print style, 10 characters per inch I5 Paragraph indentation, 5 spaces from left margin J0 Justified right margins OFF L10 Left margin, 10 spaces from left edge of page R70 Right margin, 70 spaces from left edge of page S2 Line spacing, 2 half-lines (single spacing) T12 Top margin, 12 half-lines (1 inch) Y132 Page length, 132 half-lines (11 inches) ST Writer also defaults to a starting page number of 1 when you enter a page numbering or print file command -- unless of course you enter a different starting page number. DELETE FILE. To delete a file from diskette, select Delete File from the ST Writer menu by pressing D. Then enter the Path name of the file (see Path name) to delete. As a precaution, ST Writer prompts Type 'Y' to delete file:; Type Y to erase the file. You cannot delete a locked file from the disk -- if you try, ST Writer will give you the message Unable to delete file. DELETE TEXT. See your Quick Reference Guide for the keystrokes used to delete text. You can delete: a character, line, or portion of a line at a time; all text from the position of the cursor to the end of your text file; a defined block of text, or the entire document. In case you change your mind about a deletion or delete something by accident, you can press the [Undo] key to restore the last line or block of text (up to about 40,000 characters) that you've deleted; the restored material is inserted at the position of the cursor. Note: exceptions to this are deleted single characters, blocks larger than 40,000 characters (warning message appears), and deletion of the entire text ([Clr Home]). DISKETTE MANAGEMENT. In order to load the ST Writer program into your Computer, if you don't have TOS in ROM, you must first load the TOS operating system from your ATARI TOS System Disk. Consult your ST Computer Owner's Manual for further instructions. Before you can store your ST Writer text files on a data disk, the disk must be formatted -- that is, organized into sectors so that your disk drive can keep track of where information is stored on it. You can format blank diskettes from the GEM desktop (see Owner's Manual). Or use the Format Disk selection from the ST Writer menu to format a blank disk while in the middle of a work session with ST Writer. For your own peace of mind, always make a backup copy of any disk you store ST Writer files on -- just so you'll have a duplicate in the event that something happens to your original. Your ST Owner's Manual also contains further details on this and other disk management functions. DOUBLE-COLUMN PRINTING. You can format a text file for double-column printing on any printer. To do so, you must enter formatting commands and values of the second (right-hand) column. You can do this either at the beginning of your file -- to print the whole file in double columns -- or at that point in the file where you want double-column printing to begin. To set the left margin for the second column, press [Control M], then type the number of the setting you want. Then press [Control N] and type the number of the setting you want for the right margin of the column. You may also have to adjust your settings for L and R, which control the margins for the first (left-hand) column of print in double-column printing. Always be sure that your first-column right margin and second-column left margin do not overlap, and that T and B margins are set the same for both columns. When you print to the screen a file that you've formatted for double-column printing, the two columns appear as they will print. DUPLICATING TEXT. To duplicate a portion of text from one part of a text file to another part of the file, first position the cursor at the beginning of what you want to duplicate and press [Shift F5]. Next, position the cursor at the end of what you want to duplicate and press [Shift F5] again. Finally, position the cursor where you want the text to be duplicated (the cursor must be outside the marked block), and press [F2]. From this point until you perform another deletion or duplication, the marked block of text is held in a failsafe buffer, and can be inserted anywhere in the document simply by positioning the cursor and pressing the [Undo] key. You may duplicate a block of text as many times as you like. If you want to duplicate it more than once, however, be careful not to delete anything until you've completed your duplication procedures. A block of text that you duplicate is stored in the failsafe text buffer of your computer, where it will be replaced by the next deletion. Also keep in mind that the capacity of your failsafe text buffer is about 40,000 characters of text. So if you want to duplicate a block of more than 13 pages or so, do it in segments. EDIT FILE. Select this option from the ST Writer menu when you want to revise or reformat a text file already in your computer's memory. ELONGATED PRINT. See Print styles (fonts). ERROR MESSAGES. When ST Writer finds a mistake in an entry or command that you've given, or detects a problem in your computer system, it displays the appropriate error message in the Message Window at the bottom of your screen. Press any key to continue. FILENAMES. Filenames may be up to eight characters in length, optionally followed by a period and a three-character extender -- for example, RFGUIDE.001. You must give every file a filename in order to save it on a disk. ST Writer uses the same conventions as your TOS operating system for allowable characters in filenames -- letters, numbers, and punctuation are permissible. Lower case letters are converted to upper case in the actual filename. FONTS. See Print styles. FOOTERS. See Headers, footers, and page numbering. FORMAT DISK. In order to store your ST Writer text files, disks must be formatted with TOS. While it's always a good idea to keep an extra formatted diskette on hand, (see Diskette management), you can use the Format Disk selection from the ST Writer menu to format a disk during a work session with ST Writer. Simply insert the diskette you want to format in your disk drive and select Format Disk from the menu by pressing F. The Message Window shows All data will be erased, 'Y' to format. Type Y to continue with the format operation. Type any other letter to return to the SELECT LETTER prompt. After typing Y, type A or B for the drive containing the disk you wish to format. Next you're asked Sides to format ( 1 or 2 ):2. Note that the default response for a double-sided drive is already supplied, and you need only press [Return] to begin such a format. To format single-sided, if you have an SF354 drive, type 1 and press [Return] -- the 2 disappears at the first keypress. At the prompt Enter name for disk: enter in a disk name following filename conventions (up to eight characters with an optional three-character extender), or just press [Return] for no disk name. The message Formatting disk appears and the disk is formatted. If there are any problems (such as the disk being write-protected), the message Unable to format disk. appears. Press any key to return to the SELECT LETTER prompt. FORMATTING TEXT FILES. How ST Writer formats your text files is controlled by a variety of formatting commands and values entered either in the Print Formatting Block at the top of each file or within the body of the file. Each time you select Create File from the ST Writer menu, the program's default values for formatting are refreshed in the Print Formatting Block, but you can change them or add to them as you wish. You can edit formatting commands and values -- delete or modify them -- just as you can text. See your Quick Reference Guide for a summary of all formatting commands used with ST Writer. You can examine a formatted text file on your screen prior to printing by using Print to Screen. FORM PRINTING. (Also called Database Merge.) You can leave blanks in a text file that you want to use as a form, and fill them in -- with names and addresses, account numbers, and the like -- each time you print the file. Wherever you want to leave a blank, press function key F9. An inverse video ? appears at that point on your screen. Press F9 at the desired location for each entry that you'll be filling in. When ST Writer prints the file, it stops when it encounters each such command and prompts you FORM DATA FROM FILE Y/N? If you have previously created a data file, type Y. The prompt DATA FILE NAME? will appear. Type in the data file name and press [Return]. ST Writer will read the data file and insert the data in sequence into your text. If you do not have a data file, you will be prompted to MAKE ENTRY?. Type what you want to fill in the blank -- up to 55 characters per blank -- and press [Return]. When you complete each entry, ST Writer continues printing the file. Alternately, you can supply information for each blank from a text file output by a database management program such as the mailing list option of DB Master One. After sorting the desired addresses with DB Master One, "print" them to disk. See the instructions from compatible database managers for further instructions. If you're using the hand-entry method and have left a number of blanks, it's a good idea to jot down a list of them, because you won't be able to see the file on your screen when you're prompted to make your entries during printing. FREE MEMORY. When first creating a file in ST Writer, you start off with approximately 200,000 bytes, or characters, of memory (more or less depending on system) available for your text -- room for over 130 double-spaced pages. This number is reduced if you have any of the accessories such as the Control Panel installed in your desktop. To remove desktop accessories, use the GEM desktop to change resolution with a non-system disk in the default drive, or if you have a monochrome monitor (cannot change resolution), rename the desk accessories on your system disk and reboot the system. ST Writer constantly displays the available memory, expressed in bytes, in the Message Window at the bottom of your screen. One byte equals roughly one typed character, and you can figure on about 1500 bytes for each standard double-spaced page. In any case, it's a good idea to leave yourself with a margin of free memory with every file you write, just so you'll have some memory to work with if you want to edit (or add to) a file later on. When your computer's memory will accept only about one more screen full of text, ST Writer alerts you by displaying a "memory low" message. When this happens, save the file and start a new file to continue the document you're working on. GEM MODE. To get the features of GEM, click one of the mouse buttons. An alert box will appear to allow you to select GEM or CANCEL. Besides allowing you to use the mouse in Menus, Dialog and Alert Boxes, on the EDIT screen you can place the alpha cursor anywhere in the text on the screen instantly. You can also exit edit mode by clicking on Esc in the last line of the command box, and you can scroll up or down a page by clicking on the up and down arrows on the same line. You can exit GEM mode from the main menu by clicking on "Mouse" in the Options menu. NOTE: Sometimes when you press the [Esc] key, you will seem to be "stuck" on the Edit screen. This occurs when the mouse is on the top line, regardless if you are in GEM mode or not, or whether the mouse is visible or not. A peculiarity of GEM makes it necessary for you to move the mouse downward to exit the Edit screen if this should occur. GLOBAL FORMAT. In GEM mode only, Global Format allows you to set up the Format line at the top of a file you are about to Create. It does not work on files already created in memory. HEADERS, FOOTERS, and PAGE NUMBERING. For headers or footers of one or two lines on every page of your printed text file, enter the appropriate commands and text at the beginning of the file, on the screen line or lines just below the formatting commands and values displayed on the first line. To begin headers or footers elsewhere than on the first page, or to change the text of your headers or footers, you can also enter the required commands and text within the file. In this case, however, each header or footer command and line of text (preceded, if you like, by elongated print and center text or block text right commands) must be the only material entered on a screenline. In either case, be sure that no line of header or footer text exceeds your overall page width margins. To specify a header, press [Control H], then type the text of the header and press [Return]. For a two-line header, enter a [Control H], then the text and a [Return] for each separate line. To specify a footer, press [Control F], then type the text of the footer and press [Return]. For a two-line footer, enter a [Control F], then the text and a [Return] for each separate line. To discontinue a header or a footer, type two [Control H]'s or two [Control F]'s followed by a [Return]. For consecutively numbered printed pages, type @ ([Shift 2]) at that point in your header or footer text where you want page numbers to appear (for page numbers only, use the @ symbol as the entire text of your header or footer). ST Writer will number the page where you enter your page numbering command as 1, and subsequent pages in order, unless you specify a different starting page number. To do this, press [Control Q] after the [Return] that concludes your header or footer text, then type in the number of the starting page number you want (from 1 through 999). A negative value following the [Control Q] indicates that you want your left and right blocked headers and footers to each block to the opposite margin on alternate pages. Headers or footers appear one full line below or above the top or bottom of your printed pages. By default, ST Writer prints headers, footers, and page numbers in the print style you've formatted for the entire text file, and aligns them to the left margin. If you want to change the print style or left or right margins, or want elongated print, centered or flush right, enter the appropriate commands just after your header or footer commands. The main text body will not be affected by these formatting commands in your header or footer. INDEX OF FILES. For a directory of files on a disk or within a folder, press I from the ST Writer menu. At the prompt 'P' to printer, 'S' to screen: S, press [Return] to accept the default (screen print), or P for a printed index (make sure your printer is ready). Next ST Writer asks for the Path name: -- see Path name for details. When you enter the Path name, ST Writer reads the disk directory and prints it on the indicated device. Also shown are the number of bytes contained in each file. Files generated by ST Writer and folders are indicated as such, and locked files are marked with an asterisk (see Locking files). If you have more than 21 files and folders on your disk, ST Writer scrolls the directory listing upward on your screen to show every entry. To momentarily pause the listing, press any key; press it again to restart the scrolling. At the end of the directory listing, ST Writer again presents you with the printer/screen prompt, in case you wish to index a different disk or folder. To return to the menu, press [Esc]. There is no corresponding selection for Index in GEM mode, as File Selector Boxes contain filenames. Unfortunately, information on file size or whether or not they are ST Writer files is not available in GEM mode. INSERTING TEXT. To insert text, simply position the cursor where you want and begin typing. ST Writer pushes the text to the right of and below your insertion as far as necessary to accomodate the new text. Use the same procedure to enter formatting commands within a text file that you've already written. Pressing the [Insert] key toggles between insertion and type-over mode. A capital 'I' near the bottom right of the screen indicates insert mode, and an inverse capital 'T' indicates type-over mode. INSTALL PRINTER. The Install Printer accessory from the Desk menu on the GEM desktop allows you to choose the type printer you will be using (dot matrix or daisywheel, black and white or color, dot configuration), paper use (single sheet or continuous feed), and quality of print (draft or final). If the codes for draft or final have been placed in your printer configuration file, you can selec single- (draft) or double- (final) strike printing. You may also change ports so that your text gets printed via the modem (RS232) serial port, rather than to the parallel printer port. JUSTIFIED RIGHT MARGINS. The justified right margin command works like a simple On/Off switch. The default value of 0, displayed next to the inverse video J in the Print Formatting Block, gives you nonjustified (ragged) right margins. For justified right margins, change this value to 1. You can change from one to the other within a text file by entering [Control J] and the appropriate value. LINE SPACING. ST Writer measures line spacing in half-lines. The default value for line spacing is single spacing, represented by the 2 next to the inverse video S in the Print Formatting Block. For double spacing, change this value to 4. To vary line spacing within a document, press [Control S] and type in the appropriate value wherever you want the spacing to change. The new value must be an even number. When you use [Return]s to create blank lines in a text file, keep in mind that ST Writer inserts blank lines according to the value of S for each such [Return]. LOAD FILE. To load a text file from a disk drive, select Load File from the ST Writer menu by pressing L. At the Load file: prompt, enter the Path name (see Path name) for the file you wish to load. If you've previously loaded or created a text file during the current session, ST Writer first asks, Erase file in memory, Y/N ?. An exception to this happens if you've previously saved the file and did not edit it after the last save -- the new file is simply loaded when you enter its name. If you press Y, the file in memory is erased, whether or not you proceed with the load. In GEM mode, you are supplied with a File Selector Box from which you click on the file you want loaded. See PATH NAME for details. If while loading a file ST Writer finds that your computer's memory is full, Buffer is full, file not loaded appears in your Message Window. That part of the file that's been loaded is erased from memory. If you load in a non-ST Writer file, the file must be converted to ST Writer format, and this takes some time. Essentially, all line-feeds are discarded, and all carriage returns replaced with nulls. Also, all tabs are replaced with 5 blank spaces. You can toggle off the tab conversion when prompted by answering 'N' (No) to the query Change Tabs to Spaces? In this case, your file may be punctuated with a lot of [Control I] characters, which represents the tab character. This would usually be done only by experienced computer users. LOCKING FILES. To lock a text file that you've saved to disk, you must return to the GEM desktop (see Quit). Open a window for the drive that contains the file to be locked, and select the file by pointing to its icon (or filename) and clicking the left mouse button once so the icon is highlighted. Then point at the File heading on the Menu Bar, and select the Show Info option. This is the same Dialog Box you would use to rename the file. To lock the file, select Read-Only, then OK. If you load a locked text file, revise it with ST Writer, and then try to save it again under the same filename, ST Writer asks, ALREADY EXISTS, 'Y' to replace it. If you type Y (no [Return] necessary) ST Writer gives you the message ERROR trying to open the file. Press any key to return to the Save file: prompt and enter a different name under which to save the file. MARGINS. ST Writer measures a page from top to bottom in half-lines, and from left to right in character spaces. The default values for page margins are represented in the Print Formatting Block as follows: T12 B12 L10 R70 Top Bottom Left Right To change any of these margins for the entire text file, simply delete the value shown and type in your own. You can also change margins within a file; just press [Control] and the appropriate letter, then type in the value you want. Values for the top and bottom margin must be even numbers. You may have to experiment a bit, adjusting the paper in your printer, to get the correct top margins on your printed pages. With the default value of 12 for T, your top margins should be one inch. For a continuous printout of a file, without page breaks, set your top and bottom margins at 0 and delete any headers or footers from the file. MERGING TEXT. You can merge a saved ST Writer file, or other ASCII file from disk with the file currently in your computer's memory with this command. Keep in mind, though, that when merging files you run the risk of overflowing your computer's free memory. To merge two files, first position the cursor where you want the merged text to appear in the file currently in your computer's memory. Then press function key [F8]. ST Writer then prompts Load file:, at which you should enter a Path name for the file to be merged (see Path name). If while merging one file with another ST Writer finds that your computer's free memory is full, a warning message appears in the Message Window, the merge is halted and that portion of the merged file that has loaded is erased. MOVING TEXT. To move a block of text from one place to another in a text file, position the cursor at the beginning of the passage you want to move and press [Shift F5]. Then move the cursor to the end of the passage and press [Shift F5] again. Next, move the cursor to the point where you want to reposition the passage, and press [Shift F2]. Remember that you can move only about 40,000 bytes of text (the capacity of your failsafe buffer) at a time. If you want to move a larger block of text, do it in segments. PAGE EJECT. Use this command when you want ST Writer to halt printing at a given point in a text file and space to the top of the next page before printing is resumed -- for example, in a multisection document where you want each section to begin on a fresh page. To enter this command, position the cursor where you want a page eject to take place and press [Control E]. A number following [Control E] specifies a conditional page eject. The number is the number of lines to appear in a block, and should not exceed the number of lines between the top and bottom margins. If the block will not fit on the current page, it will appear on the following page. PAGE LENGTH. When formatting and printing a text file, ST Writer uses this formatting command -- represented by the inverse video Y in the Print Formatting Block -- to determine where the next printed page should begin. Keep your page length set at the default value of 132 (half-lines) for 8 1/2 by 11-inch paper. For a continuous printout of a text file without page breaks, set your top and bottom margins at 0 and delete any headers or footers from the file. Values for page length must be even numbers, and 224 is the maximum value of Y that ST Writer allows. PAGE NUMBERING. See Headers, footers, and page numbering. PAGE WAIT. Use this command when you want to print a text file on separate sheets of paper -- for example, on bond, letterhead, or your personal stationery. Enter [Control W] in the Print Formatting Block at the top of your file for a page wait on every page of the file. ST Writer will stop printing at the bottom of each page; after inserting a fresh sheet of paper in your printer, press any key to start printing the next page. You may also invoke this command by using the Install Printer desk accessory, and using the "single" sheet selection. When printing to the screen, [Control W] causes the screen scrolling to halt when the screen is full. Hit any key to continue scrolling, or [Esc] to exit. PARAGRAPHS. Mark the beginning of every paragraph by pressing [Control P] -- ST Writer displays an inverse video letter P at that point on your screen. Press [Return] at the end of each paragraph -- ST Writer displays an inverse video 'less than' symbol at that point. Two formatting commands control how your paragraphs appear when formatted and printed by ST Writer. The default value for paragraph spacing, displayed next to the inverse video D in the Print Formatting Block, is 4 blank half-lines, or double spacing, between paragraphs. To change this value, just delete the 4 and type in the value you want. The default value for paragraph indentation, displayed next to the inverse video I in the Print Formatting Block, is 5 spaces (from the left page margin). For a different paragraph indentation, delete the 5 and substitute the value you want. To vary paragraph spacing within a new file, press [Control D] and type a new value where you want the spacing to change, then press [Return]. To change paragraph indentation, press [Control I] and enter a new value. For bibliographies, ST Writer also allows negative indentation (outdenting or undenting). Type [Control I] followed by a negative value (eg., [-5]). Each time a [Control P] is encountered thereafter, the first line of the paragraph will be alligned flush with the left margin, and succeeding lines will be indented. PATH NAME. Path names are used to indicate files held in folders on your disk. See your ATARI ST Owner's Manual for a description of folders and how to use them. Path names can be entered at any of ST Writer's prompts for filenames or Path names. A path name is similar to a filename, but may also optionally indicate a folder name (or folder names) in order to tell ST Writer what path to take through your various directories and subdirectories in order to access your file. Say, for example, that you would like to use a folder named TEXT to hold your ST Writer files. To create the folder, follow the instructions for Creating Folders in your ATARI ST Owner's Manual. Then, after invoking ST Writer and creating your file, press [Esc] to return to the main menu and select Save File by pressing the S key. At the prompt, first enter the drive identifier (A:, B:, or C:), then type a reverse slash (the key to the right of the [Return] key), then the folder name (TEXT), then another reverse slash, then the filename under which you wish to save the file (e.g. B:\TEXT\MYFILE.TXT). Thus, a path name is simply a filename with one or more folder names inserted, offset by reverse slash marks. To obtain a directory listing of the folder TEXT, select Index of Files from the main menu, select Screen or Printer, then at the prompt for Path name:, type B:\TEXT and [Return]. Since folders can contain folders, you can use more than one folder name in a path name. For instance, if the disk in drive B: contains a folder named LETTERS in the folder named TEXT, a path name to file MYFILE would resemble this: B:\TEXT\LETTERS\MYFILE. In GEM mode, file selection is done slightly differently. A File Selector Box appears with the current "path" on the top line. You may change the path by placing the cursor on the line by pointing and clicking the mouse, then either back-spacing over it, or pressing [Esc]. You can then type in the above path name ( B:\TEXT\LETTERS\*.* ). Move the mouse inside the File Selector Box and click. All files in the LETTERS folder will be listed. This is because you used a "wild card" specifier [*]. If you only wanted files ending with .TXT, you would have typed: B:\TEXT\LETTERS\*.TXT [TAB] (Note: File Selector Boxes use the [TAB] key in place of the [RETURN] key.) You may then click on the file wanted followed by clicking the OK box, or double click on the selected file, and it will load, be saved, or delete, depending which function you had selected. PRINTER CONTROLS. If you do not have an Epson or Epson-compatible printer (including the ATARI SMM804), you can still format and print your ST Writer text files by entering the desired printer controls directly in your files. Wherever you want to enter a printer control, first press [Control O], then type in the decimal equivalent of the appropriate code understood by your printer. For instance, to send a decimal code 15, type [Control O]15. Be sure to type a space after the number -- ST Writer uses this space as a delimiter. You should be able to find a listing of codes used by your printer in the manual that came with it. Note: when you enter a printer control code with [Control O] on a page, that entire page will be formatted by the code you enter. PRINT FILE. You can print your text to the screen (see Print preview), to a disk file, to a serial printer or modem, or to a parallel printer. (Note: To print to a printer or modem connected to your computer's RS232 serial port, first use the Install Printer option from the GEM desktop Desk menu to set the Printer Port to Modem, -- see your ST Owner's Manual -- then print to the printer as usual.) To print a file, load it in memory if not already present, go to the ST Writer menu, and press P. ST Writer prompts, Enter Printer, Disk, Screen, spooLer? -- press the highlighted capital letter of the desired output device. For further instructions on printing to the screen, see Print preview. The message Searching for printer config file on disk appears in the Message Window as soon as ST Writer has loaded into the computer, and the disk drive spins momentarily. When this happens, ST Writer is looking for the file XYZZX.DAT on your default drive; the drive from which you loaded the ST Writer program. For further information on this file, see Printer Configuration File. Whether or not the printer configuration file is found, ST Writer still can print your file. From the ST Writer menu, to print your file to a printer, press P. Note: If your printer supports proportional print and you wish to use this, you must first return to the GEM desktop and use the Install Printer option from the Desk menu to set Printer Type to Daisy. To send the formatted text to a disk file that you can later transmit to another computer or print out directly from the GEM desktop, press D. ST Writer prompts you for a file name and then sends the formatted text to that file. The spooler option (press L) lets you print to a disk file with all your printer control codes embedded along with your text. A properly formatted file for your printer can later be printed directly to your type of printer from the GEM desktop. The next prompt, Enter number of copies?, is followed by the number 1. Press [Return] to accept the default value of one copy. To print more than one copy, type the new number of copies, then press [Return]. Next ST Writer prompts Print whole document Y/N?. Type Y (or just press [Return]) to print the entire text, or type N to print a range of pages. If you press N, ST Writer asks you for the beginning page number with the prompt Enter first?. Press [Return] to accept the default value, page 1, or press [Backspace] once and type a new beginning page number and [Return]. Then at the prompt Enter last?, press [Return] to accept the default last page 999, or use [Backspace] to edit the entry. Finally, you are asked if you want letter quality print, and a 'Y' appears if you have selected letter quality print in the printer configuration desk accessory, or an 'N' if you did not. You may change the 'Y' to 'N' or vice versa at this point, or simply press [Return] if the correct letter is present. To temporarily halt printing, press [Control S], and to resume, press any key. You can stop printing and return to the main menu at any time by pressing the [Esc] key. Hint: Printing your file to a disk file is a convenient way of creating documentation on disk for a program you've written. Users can show a file printed to disk on the screen or print it out from the GEM desktop by double-clicking the file's icon or filename. Type instructions for your program into ST Writer, then print the text to a file named README.DOC, then write "Show (print) README.DOC for instructions" on your disk label. Remember to adjust the left margin to one. In GEM mode, there is one dialog box which allows you to select the number of copies, the range of pages to print, and the device to print to. PRINT PREVIEW. This feature of ST Writer lets you examine a formatted text file on your monitor screen prior to printing it. You can use Print preview at any time while creating or editing a file. For a print preview, press [Esc] from the editor to return to the ST Writer menu, then select Print File. At the prompt Enter Printer, Disk, Screen SpooLer? press S for screen print. For directions for responding to the next prompt, Print whole document Y/N?, see Print File above. Next, ST Writer prints your formatted file to the screen, showing each page break with a dotted line across the screen width. To pause this screen print, press [Control S], then press any key to resume the listing. Return to the ST Writer menu any time by pressing [Esc]. PRINT STYLES. (fonts). ST Writer offers you a choice of sixteen combinations of print styles or fonts -- check the manual that came with your printer to see which ones your printer is capable of. The default print style of ST Writer, represented by the 0 next to the inverse video G in the Print Formatting Block is Pica, or 10 characters per inch (CPI). To format your entire file for condensed print (16.7 CPI), change this value to 2. For bold print, change it to 1, and to print in italics, change it to 4. To print in Elite style, type 8 after the inverse video G. To vary the print style within a file, position the cursor where you want a new print style to begin, press [Control G], and type in the value desired. You can add the above values to use more than one style at a time -- use this table: CONTROL G STYLE CODE 0 Pica 1 Bold 2 Condensed 4 Italics 8 Elite To combine print styles, add the values for the required styles. For instance, to print Bold Elite, type [Control G]9, then a hyphen, then the text. The hyphen will not appear in the text printout. The print styles you select are not represented as such in Print preview except for elongated, which appears as letters with single spaces in between. The GLOBAL FORMAT dialog box simplifies this task. See GLOBAL FORMAT. PRINTER CONFIGURATION FILE. ST Writer comes with a special printer configuration program called CONFIG.TOS. When run, CONFIG.TOS looks on disk for a file names CONFIG.TXT and reads it into memory. CONFIG.TXT is nothing more than a saved ST Writer file containing all necessary printer codes for the user's individual printer. After reading CONFIG.TXT, CONFIG.TOS converts the text into special code and saves it back to disk, creating a file named XYZZX.DAT. ST Writer searches on the disk it was booted from for XYZZX.DAT and uses its codes to properly interface with the printer. Once you create an XYZZX.DAT file for your particular printer, you never need to go through it again. Be sure to make a backup copy of CONFIG.TXT. The only two files you need on any disk to operate ST Writer are the STWRITER.PRG program itself and XYZZX.DAT. To modify the printer configuration file, pull up your printer manual and load a backup copy of CONFIG.TXT into ST Writer and examine it. Any line of text beginning with an asterisk (*) is a comment for your information only and is ignored by the CONFIG.TOS program. For the moment, let's skip over the first section of the file and edit a fairly simple example. Look for the comment: *underline on. Following *underline on are a list of numbers: 27, 45, 1, 255, 255, 255, etc. Each of these numbers is a printer code in decimal representing the command to turn on the underline. The 255's are fillers where there is no printer code number. Look in your printer manual for the proper codes to turn on the underline. If your printer codes are listed in decimal--sometimes shown as CHR$(27), CHR$(45), CHR$(1)--you're lucky. Printer codes are also often listed in hexadecimal or ASCII form. Hex is indicated by either a preceding dollar sign or by the presence of the letters A through F. The underline on codes above would appear in hexadecimal as: $1B, 2D, $01. In ASCII notation underline on would be: Esc., -, SOH. Whichever the case, if your printer codes are in hexadecimal you wil need to convert them to decimal with a table, and if they are in ASCII, you will need an ASCII chart. Fortunately, many printer manuals have conversion charts in their appendeces. Go down the line of CONFIG.TXT codes and replace any codes that disagree with those codes in your printer manual. If your printer requires, say, four codes for a function that prviously contained three, replace one of the the 255's with the fourth code. Likewise, if your printer is one code short, replace the old, extra code number with a 255. It is very important that each function segment in CONFIG.TXT contains eight codes, so edit carefully. If you are uncertain about a particular function, leave it alone. Change as little as possible. You can always re-edit and try again. Go back and look at the top of CONFIG.TXT. A short chart at the top shows the necessary code numbers to use for certain parameters. It is set up for 80-column printers, but if you have at least 132 columns, substitute 8712 for 5280. This number is critical if you want more than 160 columns (condensed elite on an 80-column printer). You can get 198 columns (condensed on a 132-column printer) if you don't try printing more columns than your printer can handle. The character translation table may appear confusing, but it merely lists the ASCII equivalent of all the characters in the character set, from 0 to 255. Unlike the remainder of CONFIG.TXT, these numbers are in hexadecimal (represented in this case by 0x), so if you are not sure what they represent, see a table or the character set in your printer manual. Beyond the standard range of alphanumeric ASCII characters is an extra character set. The ST sees these extra characters as one thing, but your individual printer sees them as another. Many printers have their own special character set. The character translation table in CONFIG.TXT is designed to make the two jibe as much as possible. Currently, the table is set up for Atari printers. If you don't have an Atari printer, you won't have all the special characters, so you can configure your printer driver to print the characters you do have, even if they have a different ASCII number. For example, my Star Micronics NX-10 printer has the paragraph symbol located at 0x14 (decimal 20), but on the ST, that symbol has the value 0xbc (decimal 188). I found 0xbc in the table and replaced it with 0x14. Now, every time I use the paragraph symbol in text to be printed, it will print as though I were using an Atari printer. Don't bother changing table values below 0x20 because ST Writer uses those for formatting codes, and they will never be sent to your printer. Once you have completed editing CONFIG.TXT, save it back to disk under the same name. Return to the GEM Desktop and make sure you have both CONFIG.TOS and the newly edited CONFIG.TXT on the same disk. Double-click on CONFIG.TOS. In as short while, it will create a XYZZX.DAT file on your disk. Place this file on the same disk as STWRITER.PRG and you're ready to go. You might create a short ST Writer file which uses all the printer commands you wish to test. This way you can quickly try out the different functions and see how successful your edit has been. QUIT. Use this command to exit ST Writer and return to the GEM desktop. From the main menu press Q. If you have made any changes to your text file since the last time you saved it, ST Writer prompts Quit without saving file in memory?. Press Y or y to exit ST Writer, or any other key to return to the main menu. RECEIVE ATARIWRITERTM. Use this function to transfer a file from an ATARI 400, 800, XL or current XE Computer using AtariWriter or AtariWriter Plus to your ST. You must have an ATARI 850 Interface Module (or equivalent) connected to your 400, 800, XL or XE Computer and a "null-modem cable" (see below) in order to make this transfer (300 baud). You may also load in an 8-bit AtariWriter file from disk, and ST Writer will convert the file. A special cable called a "null modem cable" is required to connect the two computers. You probably will not be able to find such a cable ready-made -- you must either make it yourself or have it made for you. Most cities have stores that will custom-make a cable for a reasonable fee. To make the cable, obtain a female 25-pin connector for the ST end, a female 9-pin connector for the 850 end, and a length of cable with at least five wires. Connect these pins on the two connectors: 25-pin pin # TO: 9-pin pin # ------------ --- ----------- 2 4 3 3 4 8 7 5 8 7 To transfer a file, first load AtariWriter or AtariWriter Plus and the file to be transferred into your ATARI 400, 800, XL or XE. Make sure that you have downloaded the RS232 handler from the 850 -- follow the instructions with your DOS manual. If using AtariWriter Plus, make sure your 850 Interface is connected and turned on before you load the program disk. Next, on your ST, run ST Writer. Connect the two computers with your cable. Next, press R on the ST keyboard to activate the Receive file from 850 command. Then press S on the other computer's keyboard to Save File. When prompted for DEVICE:FILENAME, enter R: and press [Return]. The file is then transferred to the ST Writer text buffer, where you see it appear. After the transfer is finished, it's a good idea to save the transferred file to disk for safekeeping before editing it. SAVE ASCII. This is a MENU selection in GEM mode, but in non-GEM mode when you type 'S' to SAVE a file, you will be asked if you want to "Save in ASCII format?" The default is 'N' (No), and merely pressing the [Return] key negates an ASCII save. However, selecting ASCII SAVE allows you to write an ASCII file to disk. This is the same as printing to disk, as every line gets a carriage return and line feed appended to it. The major exception is that the left margin will be 1, and the right can be set up to 160 (for an 80 column printer driver). All blank spaces at the end of a line or page will be discarded. If you MUST have blanks at the end of a line, use the Elongated text control [Shift F9] followed by exactly 1/2 the number of blank spaces needed, and then a terminating [Shift F9]. This tricks the formatter into writing blank spaces at the end of a line or page. SAVE ASCII files will not re-load into ST Writer Elite without conversion to ST Writer format, but can be easily loaded into other word processors or text editors. It is a good idea to use a ".DOC" extender on ASCII filenames so as not to confuse them with files saved in ST Writer format. SAVE BLOCK. After marking the beginning and end of a block of text with [Shift F5], you can save the marked block to a disk file. Mark the block, then press [Shift F8]. ST Writer prompts for a filename with: Save block as:. Enter a filename or Path name, then press [Return] to save the block on disk. You can merge this text with another file with the F8 key (see Merging text.) Hint: an easy way to delete the block markers after saving the block (40,000 bytes or less only) is to press [F5] to delete the block, then [Undo] to restore it. SAVE FILE. To store a text file on a diskette, select Save File from the ST Writer menu by pressing S. When asked "Save in ASCII format?", hit the return key. Insert a formatted disk in your disk drive (if you don't have a formatted disk on hand, you can have ST Writer format one for you -- see Format Disk.) Then type a filename (optionally including Path name -- see Path name), and press [Return]. If your file already has a filename associated with it (i.e. you previously loaded it from disk, rather than creating it from scratch), ST Writer prints out that name after the Save file: prompt. Simply press [Return] to save the file. Important Note: In the latter case, or if the filename you have entered already exists on disk, ST Writer does not print a warning message in the Message Window. Therefore if you wish to retain an original copy of the document you are editing, save the edited version under a different filename. In GEM mode, this is done by selecting "Save". Selecting "Save AS..." allows you to specify another filename to save it under. SEARCH AND REPLACE. Use this feature of ST Writer to search for, replace, or delete any string of text up to 57 characters in length. On command, ST Writer executes a search from the current position of the cursor to the end or the beginning of a text file, in either direction. There are four ways to search; Search Reverse, Search Forward, Replace, and Query Replace. To conduct a Forward Search, from the cursor position to the end of a file, press function key F6. ST Writer then prompts Forward search : in the Message Window. Enter the character, word, or phrase you wish to find, then press the [Esc]. Using the [Esc] key as a terminator in the search phrase allows you to search for phrases that include the [Return] character. You can also search for other non-alphanumeric characters, including all [Control] key combinations. Pressing [Esc] activates the search, whereupon ST Writer moves the cursor to the first incidence of the sought phrase. If it does not appear in the text, the Message Window shows String was not found. If found, to search again for the same phrase, press F6 again. The Forward search : prompt reappears, followed by the last seach phrase. Simply press [Esc] to search for that phrase. To search for a different phrase, press any key and the old search phrase is automatically deleted, making room for a new search phrase. To search backwards in your file, press [Shift F6]. Reverse Search works identically to Forward Search, except that it searches from the cursor position to the beginning of the file, rather than to the end. Forward Search and Reverse Search use the same buffer for the search phrase. If you want to replace the phrase you're searching for with a different phrase, use function key F7. Pressing F7 alone causes ST Writer to confirm each replacement operation with you, and [Shift F7] effects replacement of all occurrences of the sought phrase without verification, also known as global replace. After pressing either, ST Writer prompts: (Query) Replace :. Enter the search phrase (including presses of [Return], if applicable), then press the [Esc] key. Next, ST Writer prompts: With :. Enter the phrase that is to replace the search phrase. For instance, you can use Replace to change the name John to Jack through your entire manuscript. If you have selected Query Replace, and the search phrase is found, the message window prompts: Type 'Y' to replace string:. Pressing Y replaces the phrase and moves the cursor forward to the next occurrence of the search phrase (if any). Pressing any other key does not perform the replacement, but still moves the cursor to the next incidence of the search phrase. Note that Replace and Query Replace search forward only from the cursor position. Note: if, while entering a search or replace phrase, you decide not to make the search after all, press [Control K] to abort the process and return to editing your document. If you press [Shift F7] for global replace, all incidences of the search phrase are automatically replaced by the replace phrase without query. This is a powerful command, and should be used carefully! When entering a search phrase, you must type it exactly as it appears in your file. When the string is a single short word that might appear in your file as a part of longer words, it's a good idea to type in blank spaces before and after it. If you do this, though, include the same blank spaces in your replace phrase. And keep in mind that ST Writer will not recognize occurrences of such a search phrase that have punctuation marks immediately before or after them. To halt a search-and-replace operation, press [Esc]. SECTION HEADINGS. Use this feature of ST Writer to number section and subsection headings in a multisection document. The easiest way to explain its use is with an example. Say you're writing a text file about nutrition. In outline, it includes the following sections and subsections: Fruits and vegetables Fruits Fresh fruits Preserves Vegetables Dairy Products To number each of these section and subsection headings when entering them in your file, press [Control U] and type the number of the section level, then the text of the heading and [Return]. In this case, Fruits and vegetables is the highest level of headings, so you type 1 after [Shift F8]. The section level for both Fruits and Vegetables is 2, and 3 for both Fresh fruits and Preserves. For Dairy products, you return to a section level of 1. You can specify section levels of 1 through 9. Wherever you enter a section heading command and number, ST Writer displays a European paragraph symbol followed by the section level number you've entered. When it formats and prints your file, ST Writer numbers your section headings, raising the numbers for each occurrence of a section heading command at a given level. In other words, the section headings in your file on nutrition would be numbered as follows: 1 Fruits and vegetables 1.1 Fruits 1.1.1 Fresh fruits 1.1.2 Preserves 1.2 Vegetables 2 Dairy products You should format your section headings according to your preferences. Add as many spaces between each section level number and heading as you want between the section number and heading. And use paragraph markers, center or block text right commands, and print style commands in combination with your section heading commands to format your headings the way you want them. To reset your numbering of section headings -- say, in a large document where you want a numbered system of headings in each chapter -- press [Control U] and type the number 0. Then press [Control U] again and the desired level number when you enter your next heading. SOURCE FILES. You can create source code files in BASIC, LOGO, C, etc. with ST Writer. Set [Control B] to 0 (zero), [Control G] to 10, [Control L] to 1, [Control R] to 160 and [Control T] to 0. Be certain that none of your lines of code exceed the 160 (80 column printer driver) or 198 character (136 column printer driver) limit without an intervening carriage return. Also, the last page of your source code may not fill up the whole page, and when printed will have several carriage returns following the text. Use the print preview to find the page break (occurring at the end of the each page). When you see the beginning of the last page, make note of the position and number of lines on the final page in the file. Then edit your file by inserting [Control Y] followed by a number that is double the number of lines on the last page, somewhere in the text prior to the end. Then Print your file to disk. It is a good idea to also Save your text file under another name in case you wish to edit it later. SPECIAL CHARACTERS. Ordinarily, all ST characters with ASCII values less than 32 ($20 Hex) cannot be used in your text, as these have special meaning to printers, and are used internally by ST Writer as formatting directives. However, using [Control X] before and after such characters will temporarily shut off the interpretation of such characters in their usual meaning and will actually insert them into your text (particularly useful if you are planning to "SAVE ASCII" (GEM mode only) and the disk file you are creating requires such characters to maintain its integrity. This feature is for experienced programmers. Most control codes can be produced using [Control X][Control {Key}][Control X]. You may use as many [Control {key}] characters between the [Control X] formatting commands as needed, but no normal chararacters (ASCII numbers greater than 31, $1F Hex) with the exception of [\] which is used solely before a [Control X] to differentiate it from a terminating [Control X] formatting command. Exceptions to the normal {key} characters are: To get: Use: ASCII 0 (null) [ Return ] [ Control A ] [ Control U ] [ Control U ] [ Shift F5 ] [ Control X ] \[ Control X ] [ Control Z ] [ Control : ] [ Escape ] [ Control [ ] or [ Control ; ] ASCII $1C [ Control < ] or [ Control \ ] ASCII $1D [ Control = ] or [ Control ] ] ASCII $1E [ Control > ] or [ Control ^ ] ASCII $1F [ Control ? ] or [ Control _ ] SUBSCRIPTS AND SUPERSCRIPTS. Printed a half-line below or above the line, subscripts and superscripts are especially useful when you're writing about chemical or mathematical formulas or including footnote numbers in your text files. (Check the manual that came with your printer to see if it's capable of printing subscripts and superscripts.) To specify a subscript, press function key F10 before typing the material to be subscripted and [Shift F10] after. To specify a superscript, press [Shift F10] before and F10 after the material to be superscripted. ST Writer displays inverse video up and down arrows where these commands are entered. So the chemical formula for water would appear on your screen as H(down arrow)2(up arrow)O, and Einstein's famous Theory of Relativity as E=mc(up arrow)2(down arrow). If you wanted to use a superscript o as a degree symbol, the boiling point of water would appear as 212(up arrow)o(down arrow)F. TABS. The series of arrows that appear every five spaces along the top of your Message Window each time you begin a work session with ST Writer are the default Tab settings of ST Writer. To remove any of the default Tab settings (or stops), first move your cursor to a Tab stop and press [Shift F4]. ST Writer prompts you to Type 'Y' to clear current tab stop: -- pressing Y clears the stop and removes its arrow from the Message Window. Conversely, to set a new Tab stop, simply position the cursor at the desired setting and press function key F4. To clear all Tab stops, press [Control Tab], and to restore ST Writer's default tab stops, press [Shift Tab]. Here are some important facts to know about using Tabs. Using the Tab key alone always inserts spaces to the next Tab stop. To tab forward to the next stop without inserting spaces, press [Shift (right arrow)], and to tab backward to the previous tab stop, press [Shift (left arrow)]. Also, Tab settings are saved along with your text file; thus, you don't need to reset them each time you load and edit the file. Tabs are perhaps most often used to create columns of numbers or words. In such applications, we highly recommend that you use ST Writer in TOS's medium or high resolution to take advantage of the 80-column screen for proper layout of your document. UNDERLINING TEXT. To enter underlined text in a file, press [Shift F3] before typing in the text. An inverse video underline character appears. Press [Shift F3] again to return to ordinary text. UPPER AND LOWERCASE CHARACTERS. To enter a single upper-case character, of course, you hold down the [Shift] key while typing the character. For all uppercase letters, press the [Caps Lock] key, whereupon the letter C appears in the right half of the message window, and press it again to return to all lowercase. With ST Writer you can also change letters that you've already entered from lower to uppercase or vice versa. To do this, position the cursor on the letter you want to change and press function key F3. To change a series of characters, simply hold down the F3 key. `1Q` Efv*oM\ m HPHUBg?<JNA(m)m -:gS)@ -OK1PC#HN Hx?<HNA@)@l/?<HNA)@h&@)@XЬl)@d)@`ARCpr Ѝ"QHNFALNHz2?< NA\pdAxr0XQ)K\NNHAᤐ NuN ,`NuJrBjNuHz?<&NN\CAp$L Qp NBlJpNNpMN9@pdAr 0Q0tr N9lNupealp`NuaNJHz?<&NNBWNANC2A@p222NrҌ0<NB0,rNurA9Ar`v C9Cr`rt9@9A9BNrrҌpsNB0,Nu9@N`rDҌpsNBNuC2 @ e @}bA@p222Nr,Ҍ0<NBNu Hn 2$4BBNuAd RdQRB BbABJk 0NuJBjBBXNu 0Nu 2$NuE`B<gJEgEjCDEDF Fe( F dF8BCHC` F0bFHC8v` HD8HDkDуdQRBNuDdBDA@kgAр[SBk0NuJlJBk&Nu0g H@rB JkЀ[` BbNuJBj prtNuHPAJgPpr$< _Nup _NtNu&8*JEgJBgJjBEB:HC҅H@:|ۆ҄ۆ<HC>H@ЃdHA@B@H@хk HAҁHAрSB BbNuNpNNuCDEJEgJBgJjBEBQ*HE?<>0rHGGdHGGdSWDуdi\?<>0rHGGdHGGdSWDуdiN?<>0rHGGdHGGdSW2 H@Nx?<,>CEdGH@0r`?<`JBgVB&8TTDуdQRBNuDAр&AdRAрAрDуNuprt|=|  g +g -f .g20  b 0e 9b da`RF` .f 0e 9b dajSF` Eg efX +g -f 0e 9oSH`00  b&Hz0  b E Do`HJjDDDS4</NJFkSFk&aQN`Ha"FFaQL8N^6.JgtBnNupr$<NuJBk4<rpAC v JBgJjv-| Bb BkH>aaNRFBdL8?N^<JBga2SF Be BgQRB`ApdR e <rRF&0xafEv+0JFjDFv-Hƌd0BFHF 0HF0ANuprt|`2:HQ A dNAXJ@jNNu ::/rI IN<,(k$/<??<?N`NA Jj ?a0NNHrO INLA NNN` A$ HJo d*b` QjNuQjNubNNpvN)@p `H@)@prtNAHplrtNB 2pNpNpapaprapalpalpalpaTpaTpaTBp'a?<NNT@B){L9|0<rtNpapap9@p`pvNv`v`vj`v `v`v`v`?Aa*` Al 2l 4)lVH)lRprtNAl 2l 4HVNu9Cp rtNAv` Av `Avl 2l 4)lVHNaBp0,l 2Nua40,HNua*p0,l 4Nuaprt0,l 22,l 44,NuN9||BlBlrҌpsNBNu0<}Nr& ?<NNC`&?<NNT"@ C <}N`Np@((?<NN.?<NNX@LvA HA HNuNup9@HA)A,N^ FN @e024E$ Bb5B5A6CC5CK5CAB008:Dk`Ek\00<,>,SFSGFnHGnDDDk9DBlDEk9EBlFcllGcll0,lb 0,lcNuRpmrtA)HA)HNpNrHHPN^4 _:8><DbFEbGCHP@dʾAdBD2ƞE29|C???FF22N23BRG0@\@Nr"2)INR(* 9AJA)H@@[000][ˈN Evz`* [g" ]g |g QSz` zQSpQ][ɈN Dvx`* [g" ]g |g QSx` xQSpQ]Bp4NHNu*( INA)H @depd ae zb QB DNA\)H @ e` ae zb \gQBA BhNpZNA BP"`#|}N*A"H0,tg"Hg \f`A\fS A ENrAR@H`2QNu2(g"P@g2RADAH""l`r2oZAe 1@#)I`Nuk1@Nup NN"l`dpNAtrdJhk\QpaNH ld$l`"Hg: k&@0+R`g k#&@0+S@H3 Q&f)I`LNu?<?<NAXJgJgNlAH@B pNA NuApNA0pNN$N$BS@kH2QNupC ұd"X0Pg"RA$D#Nu"X0NuNJ@gpNu _0HpN _0HpNp"_0HqNp"_0HqNE ұeHHQ0)Nr$_$ZR@H`2QNu$Y0gHR@@"D%$X0P2g# R@%NupE $ $X0dP.gRG,D%pr Y2dP.gRG,D!p4Ae4v`VfANuN`WHNuJhg N1NlNu Ihd*N$E$RR@H`2QˈN ENu Ihd"*N$E8*$R`"QˈN ENu2)A IJAfr4(Ae*RBBc0*SA?N$E$R`QˈN ENup`(* 0(iN$E 4R`Q$D 4R`QˈN DN ENu2p <0N`QNur ,* N& ( EN C"Sj|AcJf`CfSHj-D@Hd0H@H 0H@0`fSC\fS , @a"C\fApNNNxHP?< NA\NuH@aa/a a Nu@0 9c^Nu| PC>$Error # ][Abort]\f.B &lX)K\)ld` lp ,BQjNup(NV"l`Yd&-KNN"l`YepN&#k"C-KN"Cփk փk2##`փk"`2`$Y8gHRDD*D%H8#$c2g# HRDD%H`?<NNT+@HA1nNX -HJWHfN ?<HxHx?<NN pp@pWBg?<NN\pp@pW?<?<NN\pp@pW?<?<NN\pp@pW?<?<NN\ -HU]HfN +|ǀLN!+|LNO Page: Page: Line Up: Line Down: Start: End: Quit: CN <NC N N/ - /p""_N+|PA NAPNHm -P"_N,HPp Nl"_NfN!Hm pNl"-P"_N:N`NqNqHm p"_NN !]HfN"bA NU]HgN"bHm A NNfH <r$<L8NN"_NC N `Hm p"_NN !]HfN"A NU]HgN"Hm A NNfH <r$<L8NN"_NC N `A NU]HfN#2N\*.*HPA HPA""_NANJWHfN#,A1NXN#>A CN NJWHgN\+| T -TC퀔Np rRNCN p NlHPp Nl"_NpCN +|X -TNfH <r$<L8NNAXN/-XAC퀔NN`NqNqBAC퀔NpINlHPAr"_N,pN+@\ -\ ^HfN$:p"<NRC$N N$Lp"-\NRC$N pNHm$A"_N+@`N+@d -dNfH <@r$< L8NNC*N -dNfH -\Nf&<x*<N|&<@x*< N L8NFfN$A/NX -`JWHfN%A/NX -` ^HfN%(A0NXA C$N -\Nf&<x*<N|&<x*<N NC퀚NN -HU]HfN%pN*pN.pN2N%pN*pN.pN2prNn -L"<N -HJWHfN&?<?<?<??-NA0" Nr?<@?<A0"NNN LOADING ANN -- Length of File: -\NfNNN BytesNHmpC퀚N"_NNN,File LOAD is complete. Text FORMAT requires -\Nf&C6N A6NUWHfN*A6NN+@PA6NSWHfN*A6N+@| -|Nf&<x*<NFpJBgp/ -|Nf&<x*<NLpJBgp$VHfN+ -NfH -NfH -|NfH <r$<L8NL8NH -xNfL8NL8N N+@A-xNXB| -P PWHfN++|x+| -Э+@A-xNXBP -P HWHfN,,+|x+| -+@A-xNXBP -P KWHfN,l+|x+| -+@A-xNXBP -P MWHfN,+|x+| -Э+@A-xNXBP -P GWHfN,+|x+|+|A-xNXBP -P aWHfN-A1NX -P RWHfN-f+|x+| -tNfH <r$<L8NN+@A-xNXBP`&A1NXNxN -NfH -tNfH <r$<L8NL8NLfN- -tNfH <r$<L8NN+@ -J_HfN-+| -Nf&<x*<N H -tNfL8NjfN.l -+@X -tAXNN -XC퀔NNN`NqNqN. -+@X -AXNN -XC퀔NNN`NqNqNprN4pNlNppN+|ANA퀈NHmp"-"_N2N??<?<NM\N`NqNqNpNlNpqNN~N< ERROR! FILE TOO LONG!| File Must Be Text File Less|Than HPA*"_NpHPN2 Bytes With No Lines| Longer Than 240 Characters!"_NpC8p`(, oC#b мШ ШШ##x#p (S##t//??<JNA B?< NA\#.|a,33 3`By0< yg: yg.0< yg0< yf3S`0<3 y33?</<NM\O?<f/<NM\O/<j?<?<NMPO#33??</9,Nl\>?</9,Nl\.Ne```NV y 1|  y 1| r y 1|!J9tg,Bn`0n2ntRn n@o3*3 y 1|! y 1| >?<!NTg y 1|! y 1| y Bh y Bh# y0R y0R y1# y9R y9R y9# y0R y0R y1 y\g&>/9 NX=@ nf` y 1| R y hjN=@Jnm yfNh`JByhN yhf 9#p#x.Ne ygSy*Jy*nBn`0nt2nRn n@o yg yfNe yf>N yf>n?<>NTN^NuNVBWBgBg/<NPBW/.?<=N\=@Jno..,/<?.?<?NP>?<>NTN^NuNVHBG`t0G0 0Gž0 0GN0 0G0 0G0 0G^0 0G0 0Gp0 RG|mBy„3bBG`0G0RG0G.RG|m3 D3FByL3NByR3X3 By3F 3 33 3ByJ y\f43ByByD3 L3O 09L@yJByBy ByByByByP3T3 ^ByByByBy 3J#B9:By>?<!NTg 3By>?<!NT g 309S@3HJLN^NuNVHN t ygJyg yf6.N7B yf.N7B`.N7B`|3`.lN,j ygJyJf0 yfSyN|f0y"<l00|| f<`Sy0y"<l00|| f09ذyn`T y  f yf:`0y"<l00||g>Jyf4`S y  eS`S y  e0y"<l00|| 2yl209S@309ذyo 0y"<l00|| fBJyf"`S y  fR`$`Sy0y  fRy0y"<l00H3J09S@3 yf"`Ry0y  g``R y  g yRfN|f 09^yS@=@`>9``RG0G"<l00|| g ymܾyll<9`FGg0FRHl2Fl0`"0F"<l00|2FRIl2SFGl09R@30.S@=@Jnf >9`*`RG0G"<l00|| f ymܾym"JnnJyg 9갹pgNj 9갹pd09Xyoh3TJy*f yf y„fN JLN^NuNV33 =y`20n"<l00|| g By`By Rn0.ymBnJyfJy f=|0.`N^NuNV09J|H=@3„Jyf09TygN(09Tyf>^SW?9TSWN$T`>BgN$T=y yJf y f=yFBy 09n29yDAlJyg09Tyg no09HR@=@`Bn`J0.2.HЁ @"< 00|2.A2.4.H҂Ҽ "A2Rn0.2.HЁ @"< 00|| f0.ymRn09nHnn`09n3`N N^NuNVH>9HǏ<.`&02HЁм @2Fl0RFn oJLN^NuNV. H` 4N "=@Jy\f@0.HH@n=@Jnm09ynl=| 3D` N,>` `R yJg 9갹pf yJfR` yJgdJyfZBn3h`Rn0n  b0nB`0n2nQ SnJnlBWBgBg/<NP 9#p#x.Ne#Bn`0n0 0nž0 0nN0 0n0 0n0 0n^0 0n0 0np0 Rn nmt 9pfBWBg?</<NPBy*`(BWBg?</<NPBy*#p`N "=@Jy\f2Jnm0.| y oBn3<3`N "=@Jy\f609| nn no=|3<3 `09Jr@3J`p`R y f 9Rpe`D3J`8Jyf03JyJ 9갹pg 3`3JBy`N7`=yJ09J|3J=y =y3./<^N2X./<pN2X.^N,j.p/< N2X3J3 3By3`@=yJ09J|3J=y =y3./<žN2X.N/<N2X.žN,j./< N2X3J3 3By3`N "=@Jng=|3R`zN "=@Jy\f> nm no=|0.| y o =y3`&N "=@Jy\fH0.HH@n=@ nm09yyDnn=|3`N "=@Jyg0Jno"09yDyHnlN `N "=@0.HH@n=@ nl=|09yDno =|` no=|3`N "=@ByP no=|Jnl3P0.D@=@3X`33`3N3 `N "=@ nm no=|3N`zN "=@0.HH@n=@ nm no=|3F`6N "=@Jnm noBn0.H|H ygJyg yf.N7B`N "=@Jy\f@3L yLn JyLlByL09J|29LAA3JBy 9갹pgR`XN "=@ nm no=|09| no =y 3 Jyg(09Tyf09 ymN `9Kg09Jr@3J`09J|3J`9Kg09Jr@3J`09J|3J`vN "=@ n n JnlBnJnf6`&0n0Rn0n.Rn nm`0.@U@309T@=@`&0n0Rn0n.Rn nm0y"<0HR@H@ .9o|00yBybBy`N "=@Jy\f@0.HH@n=@Jnm09yDnl=| 3`009Jr@3J``|b@0@ PN09Tyg09Tyf"09^y g&09^y g3T3 ^N^NuNVBn3Bn yP .-f=|R yP`*0. .H|A=@R yP .0m .9o nf0.D@`` 0.`N^NuNVHJyg09Tyg09J|H=@>9HǏSG`x<9SF`f02HЁ @"< 00|| f>02HЁ @"< 00|2.A24H҂Ҽ "A2SFJFlSG09H@lz3<3T3 ^`<3T3 ^N(By09XR@3XN!By„JLN^NuNVHBn yf yf=|=y nm=|09jyXn09Xyn yfBWBgBg/<NP` yf@ } ~>XSW/<|N+XBWBgBg/<bNP`< _ `>XSW/<^N+XBWBgBg/<:NP09H=@ y\fn 9갹pf^>.SG:<`SEJEf:<SGJGm(02SAHЁ @"< 00|| g0R@=@|fRnJyg0JygB09XS@HH@29HHAAfBG`:<`SEJEo(02SAHЁ @"< 00|| gBFBn yfno:.JEgl`T02HЁм @=P0.|"|"f=y4`0.||f=y:`n0.||f=y6`R0.||f=y8`6.g=y0` .g=y2` =y.0.||f< yg yg 9Lf>WW N2`J0.|| e,0.2.A=@09,ne >N2`>WN2RF09,ncEm yf2> ?9?<NX> ?9?<NX`.N7B=yH0.nd 0.S@=@>?<NTJ@fnf nf>?<NTJ@f =|`>?<NT=@ nf~p#pBy*`b ygV ygJBWBg?</<NP 9f~p#pBy*BWBgBg/<:NPRGnm yf9:gB>?9?<NX>q?9?<NX9:H|H:BG`>-?<?<NXRGnm> ?<?<NX> ?<?<NX yf~ 9갹pgn09Xyl^Jyg yfHBWBg?</<NP 9f#pBy*BWBgBg/<:NPJLN^NuNV yDox-|-|^JyPl-|-|p09]@3.N)>BgN$T09T@3.N)>BgN$T09PD@3PN^NuNVlHBG`,BF`02HЁм @0 RF|mRG|pm yo-|p-|žlJyPl-|Np-|l.t/<lN2X3.pN)>BgN$T09T@3.lN)>BgN$T.l/tN2X33?9X0.nHмl/N*T\n=@`0nl2n0Rn0<ƐnnnlN^NuNV0. Hd=@0. 2.dAH =@0. 2.dA2. A=@Bn.g=| n1n n1nBn0.nR@=@0.nR@=@0.n|02n20.n|02n20.n|02n20.nT@=@JnfZ0n2n00n2n00.R@=@Jnf0n2n0Bn0.`N^NuNV0. Hd=@0. 2.dAH =@0. 2.dA2. A=@0.|0"n0.|0"n@0.|0"n@Jnf n Jnf n| N^NuNV3 y f3 RN^NuNVH=yT=y^By:9J|M| Bn`0n0Rn nm yfJyg=y=y y fJyNl09ND@3 yJfBy 0.S@33JyJf y  fRByJ``409S@309J|H| 2y2RyJyo0.S@yn yfV0y"<0H@RyJ@f0 yPRBy 9갹pf 3J`h ybg40ybPRyb09byo 3b`* yPR 9갹pf 3J . d Jyg .f.@>Nt yfJyf .f=y `z . f=y0.S@3`X .fN:9J|M| =|`0n0SnJnm n2.H00|| g` . g yf 3 yfz .\g . d .\f$ y gBy3J`: .\f" 9갹pg yPR nlRn09V@nf9KgSn09JH.AA2y2Ry9Kg09JH2y2Ry09ذnl JyJg09S@3 yf0.S@3 yf`@ yPR . d Jyg |g.@>Nt yJg 9갹pfBG`0G 0RG|mJy fd0.yS@=@>.SG`0G 2G0SG0nyl<9`0F 0RFGo` y f. /.N2X yJf09 `0.yS@=@>.SG`0G2G0SG0nyl<9`0F0RFGo`0.yS@H=@>.SG`0G2G0SG0nyl<9`0F0RFGo yf. /.N2X``|gt|g`JLN^NuNVHBG`0G 2G0RG|mJLN^NuNV0.HH@0.|H@09`.H|9:H|AgZ>?9?<NX.g>p?9?<NX`>q?9?<NX:.@>?<?<NX``.@>.H?N3T`B.@>NeJ@fNe#p`|b@0@\ PNN^NuNV. g. 9_?9?<NX.|N7B9:H|H:. H9:g. H|9:H|Ag(. g.NeJ@fNe#p`2. @ @"<<0H>?9?<NXN^NuNVBn`n yg. yg" nH>?9?<NX`. nH>NeJ@fNe#p=|RRn n g nmN^NuNV yfBy3'jByNf=@ nf3#p``v nfl3F./</<`/<N yfN@BW/<?<=N\3nJyno 3 yfr=| =|33`@0.Hм./<?9n?<?NPJflJy*oSy*Jy*oBW?9nB?<BNP`$>n?<>NT3*30nBBn`0n  l0nJl nNfz0n  g nNfZBn=|0nB( nNfX0n  gF0.Hм./<?9n?<?NP=@ nf0n  f0nB`.0.Hм.R/<?9n?<?NP=@ nf(0n ( l0n ( fJnfRSy*Jy*oBW?9nB?<BNP`$>n?<>NT3*3`>?9n/SDf~?|33a 0NuJEg|PmNqa\SEfNuJyf( |09f hg* 1EaJEg|PmNqa SEfaNuB@ @ l?</<NM\O yg yf?<p/<NM\O`L?<c/<NM\O?9/<NM\O?</<NM\O?<b/<NM\O?9/<NM\O0 fN yg: yg.?</<NM\O?<c/<NM\O?9 /<NM\O0<"`Jf 0<<` f 0<`r f 0<`b l|@?/<NM\O`R f 0<`6 f 0<`& f 0<_` f 0<`0<??/<NM\O?</<NM\O yg yf?<q/<NM\O`\?<c/<NM\O?9/<NM\O?</<NM\O?<b/<NM\O?9/<NM\O`?/<NM\ORyNua ?</<NM\O?<K/<NM\ONuJyg/<?<N\OByNua?</<NM\O?<E/<NM\ONuaBCg atJfNu?</<NM\O?<Y/<NM\O09| ?/<NM\O09| ?/<NM\ONuaJ@fNuB9ta `.Jyg 9󴰹tfP 9pg` 9 |@(pf& |@"yB(Sa J@g"3j3a_|fpNua` 9#p#x#tBy |tBaba_pNu/<?<NM\ONuB93 j3a_< @gDB@ ya4J@g2/9?<ANA\O3jJ@g 3 j3a^Nu 9xgnJyfPSyJyf 9gxa3 |0900S@3`SySxapNuB@NuaJ@fNu |092(SAyn$ 9xRpf 9tf PJf609R@yfxaJ@g,SyRyBy`RyRxaDpNuB@Nu09H&yx3aJ@g Syf*|Bya:ByB\M(Ka Ry09yo |3Ry09yo xa`"XJPf"gdJ)gSy0(`$Iصxo 9x3Jyf*xa:J@g3 | 9x3a:Nu 9xpf 9tg0<NuB@Nu KB@BC29pf,$9tgD/ "yt"_RpRtfR@Nu  f6R@AmJCf0Nu0R@Nu yp"ytRI09` S@k oSI#t#p`^ 9xpf 9tg yxpfSp&|092Sk`S\KRAyo*|09gS@&Uaްmf\M&Ua`Sy3;@yl3:y(KJyfBa&U`Byat:(Ka\MRy09yoapNuB@Nug<(K`Jf RgRK`SKf`aAmNuB@Nu yxJyfg6 g.Jg("|492)ygtNu"9pRtmBBNu#ppf |092Rh`R\HRAyotNuNVHB93(j3Nf|f*| -M-|J=| ye=|3+j3NfH|@H 9Cg9H|=@3-j3Nf=@=| nf=| ngP0WNQPBF`:.`0E2Er0RE| mBE`"x nE0E2Dr0REnmBE`0Er2E0RE| m>/BgBg?<?.B/ ?<N=@Jng3)j3Nf`RFnmHRG|Pm*BW?.RW/</ ?<N >BgBg?<?.B/ ?< N>?<NT-@>BgBg?<?.B/ ?< N n=h n0(no n=h8.p dHĉBE`0EBPREDm n1| BE`RE0E2E6f n:(ERE>? n?(/ ?<?<N BE`0EBPREDm n0 n1|BE`B n2H00"n2) AH"nT@=@./.??< n?(/ ?<?<N > n?(RW n?(/ ?<?<N JL N^NuNV n (g0.@H-@ n0`0.@nH-@=| . g=| =|`=| .Ю-@ nP nh.UNN>0.nn =@.UNN> n nnN^NuNVNV n0X0N^N^NuaJ@g:ByBy31j3aR @gV @g |`B3 F/</<//<a7P @f#3`4/?</<NM\O?<K/<NM\OSySDfaaNu3Ty3Wya< Jyg<Da@< Jyg<Aa*<IJyfg<a< Jyg<C?/<NM\ONu33 y0?</<NM\O?<b/<NM\OBg/<NM\O?</<NM\O?<c/<NM\O?9/<NM\O33Nu?</<NM\O?<b/<NM\O?9/<NM\O?</<NM\O?<c/<NM\OBg/<NM\O33a y09W@033Nu3T ya0Jfg3j`:g3j`&g3j`g3j3aK`JyTgJyff y"|p"Q/ JfSH (\g (:f3j3aK"2< "_ SAf @g& ya2`JyTf3j`VpNupNu ytRH"yp 9󴐹tgV`0ؐnرo#p#tNup yalByJ@g4ar# 9p# yaLg3j3aJ`3J/</<?9J?<@NA g3j3aI`/</< ?9J?<@NA g`/9 9/#P?9J?<@NA Pg` 9ްf4ByJyf$"|t yf ya |a$aIb09Ja8NuH&o(aLxNua*a?9B9pa*3Nu??<>NAXONuBg/?<yaaJ@gJygay@fpNuyBg y Bf|r fpNuJyZfBy?aB03Z` @f2gJy>gBySy>SySKaa$`b @Sf( |>gHBySy>a`4 @Kfg"SKSya` @MfgJgRKRya` @-fByax` @sf y&|aF` @tfJf a0`RyRK` @ g @r fB@` @f f 0<` @Jf 0<` @Xf 0<` @Vf 0<`p @f 0<`` @\f 0<`P @Cf 0<`@ @]f 0<`0 @Df 0<` Jyg @g @,g&By |>RHmJyfgJg K`Ry> KnBaDRya RK`v Kla&NuBy> y&|BaNu/ ?9a K89>Hg aSDfa(3a&_NuJyf?</<NM\O?<e/<NM\O/< NMXOfJygfBy`JyfR3?9?909ynaa3309ynaaa::JygB@`0/<NMXOJ@g^/<NMXO"AJyg&?aR?</<NM\?<e/<NM\0 @-f y`. @wf y` @Rg @R0fV yf?9?909ynaa3309ynaa` @Sg @ fF?/< NMXO2g ASg&0<9` @g0 af <`. Af <` ef <` if <` of <` Of <` uf <` Uf <` yf<` 'fta8J@gJyg af <` ef <`t Ef <`d if <`T of <`D uf<`4 ~ftaJ@gJyg af <` Af <` nf <` Nf <` of <` Of<` `ftaDJ@gJyg af <` Af <` ef <`p if <`` of <`P uf<`@ ^fdaJ@gJyg& af <` ef <` if <` of <` uf<` _f4a`J@gJyg af <` of<` /f4a&J@gJyg of <`r Ofj<`b f4aJ@gJygH af <`8 Af0<`( -f aJ@gJyg YfSp&|a!nJ@g@aj9 g. Pg pg Sg sgaߺ`#aNap&|ra J@g |an |a,Jg&|Qa`xaB@&|a |aJ@fr yD(3J@g @fF#A .g2#B@aJ@kL3J/</<??<?NA f& |"|0<aJ@f (|~`(|09g(|a< 09g<*a< a(ya< aRE|m09f 9a8(|a(|a09JaRDaJ@g: gjaB@&|.aPaJ@g gJatB@&|a0?<ONATOJ@gJDf&|a$`Jyf6< a`?9aFjTNuHaLxNu?<NATOA:BgHy?<GNAPO |JfS\Nu (:g,/ |?<NATA: _"|`"/AH??<NAX _"| \g\f |"|f#S !\g`"|J)f"|/ ?<;NA\ONu?/9NM\ONuBEBCgREa`Nu/<NMXOJ@g /<NMXONu /Bg/?<NAXONuH#(3Jyg aN`aLxNua0J@ghBy` 3By ygzpa2J@g8`j y`RH< o#a"y< o`# y"|< nBfB # 9tp#p yag(Jyfa3j3a:l`3J/</<?9J?<?NA f|g,`B09Ja>a3j3a:`$ |"|0<aFJ@g:Bg?9JB?<BNA yJyg yx//9?9J?<?NA fxf(a609Ja3j3a9|`йp#pJyg y f ` f ` f ` f `x f `h f `X f `H f&Sppl6"H$IRڳpm`f m n f ` f ` f ` f ` f ` f ` f ` f ` f ` f `p f `` f `P f `@ f `0 f ` f ` f ` f ` f ` f ` f ` f ` f ` f ` f ` f `p f ```XgJyfB3`Jyg,By"yp$IRItl#p"nRHpm<09Ja`~By 3j3a6n|g 3 3 yp"ytRI xf  fB`B  fRItg8f  f$Jy f 09  gS@fٳtf#p#t09JaJyg3`Jyg ?<?9J/< ?<BNA `./</< ?9J?<?NA f>| f6/9x/9?9J?<?NA fgйp#p09Ja8Jyg3`$ y"|tfaa5z ya2Nuapa|9 yg YgBFNu 9&g"| aJ@g 09aNu g f4g3j3a4t`3j3a4\Nuavaa g#|xo(xla3j3a4`VRI /&IaLJ@fXO`< y|pmUp$y|"9x lU#xpNuB@NuJgʰmbJyfa830j3a3`4// a3j3a3h< FfBF&_ JFf a`d/af $ypmJ#p K#&mB&`"| SfطmJ&fapNuBNuJgL yptm3j3a2B@Nu$yp#p`"xfSfpNu09*|&Ua(K:? KfaBya0Jmg$g\M09R@3yoaNuNuH?Jyf ?98<aZ33`409yfH&|Jkg48<a͞SyJyf/<?<N\3&|29090+fJyg]KSyf`S@Al2&S3#xaLxNuaF 9󰰹pf2 9󴰹tf""|@HHa,#pxaa8a$9p"9󴒹tԁ 9󴐹󰐂SoJygTBy`J3Jfa:a63#j`3!jn 3"j3a0ha09y,f09y*g3*3,a09yf xaaҬ |09&Xзpg$ ytRH"yp!fSH#t#paJ@fa$J@g`Jyga @g @Sf2 9xpf 9tgaӆ3`v|Gf|3j3a/P @gT 9#p#x#t |tBNZa/"|@HHa"#pxa2aa߸` @faJ@ga3` @HfJyg yn4?9xa33 9g 3Sy |092(SAyl3"P#xaͮ`> @Pf |09"hpm#pxaИ`09R@yfxaɲJ@gSy`092( gSAyl0pl#xRy3a ` @Kf aΘ` @Mf a`| @ g @r f#xaJ` @;fa #pxa,` @H8fD&yf#xByBya4`89aJ@g@SDf`8 @P2f&|09&Spf 9tglBya6:By(KaRy09yo09H3 | p#xpf aΨ`Byav` @sf( |09#xByaH` @tfBaJ@g |09"X0J1fS@3#xa` @=fT yx Am< Zn | ` am$ zn| 36aSya`6 @Sf@ |09p0(y&yxaD309a.` @SfF&yx 9p"9󴒹tЁ3aBy309a` @?f03a0ByJ@g309a̬`n @afa3`V @<fj3aZa a g4/9x/ aJ@fPO`#x 9&"| a #xxlUxa$` @UfazJ@g3a`İ|[faa a g Sg#RI#By>a3ByF |`B/</<//<a ?09a˂0J@g#pa2J@gaByaa `aɢ` @@f0pa J@g3>x |&H"|faݘ:9xaנJ@f`x"| )n,09S@$Yѵo#xaa`2pm 9tRp#xa&aa J@g |"|009>f aN`3S@fp&|>By>a vJ@g3>ar/9xByJy.f #x yp"yt` xf#p#xSI#t/9p/9t#p#t&|0:9a#t#pJ@g3"ytR$ypg`S#t#pбoJ#t09$ypJ@g&|3S@f#p#xSxo2aP ypSH#p`"#x&|0:9a6J@f:#xJyfaa3$a֤09$`&aa֒`3#x |09"Pxo a.`a&|KB@aa^ @gz yg YfJ&yxp09a3"|09HaVJ@f3`,a yxSH#x` @9ff |JfJfJfJfJg3j3a$<< @g3 |BBBBBaL` @Ifx3j3a$ @g3 y f |"|"""""`&2< y f2<0< |0S@fa`* @>f>309H |@09@2<i0AfPa` @f\ 9xRaJ |g&|f |Sfaa:B&|atap3$aN09$` @Bf yp"ytRI` xf#pSI#t33F |`B/</<//<a?a0J@gJ#BaJ@g4a |tJf$//9aPNZa#L yaBya09aan`|K4fd09g8H |@~>:E E` > z fSDg R|f`093DHxa`@|M6fajJ@g.098H |@>:E E` >z fRDygSk` |090(S@@o8yHٹxya"` @ f098H |@>:E E` >z fRDygSk`y?0H"|zah0Hѹx*|89&UBaĐf mg.B;@By:(Ka\MRy09yoaÂ` @Xf2a& g g3 j3a `<` @Vf <` @\f <` @Cf <` @f f <` @Jf <` @]f <` @Df <` @Wfd09H |@09@2<i0Ag?/3j3a _2 @g3FAPa`Jyf" @g @,g @f <`JgJygaJg3 |09:(yn2?9(yxyaRx3Rya` |JgRy>`ByZ?a3ByaDga`a0g\ @f2a؎J@gJygapSya`$z:9yڼa?a0NuaNuaD09U@3Bya&|89>z6<. g6<^?/<NM\OSDkSk`a|Nu?9 ?9 ?90?9?9a' y09W@03aaNuNV` n "nR R nJf n BN^NuNVBn`0nBRn n@mNd`Bn`0n2nRn0n"<J0f0nBBn`0n2n2n Rn0n Jf0n2nBN^NuNVBn`Rn n2.HJ0f`0nBSnJng( n2.SAH0H@|\g .:f0nB nJ(f n|\N^NuNV./.NX n BB?<NT0yF"<./U/. /.Nz B?<NTJnf 0.`Z n Jf3j3NfB@`4./.NX.N. /.NX0.`N^NuNVBn`Rn n2.HJ0f0.HЮ./. NXN^NuNV n (:f^ n (\gPBn`Rn n2.HJ0fRn`0n2nSISn nn n|\` n \fB@`R nJfp`N^NuNV ymH>?<+/9,Nl\ yh yf yh y,hr y hRBn.D/<B/<@/<>/9N>D?9B?9@?9>BgBgBgBgBgN` By\ ym6BW?<+/9,N@\Jyg>?<+/9,N@\JyfBW?<-/9,N@\`>?<-/9,N@\JyfBW?<,/9,N@\`>?<,/9,N@\Jyff0>?<(/9,N@\BW?<)/9,N@\`,>?<)/9,N@\BW?<(/9,N@\B?<NT.Y/Q/Y/Y/Y/YBgBg/< BgBgBgBgBgBgBgBgBgBgBgBgBg?<N8=@B?<NT.gn nam nznn =|3  nAf3(`X9Hnf3$(`<9Hnf3(` 9Hnf3"(`9Hnf3(`9Hnf3(`9Hnf3(`9Hnf3(`9Hnf3(`x9Hnf3(`\9Hnf3/(`@9Hnf3+(`$9Hnf3 (`=|.gV09 `0`H09&ylff>N ./</</<?< ?9&N8>/9,NX`./<(N8XJ@g3d3f09yS@3h09yS@3jBW?9N@T.d?9NT.N>?9?9?9?< Bg/9N.Bg?9NX./</</<?< ?9&N8Jyg JyfBWN `>?9&/9,N\09(`p3j3Nf`p3F.2/</<`/<N =@#t nf#Nf`#t3NV`ByF.2/</<`/<N =@ nf#ByNV`3\NNz`NNV`NGnNz`xBW/9,NXNNz`X3F./</<`/<N =@ nfx.N 33 jNf=@>?<!NT=@=|g>W?<!NT`>W?<!NTNz`Jyg*3j3Nf|f=|`=|`hBW/9,NXNp `NBW/9,NXNA&Nz`.3FB9`./</<`/<N =@#t nf#NB` y Bh y BhN> /9 NX|fNHN`>?<(/9,N@\BW?<)/9,N@\Byf`VBW?<(/9,N@\>?<)/9,N@\3f` ymN<(Nz`BW/9,NXNa`09r@3`09r@3` ygN;Nz`3ByjNfV@3 y f 3 09 HM`d3 09 HM$NBL.2/<NX.O/<NX=| y2(f43ByjNfV@3 y f 3 09 HM32jByNf=@ nf.2/<NX`B nf.2/<NX` nf.2/<NX33j3Nf=@BL nf WL y Bh y BhN> /9 NX=@|fNHN nf34j3Nf|f>/< ?<=N\=@gT.?.NTJ@g(.F9NH| H/?.?<@NP>?<>NT`33jNf` `| |*b@0@ PN`"`| gH|gȰ|g`JngtNN^NuNVB?<NT.Q/]/Y/U/.N>?.?.?.?<$?<$BgBgBgN>?.?.?.?<$?<$BgBg?<N>?.?.?.?< Bg/.N> /.NX=@>?.?.?.?<$?<$BgBg?<N>?.?.?.?<$?<$BgBg?<NB?<NT0.`N^NuNV. \/. X/. T/. n?( n?( n?( n?N`N^NuNV n> n0W?.0. WNT=@ n> n0W?. 0.WNT=@> n?NjT=@> n?NjT=@ n0 n00.n"n20.n"n20.no0.nnB@`p`N^NuNVBn yfjB?<NTN =@By ng>>?<?<NX>e?<?<NXBn`Rn nu0m`T>?<?<NX>f?<?<NXB?<NT3Bn`Rn nu0m0.`N^NuNV. /< /<?9Nn =y`$. /< /U?9Nn JnfN^NuNVBn y (;g 1 y (Sg 0 y (;g0.|=@ y (#g0.|=@ y ( g0.|=@ y (kg0.|=@ n c.10. H@||0H`*0.||0H.?<$NT.?<NT.?<NT.?<NT.?<)NT.?< NT.?<NT.?<.NT.?<3NT.N=@Jnl-0.D@=@` * n l *0.H|0H`40.H H|0H0.H H@H|0H.Nذ|l B94`  4.O/<NX`N^NuNVBn`0n2n*RnR n 0f n Jf n Jf0nSH0`,` 0n2n"n R Rn n JfN^NuNVBn`0 . o ./n .-f n R Rn nH@RJ@o .:m n BRn0.`N^NuNV-y y 1|  y 1|! y 1| " y 1| : y 1| j y 1| : y 1|!R` . dBnB.`Rn nPR n 0m n 9o n -g .0e .9bS.@`x./.?<?.NrP`r./.?<?.NrP`T./.?<?.NrP`6./.?<?.NrP`./.?<?.NrP`./.?<?.NrP`./.?<?.NrP`./.?<?.NrP`./.?<?.NrP`-yBn` SRn0.S@nn.N=@ n0Jnl n-0.D@=@R n l" n0R0.H|0"n`40.H H|0"nR0.H H@H|0"n` nfS.N=@.g y 1|! y 1| .g y 1|!".g y 1|!:.g y 1|!j`F n 1f y 1|!: y 1| R``U@|b@0@2 PN nH@RJ@g .fN^NuNV0. n=@Bn`0n0Rn0.n m0. S@=@`0n"n S Sn0.nlN^NuNV=| y (Sg.3>?<!NTfBy`r y (kg3F3-|`F y (g3`* y (g3F3-| y (gBy.NR@3j.NR@3By y (sg3` y (g 3 yg yfB9`./</<`/<N =@ nfP.Ne=@#tJnm3*`NB3j3Nf`=|`.N3*Jy*nBy*0.`N^NuNVBnBn nP .-f=|R nP`&0. .H|A=@R nP .0m .9o nf0.D@`` 0.`N^NuNV0yj"<.?9NpT=@0.`N^NuNV>?</9,Nl\>?</9,Nl\N^NuNVBW?</9,Nl\N^NuNV>?</9,Nl\>?</9,Nl\N^NuNV=|=| Bn ymJyf=| yf=|=| 09R@S@=@09R@S@=@0.@ny l0.y l0. y o =|`V0.2.AAy l$0.2.Ay o =|H8`0.2.AAy l=|P2`x09 no 3 09 no 3 09 H3JylBy09 H3JylByNoB0.`N^NuNVBn=|`` .Q/<?.?<?NP=@ n H.gJnfJnf=|`T.Q/<?.?<?NP=@ n 2.H0H.f&Jng nf=|Rn nmJnf JnfN0.`N^NuNV3 3"By$3l&3(30*3 ,3 .. ?<BgNfXN^NuNV>D?9B?9@?9>BgBgBgBg?<NN^NuNV.Q/.NFX.Q?<?9NXN^NuNV n "n0T n "n0T n0"n2)AS@"n 2T n0("n2)AS@"n 2T N^Nu#NN/9Nu#NM/9Nu#NA/9NuNV?<NRT0<N^NuNVA@#†A #ŠAH#ŽA#’AǴ#–A#šA†#?< NRT309N^NuNV3H3 J# Ǵ?< NRTN^NuNV3H3 J3 L3N3P3R3T3V3X3Z3\3^3 `3"b#$Ǵ3(d3*f?<NRT n,0 n00 n40 n80 n<0 n@009N^NuNV3H# Ǵ?<4NRTN^NuNV#Ǵ?<6NRT n 0 n0 n0 n009N^NuNV3H3 J3 L3N3P3R3T3V3X nf 3333?<3NRTN^NuNV n0 n 0 n0 n0N^NuNV#Ǵ3 H?<2NRTN^NuNV?<MNRT n0 n 0 n0 n009N^NuNV3H# Ǵ?<NNRTN^NuNV#Ǵ3 H?<NRTN^NuNV#Ǵ3 H3J?<NRTN^NuNV#Ǵ3 H3J?< NRTN^NuNV#Ǵ3 H3J?<!NRTN^NuNV#Ǵ3 H3J3L3N3P3R?<*NRTN^NuNV3H3 J3H?<pNRTByH n 09N^NuNV3H3 J3 L3N3P3R?<lNRT n0 n0 n0 n 009N^NuNV3H?<fNRTN^NuNV3H3 J3 L3N3P?<dNRTN^NuNV3H?<gNRTN^NuNV3H3 J?<hNRT n 0 n0 n0 n009N^NuNV3H3 J3 L3N3P?<eNRTN^NuNV3H3 J3 L3N3P3R?<iNRTN^NuNV3H?<kNRTN^NuNVH?<$Hn/.NO .6.HЃ-@ .3* .3,B` Ю @ Ю R 2.Hm .6.HЃ-@B` / </N  n00`, / </N Ю @ ( Ю!@ `8`6|gа|gʰ|gİ|g|g|g|g|g| g ?/.N\R 2.Hmb .6.HЃ-@B`p / </N Ю @ Ю / </N Ю @ (Ю!@ / </N Ю @ (Ю!@R 2.Hm .6.HЃ-@B` / <"/N  n 0Ю"/"<"/N" n! / <"/N  n 0Ю"/"<"/N" n! / <"/N Ю @ (Ю!@R 2.HmT .6.HЃ-@B`> / </N  n 0Ю"/"</N" n!R 2.Hm0<LN^NuNVHBG".l~D$. l GD&gHC H@J@g@HCBCւJGgD-C LN^.JNuNV0.n o0.`0. NqN^NuNV0.n l0.`0. NqN^NuNV n"n 2.HbH0|f |f`$ |g `Q`bA`2Q`VA`"Q`J0|f |f`$ |g ` Q`A`3 Q` A`# QN^NuNV3@0.| A(HЈ-@=|` nR2.AA@H1Rn nm/9NlX09N^NuNV3ByBy3NN^NuNV3eByBy3NN^NuNV## .мZ#3dBy3 n 3N09 n 03 AŴ#A #Af#A# N^NuNV .3 .3N^NuNV .3 .3N^NuNV0969Ƽ n N^NuA2Xy !JHy!W #Hy" <sNBYyA2"P$hNuNV3|ByBy3N n 0 n0f n0hN^NuNV#  3r3By3NA# N^NuNV#  3 Ŵ3333NA# N^NuNV3 Ŵ3By33N09 N^NuNV#Ǵ# ǸHy?<&N\ y d?<ZNRT n009`$#Ǽ?<[NRT n009N^NuNV x3 N^NuNV#Ǵ3 H?<rNRTN^Nu ST Writer Elitexyzzx.datSearching disk for printer config. file.Chaining Make entry? Printing to disk file.Press any key to resume,  to cancel.Press any key to pause print. Page Printing to spooler. Page ERROR writing to file!Page wait--press any key to continue.Chain file not found.Cannot chain.Enter name for disk: To format: p B(P!7n  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~--WWSTSTEF45MP @xxVR".R tFJ\"H33333Save as ST Writer Elite file.Save as ASCII file.Print to disk file.Save formatted file.Load file.Delete file.Load Merge file.Select Printer Driver.Form-data file.Load AtariWriter File. Now receiving.String was not found.Press  to return to menu.Line:Column:Free: Do Run Run STWRITER.PRG*.*\ 64k+'P' to printer, 'S' to screen: There are no files. Press any key to pause listing.Press any key to continue listing.Unable to change to that folder.Path name: ST Writer file: Folder: B!B!B!B!B!B!B!B!12 4 0 5 0 10 70 2 12 132Forward search : Reverse search : Query Replace : with : Type 'Y' to replace string.Cursor position: V.a*`œ FøJtğĺ 5oŚž;aƅ MsǗ/\ȗ[ɊCDEFILPSRTHQ*.TXT*.STW*.DAT*.SPO*.DOC*.**12 *4 *0 **5 0 *10 *70 *2 *12 132 **0 198NOONAN*.TXTW$12 4 0 5 0 10 70 2 12 132F`>&HXx,hFz*lNtNNN NNNNVNNNN8[0][ Tab Spacing ][ 4 | 5 | 8 ][1][ ST Writer Elite ver. 4.1| 1991 by Atari Corp.| In the Public Domain.| Not for sale.][ OK ][3][Quit without saving|file in memory?][ YES | NO ][1][ERROR trying to|read the file.][ OK ][2][Converting non-ST Writer file.| OK to change Tabs to Spaces?][ YES | NO ][3][Buffer is full!|File not loaded.][ OK ][1][ST Writer cannot|open this file.][ OK ][3][ERASE current file| in memory?][ YES | NO ][1][ERROR writing| to file!][ Oops! ][3][Page wait.][ Continue ][3][Unable to delete| file!][ Oh Oh! ][3][ Delete file. ][ OK | CANCEL ][2][ Send file. ][ OK | CANCEL ][1][Printer port for new driver.][ Parallel | Modem ][3][ List files. ][Printer|Screen| CANCEL ][1][Unable to change|to that folder.][ OK ][1][HIDDEN file,|can not be used.][ OK ][1][SYSTEM file,|can not be used.][ OK ][1][FOLDER,|can not be used.][ OK ][1][ | | ALREADY EXISTS! ][ REPLACE | CANCEL ][1][ERROR trying to|open the file.][ OK ][1][Disk is full.][ OK ][1][File not found.][ OK ][3][Restore default|tab stops?][ YES | NO ][3][ Clear all tab stops? ][ YES | NO ][3][Clear current tab stop?][ YES | NO ][1][File deleted.][ OK ][1][First block mark|not found.][ OK ][1][Second block mark|not found.][ OK ][1][Cursor inside|block marks.][ OK ][3][Too large for cut|buffer. Cut anyway?][ YES | NO ][1][Insert would overflow buffer.][ OK ][1][Two marks already set.][ OK ][1][WARNING- memory low.][ OK ][1][!!! WARNING !!!|Almost out of memory.][ YIKES! ][1][!!!! OUT OF MEMORY !!!!][ GOSH! ][1][Chain file not found!][ OOPS! ][1][Printing to disk file.][ OK ][1][Modification to file|must be saved before|file can be chained!][ OK ][2][ Form data from file? ][ YES | NO | CANCEL ][3][ All disk data will | be erased.][ FORMAT | CANCEL ][1][ERROR trying to format!][ OOPS! ][1][Unable to format disk!][ OK ][2][ Which drive to format? ][ A | B | CANCEL ][1][Too many bad sectors!][ SIGH. ][2][ How many sides to format? ][ 1 | 2 | CANCEL ][2][ Mouse enabled. ][ OK | CANCEL ][3][ No file in buffer! | Load file?][ YES | NO ][1][Too large for| cut buffer.][ OK ][2][Get AtariWriter file|via null modem|or from disk file?][ MODEM | DISK | CANCEL ][2][Default ST Writer Elite|File Specifier.][ *.TXT | *.STW | *.* ][2][Default Background Color][ Black | White ][3][Disk & STWRITER.PRG must|NOT be write protected!|File will be modified.|Takes about 1 minute.][Continue| Cancel ]NOONAN $%ON OFFMARGINS:topbottomleftrightlength012___999012___999010___999070___999132___99902__9904__99000___999198___999005___X99Spc:linepara.2Col: Lt RtIndentJustifyOKCANCELPICAELITEITALICSCONDENSEDGLOBAL FORMAT:BOLD1st Column Desk File Edit Options ST Writer Elite -------------------- Desk Accessory 1 Desk Accessory 2 Desk Accessory 3 Desk Accessory 4 Desk Accessory 5 Desk Accessory 6 L Load R AtariWriter--------------- Save S Save As ... A Save ASCII--------------- D Delete File F Format Disk--------------- P Print Pr. Driver I Index--------------- Q Quit E Edit----------------- C Create----------------- Global Format Insert Type over--------------- H Lines Deadkey Spec. Char.--------------- T Colors Tabs--------------- Config. STWE Restore STWECREATE FileLOAD FileDELETE FilePRINT FileEDIT FileSAVE FileFORMAT DiskRECEIVE AtariWriterINDEX of FilesTRANSFORM ColorsHIRES Flip-FlopQUITPRINT DOCUMENT:PrinterDiskScreenSpooler 1Start page:___999DraftFinal999End page :___999001Copies :___999Print Pages:OddEvenBoth OK CANCELRVZ^bfjnrvz~ r  r  r  r  r  r  r  r r ./1 r2BCE rFUVX rY]%B%   $ 'C#,59 @ E K   <Xt    !     "  #  $% &  + PP 6 = D  K 'P  V k  ! &.=K[jy      '"&#$%&!(3 ) *+ ,0-9.D/S0c1m2u 3 '  %q* 8  Tp     q    q4P l   q 0" ! !Lh%#$q $"  2# ^2! n v {  !           ! %     $   "     &*4 @ " ( 2       $                                                                2&"  " ( &      "             , (  .*    & : ,     $    0"$  &       &H  &"      >( <.  ( &(               ,    X2           \ (      4": ~                    2        &            & &&* ` *, & *, *Z$     $             0    , (    * $\ "  * $.p2($l.p*,> 8D (  .       Hd&J$8   6  F       & >*     $$  8 08l:zzzj:::4 8      $ ("  J&   $   ~          ( 0    &                .     L       6     "2 .  "          ( &"  *    6 & & (* 0     2   0  6 ^ $ D  $$:                          " $                6*,&,,L0$j , *  (           &: z         (  "        $"       :Fj l                         (L \8"&J  J t&       `3 yaJfg"Jyg3T`&|`g"Jyg3T`\&|`bg"Jyg3T`4&|`:g^Jyg3T` &|`3aHz` ?9?9?9a333`JygJy~fJygj y"|p"Q/ JfSH (\g (:f3T3aG2< "_ SAf @gr`6?9?9?9&|a333JFg ya`*6*#*O*m#1` - ЭЭм"ҍ¼.A// Bg?<JNA y1`"h#1dE?/ NN"/0<NBNu o AdpNu#1dBNuNV0/"/ NB1dd0< A+"NB0<NBN^Nu o2/0/ HSoQBNu o0/JfBNuf SNuNV.-hNBW/<-?<+/<-NXJy1m4Jy1m .+/<?91?<@NP` .-N.-N>1?<>NTBWN XN^NuNVBW/<. ?<=N\31Jy1mrB.`.]/<?91?<?NP .*fa`|Bn` |12nBRn nmBn`B.]/<?91?<?NPn .*fa,`0n1Rn .,gJ.g nm 901f$ 9x1g 9X1f.1a=@`.1a=@ y+l40.H2y++Ry+0.2.HAA=@0.H2y++Ry+ .g y+m>1?<>NT y+l ..NN^NuNVBn=|` n2n 0m2 n2n 9n"0.@"n4nHA|=@` n2n Am0 n2n Fn 0.@"n4nHA|=@`> n2n am. n2n fn0.@"n4nHA|=@Rn nm40.N^NuNVBn`0. "nH|A=@R n 0m n 9o0.N^NuNV|`.U/<?91?<?NPJ.fN^Nu#1jNN/91jNu#1jNM/91jNu#1jNA/91jNuNVHNBW/<+N X>/<+N X>/<+N X n2n B*n`&HHм0 @g H| `HRJf> /.NXJL N^NuNV. /./<.N PN^NuNV./. /.N PN^NuNVH BWNR#1p#1tBy1n.+a*n`N`RJgHHм0 @fJg2 "g 'fFH>/ RNX(@ f..@/ aVX H> M2GBRG.Ra`BG`RG M2GJg5pHHм0 @gJ5pg M2GBRGH`BWN BW/ RN 6XJ@g.R/<.RaX`l>N ->f@>/ TN 6X|f>B?<N h\|f.R/<._a|X`$BW/ RN &X|g.R/<.naVX`>?/ NXJf>*/ NXJg-|8<.8?<NT>/ ?<N\<f..}/ aX`^.H?/.aZ\.N>RWN L(@./ NX.a>/ ?<N\<f`.a`|g`JfBaSy1n.1tNz|f../<.a*XB/91p?91nN\>N XJL0N^NuNV|./NX. /N`X../N`X.?< NT>N XN^NuNVH*n y1t X1tRy1nJL N^NuNVH*n. (nGVfJL8N^NuNVHN:>|fp`>N08*@1JnfU.+/.NXJ@f U0`R`.+/.NXJ@fU0`2>/.?N\J@g3#031h0p`U0JL N^NuNVBW?. /.a:\N^NuNVBW?. /.a"\N^NuNV>?. /.a\N^NuNVN p>NN^NuNVHBG`0м..N RG|mJLN^NuNVH*n0-|g*.N -g .N.B@H+@+@Bm m>N JL N^NuNVH>.>N0*@ f3 031h0p`NBF0|f>?<>N!~T<l|>N>NJFf0``3031h0pJL N^NuNVN^NuNVH*n0-| |f, -<o >/-?N\>Gg mp`J-gJg-g;| `;| `>0- D@H/?N h\Bm +mB@JL N^NuNVHN:>|fp`>N08*@1Jn fUJnfU.+/.NXJ@fU;n 0``.+/.NXJ@fU0`d>/.?N\J@g>N3031h0p`0U>B-H?N h\BWB-H?N h\0JL N^NuNVBW?. /.a\N^NuNVBW?. /.a\N^NuNV>?. /.a\N^NuNVH>N0*@ f3 031h0p`$>?-/. ?<BN!~P+@U -JL N^NuNV>B?.a\N^NuNVH*nBnJ gh``BE-n `RRE nJg n %fJEo.?/. N \-n n n %@R DfBn n H|-@R Df n R Rn| <0fG n R =|<*f-M n=PT n R `8`*JnlBnH2. A|=@ n R <0m<9o|<.f BF n R <*f-M n<T n R `*`H2 A<| n R <0m<9oBn<lg<LfRn n R A-HH` RnJng <.` <#1x.1x?<?< // N Jngp`pH`RnJng <.` <#1x.1xBg?< // N Jngp`pH`zRnJng <.` <#1x.1xBg?<// N Jngp`pH`&RnJng <.` <#1x.1xBg?<// N Jngp`pH`-M n-PX`-M n0|@B.T`H>?// N X|`~H>?// Nf X|`XH>?// N X|`4.H?NTRn``|C|5b@0@/| PN.N:ElJFm:0.E=@JnfX .0f* n -f SE. nH?NTRRn`..H?NTRn0.SnJ@n.?/.N \n`..H?NTRn0.SnJ@n`0.JL N^NuNVJnlp`0.=@ n -@>/. /.N!PN^NuNVJnlp`0.=@ n -@>/. /.N#PN^NuNV>/. /.a~P-@. N2.^AAo>/. /.aP-@ .N^NuNVH *n>. (n,g$Bl >/ ?N\Gg lp`*B@`&`.H?NT|fp` 0SGJ@fB@JL0N^NuNVH. *n Sm mH"m|R``.H?NTJL N^NuNVH. *n BF:-fp`$JfV-fN>N+@+@fm`2m>N$J@gm@`;| H"mR`-gA+H +@ mR-gz>/-?N\<Bm `n-g>< g -мb" -:>/-?N\<+mBm `( -:>/-?N\<;| +mFg mp`H|JL N^NuNVH>N0*@ fB@`-fB@`pJL N^NuNVH>N0*@ fB@`0|JL N^NuNV>aJ@g <+`BN^NuNVH>.^GORG>a*@ fB` >/ aXJL N^NuNVH (y0\*T`ZB@0-BA2-@F@J@g>NB`:B@0-ne `*0\f>a*@ f>NB`(M*U`JL0N^NuNVH n*PB@0. X@me n `F(MB@0. HH@B@H@B@0-n 9@B@0,F@9@( n ;n B@0-F@;@#0\ PJL0N^NuNVH >.|?GG0@>NR*@fB`* R*@(M9GB@0,F@9@.Pa 90\JL0N^NuNVH *nQB@0-BA2-@F@J@g>Np`(y0\eeecd(T`e2 BA2-IHABAHAЁ" BB4,JHBBBHB҂b #0\B@`n BA2-IHABAHAЁf T0(mB@0-F@;@ T*`* BA2,IHABAHAЁfB@0-lB@0,F@9@(`(#0\B@JL0N^NuNVH *n.a>. ^GORG>a-@fB`J n(PPg2d`Sn Jn f`B0. B0. `%Sn Jn f>/.aXJL0N^NuNVN^NuNVN^NuNVH /?.?./ /. nN*@ мfB(n `%H|0|9o^G мfB JL0N^NuNVH-|1 *n<.H n. nfz` |SEJgJEf`h nf$z ` |SEJgJEfJEf-`*n<.JngJGlB@0D@> n P-"n R`B0H@B0>JGf JL N^NuNVH >.HμgR*y1d(G1d.Nz|f3 031h0p`>Bg/ N\ JL0N^NuNVH>N0*@ fp`XJnfB@`N-g3 031h0p`0-g>/. / NP``>/. / NPJL N^NuNVH|BG` 0`f 0`0`RG|m3031h0pJLN^NuNVp2.`F@H0`B@N^NuNVHBG`>aRG|mJLN^NuNVH 0.8*@10.@BUB-+| BB> Bg/ N\> ?< / N\JL0N^NuNVH>.|e3 031h0B`0B@08*@1-f3 031h0B` JL N^NuNVH *n(n >.B@=@=@``Rnnc L2n  fB@0.ncf>?.B@0.W B2.Ё//-/ N!B=@B0.ѭJnf3031h0p`^=n`8Rn>?</<0d/-/ N!B=@B0.ѭnb4 -o+mB@0.JL0N^NuNVH*n>?./. /-/ N!B=@Jnf3031h0p` B0.ѭ -o+mB@0.JL N^NuNVH*n 0.8м1-@~.a&M`RJg :fJgc .Am .On*K`K0.`BW/ ?<o n1GBG`BW/ ?<NN!~\JgB@`0<>`d>ON!~JgB@`0<>`J.?<=N!~T>o n1GBG`,.?<AN!~T>``||b@0@0f PN0JL8N^NuNV n am n zn n nHRJfN^NuNVH *n (n`RJff .JL0N^NuNVH *n (nf .JL0N^NuNVH *n(M`RJf HJL0N^NuNVN^NuNVH *n(n `$H>a0H>a&op`lp` JfJfB@JL0N^NuNVH>.|am |zn|0JLN^Nu _B0Z"y1dCCbNC NNVH..,. Jf#1 <`Hc #1 B`:fzB`(xe 〼b`BJge`#1 JLN^NuJg .NuNV n=h.0n/0n/N!P/?.?<?N!~PN^NuNV n=h.0n/0n/N!P/?.?<@N!~PN^Nu#1|NA/91|NuNVBBJlDRBJ lD RB0. -@0.2. An=@ .gDN^NuNVH-n Jnnp` nop`0.R@8BGB/.N&Pl n -R /.N'X-@B/.N&Po.`/<D/.N'jP-@SG/<A/.N&Pm`/<D/.N&2P-@RG/<D/.N&PlG|0H/N&RX-@`/<D/.N&2P-@RFDm/<B/.N&2P//.N%P-@/<D/.N&Pm -|ARGJGl4 n 0R n .R JDlD|` n 0R SFGnBF`j/.N&X:0|0"n R Gf n .R 0H/N&RX-@//.N'P-@/<D/.N'jP-@RFDm n BR .JLN^NuNVH-n Jnnp` nop`0.R@8BGB/.N&Pl n -R /.N'X-@B/.N&Po.`/<D/.N'jP-@SG/<A/.N&Pm`/<D/.N&2P-@RG/<D/.N&Pl|0H/N&RX-@`/<D/.N&2P-@RFDm/<B/.N&2P//.N%P-@/<D/.N&Pm -|ARGBF`j/.N&X:0|0"n R JFf n .R 0H/N&RX-@//.N'P-@/<D/.N'jP-@RFDm n ER JGl0D@> n -R 0H |0"n R 0H H@|0"n R n BR .JLN^NuNVH..,. N( LN^NuNVH..,. N'LN^NuNVH..,. N( LN^NuNVHJl| .D-@`BFJfB`^~` .-@R .f` .-@S. g .-@޼@ JFg .JLN^NuNVH .м<JgJFlB`V .:|oJEg <` <`0..μ|`RFJFm`SFJFnJEg D. JLN^NuNVH..,. N)l LN^NuNVH..N' LN^NuNVH..,. N' LN^NuJj Jjf NufNuJNu<NuJg NugR kjklf`>k^g>k^g2k8<d,&B<ރeNuRid~S<Nu.NuJNu:ڼ.gNugRghEDvi^E]HE:BB8HD&HC؃HF&؃BDHDHGHFHEބj ޼gNuSiex@ބއdRgNu~NujJ<Numc68343 floating point firmware (c) copyright 1981 by motorola inc. Stack Overflow$C runtimeCON:LST:B(P!7n  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~--WWSHSHEF45MP @xxCreating file "xyzzx.dat". xyzzx.datReading "config.txt" file. "xyzzx.dat" file size is %d bytes. Can't read "config.txt" file. Aborting... now closing file config.txt!!! WARNING !!! Faulty "xyzzx.dat" file!: unmatched quoteCannot open Cannot append Cannot create : No matchStack Overflow $   xBfffffff"ffffffvffffffffff|Bfffffff&ffffffz0T0T    z!!!!"CP/M-68K(tm), Version 1.2, Copyright (c) 1983, Digital Research XXXX-0000-654321__exit__break1d___cpmrv1h__base1`__sovf_crystaln_ctrl_cn*6_brkz___BDOS_blkfill_index_strchr___pname+___tname+___lname+___xeof+_j+_buffer+_main_fill_bu_discard_mk_deci`_mk_intH_gemdos_bios_xbios__main_printf_fprintf___main__creat X_creat _creata &_creatb >_exit X__cleanu p_fclose _close __iob.___fdecl _fflush __open $_open _opena 6_openb N_lseek h_tell __doprt __pftoaf__petoa__pgtoa_fputn _fputc__flsbuf_isatty$_isdevX_ttyname__afreeb0T__aflist0\_malloc_free._realloc,_malloc___errmal___prtin___prtld.___prtsh_sbrkR_write__chvec0`__allocc:__freec__chinit___chini__chkc0__wrtasc__wrtbin___open_ucase,_errno0__errcpm0_strcat`_strcpy_strlen___atab0____atab__strcmp__salloc L_uldivr1 _uldiv z_sw_ __pc_rea!__pc_wri!B_trap!~lmul!_ftoa!_etoa#fpadd%_fpadd%fpcmp&_fpcmp&fpdiv&2_fpdiv&2_fpltof&R_fpftol&fpmul'j_fpmul'jfpmult'j_fpmult'jfpneg'_fpneg'fpsub'_fpsub'ffpcmp'ffptst'ffpabs'ffpneg'ffpadd(ffpsub'ffpdiv(ffpmul2)lffpcpyrt@)_out_han1_temp1_in_hand1__fds16$ N      $* & " N    ,"  ,D( 0 <    >  h 0HN&  j^***`&$ D"V8*R$ZF \@(B4.J".86 Jp $""@2&"fHR"D(<@* T0^0 :  B?<NT.Q/]/Y/U/.N>?.?.?.?<$?<$BgBgBgN>?.?.?.?<$?<$BgBg?<N>?.?.?.?< Bg/.N> /.NX=@>?.?.?.?<$?<$BgBg?<N>?.?.?.?<$?<$BgBg?<NB?<NT0.`N^NuNV. \/. X/. T/. n?( n?( n?( n?NX`N^NuNV n> n0W?.0. WNxT=@ n> n0W?. 0.WNxT=@> n?NZT=@> n?NZT=@ n0 n00.Do Run Run STWRITER.PRGB!B! ST WriterTM Elite Quick Reference Guide Page @Formatting commandsEnter value, where appropriate, following command.Bottom margin Control BBlock text right Control C Control C before each line, [Return] afterByte Count atcursor Alternate =Center text Control C before each line, [Return] afterChain print files Control V at bottom of file, followed by drive specifier and colon, if necessary, filename to be chained, and [Return]Control Characterinsert in text Control X before and after the control character temporarily turns off formatter and prints the character in your file.Double-column printing:2nd col. left Control Mmargin2nd col. right Control NmarginElongated print Shift F9 before and after textForm printing F9 for each blank in formHeaders and Control H for header,footers Control F for footer, then text and [Return] for each lineJustified and Control J and 1nonjustified (justified) or 0 margins (nonjustified)Left margin Control LLine spacing Control SMerge files F8Mouse on Click mouse buttonMouse off Click on Mouse in Options menu.Page eject Control E where page break is desiredPage length Control Y (for continuous printout, set top and bottom margins at 0)Page numbering @ (Shift 2) in header or footer; for starting page number other than 1, Control Q after [Return] that concludes header or footer, then desired page number. Negative value alternates right and left blocked headers and footers on alternate pagesPage wait Control WParagraph Control IIndentationTo make an outdent, use a negative valueafter Control I.Paragraph spacing Control DPrinter controls Control O and decimal codePrint stylesPica Control G and 0Bold Control G and 1Condensed Control G and 2(16.7 CPI)Italics Control G and 4Elite Control G and 8To mix print styles, add the numbers that followControl G. (Note: the number after [Control G]must be followed by a hyphen.) In GEM mode,print styles can be selected prior to Creatinga file by clicking on the appropriate buttonsin the Global Format dialog box.Right margin Control RSection Control U, section levelheadings number (1-9), heading text, and [Return]Subscripts F10 before, Shift F10 afterSuperscripts Shift F10 before, F10 afterTop margin Control TAlternate Alternate XCharacter set (toggle)Deadkey function Control Clr Home (toggle)Cursor movementUp (up arrow)Down (down arrow)Left (left arrow)Right (right arrow)Beginning of line Control (left arrow), or Control AEnd of line Control (right arrow), or Control ZTop of file Shift F1Bottom of file F1Page up Shift (up arrow)Page down Shift (down arrow)Next Tab stop (inserts spaces) Tab(no insert) Shift (right arrow), or Shift (left arrow)UnderlineNew or existing Shift F3 before and after texttextUpper and lowercase charactersSwitch between CapsLockupper andlowercaseChange existing F3text to upperor lowercaseParagraphsBegin paragraph Control PEnd paragraph ReturnType-over text/ Insertor Insert (toggle)Delete textCharacter under DeletecursorCharacter to Backspaceleft of cursorTo end of line Shift DeleteTo end of file Control DeleteEntire file Clr HomeRestore last Undoline or blockdeleteText blocks Shift F5 to mark beginning and end of text block, then --Delete block F5Duplicate block Position cursor, then [F2]. After initial duplication and before any line or block deletions, position cursor, then [Undo] to reduplicate block.Move block Position cursor, then [Shift F2]Save block Shift F8, then enter filenameSave ASCII You can only set right margin (10 to 160).Search and replaceSearch forward F6Search reverse Shift F6Global replace Shift F7Query replace F7TabsClear all Control TabTab stops Restore default Shift TabTab stopsClear Tab stop Shift F4at cursorSet Tab stop F4at cursorHalt printing EscReturn to menu Esc<$Hn/.NO .6.HЃ-@ .3 .3B` Ю @ Ю R 2.Hm .6.HЃ-@B` / </N  n00`, / </N Ю @ ( Ю!@ `8`6|gа|gʰ|gİ|g|g|g|g|g| g ?/.N\R 2.Hmb .6.HЃ-@B`p / </N Ю @ Ю / </N Ю @ (Ю!@ / </N Ю @ (Ю!@R 2.Hm .6.HЃ-@B` / <"/N  n 0Ю"/"<"/N" n! / <"/N  n 0Ю"/"<"/N" n! / <"/N Ю @ (Ю!@R 2.HmT .6.HЃ-@B`> / </N  n 0Ю"/"</N" n!R 2.Hm0<LN^NuNVHBG".l~D$. l GD&gHC H@J@g@HCBCւJGgD-C LN^.JNuNV0.n o0.`0. NqN^NuNV0.n l0.`0. NqN^NuNV n"n 2.HbH0|f |f`$ |g `Q`bA`2QDo Run Run STWRITER.PRGB!B!2 4 1 5 0 1 79 2 4 1325 ST Writer 1 KEY CODE TABLE0 Shift | Alternate "X" Shift + | +KEY Normal Shift Control Control | Normal Shift Control ControlReturn ^< ^< ^J ^J | ^< ^< ^J ^JSpace Bar Sp Sp | 1 ! 1 ! ^Q ^ | 2 @ 2 @ | 3 # 3 # ^S ^C | 4 $ 4 $ ^T ^D | 5 % 5 % ^" ^E | 6 ^ 6 ^ ^ ^ | 7 & 7 & ^W ^F | 8 * 8 * ^X ^J | 9 ( 9 ( ^Y ^H | 0 ) 0 ) ^P ^I | - _ - _ ^? ^? | = + = + ^_ ^K | ` ~ ` ~ ^ | [ { [ { ^Up ^Up | ] } ] } ^_ ^_ | ; : ; : ^Up ^Z | ' " ' " ^G ^B | , < , < ^L ^Dn | . > , > ^N ^ | / ? / ? ^O ^? | \ | \ | ^Dn ^Dn | A a A | B b B ^B ^B | C c C ^C ^C | D d D ^D ^D | E e E ^E ^E | F f F ^F ^F | G g G ^G ^G | H h H ^H ^H | I i I ^I ^I | J j J ^J ^J | K k K ^K ^K | L l L ^L ^L | M m M ^M ^M | N n N ^N ^N | O o O ^O ^O | P p P ^P ^P | Q q Q ^Q ^Q | R r R ^R ^R | S s S ^S ^S | T t T ^T ^T | U u U ^ ^ | V v V ^V ^V | W w W ^W ^W | X x X ^X ^X | Y y Y ^Y ^Y | Z z Z | Insert ^P | Clr Home 7 7 | Up Arrow ^X | F3 ^_ ^_ | ^_ Rt ^_F5 ^" ^" | ^" ^"F9 ^? ^ ^? ^ | ^? ^ ^? ^F10 ^Dn ^Up ^Dn ^Up | ^Dn ^Up ^Dn ^UpKeypad * * *   | Keypad - - - | Folder: 64k+ Load file: ERROR trying to read the file.Converting non-ST Writer file.Change tabs to spaces? Buffer is full, file not loaded.B!B!B!B!12 4 0 5 0 10 70 2 12 132Forward search : Reverse search : Query Replace : with : Type 'Y' to replace string.Type 'Y' to restore default tab stops: Type 'Y' to clear all tJJJ$JFf R Desk File Edit Options ST Writer Elite -------------------- Desk Accessory 1 Desk Accessory 2 Desk Accessory 3 Desk Accessory 4 Desk Accessory 5 Desk Accessory 6 Load AtariWriter --------------- Save Save As ... Save ASCII --------------- Delete File Format Disk --------------- Print Pr. Driver --------------- Quit Edit ----------------- Create ----------------- Global Format Insert Type over -------------- Lines Mouse Deadkey Spec. Char. -------------- Colors PRINT DOCUMENT:PrinterDiskScreenSpooler 1Start page:___999DraftFinal999End page :___999 OK CANCEL001Copies :___999ON OFFMARGINS:topbottomleftrightlength012___999012___999010___999070___999132___99902__9904__99000___999198___999005___X99Spc:linepara.2Col: Lt RtIndentJustifyOKCANCELPICAELITEITALICSCONDENSEDGLOBAL FORMAT:BOLD1st Column!%4fjnrvz~PP $ + 2  9 &P  D Y n   ,<L\l|     &!%"#$% '/ (&)5*D+S,b-q./& 2# 2!!   J ! !  f !   ( %B%   8!;C#@IM T Y _  *F b~   !   !   "  # ! $+% :  ?  6 2 Desk Accessory 3 Desk Accessory 4 Desk Accessory 5 Desk Accessory 6 Load AtariWriter --------------- Save Save As ... SaveDo Run Run STWRITER.PRGB!B!* the following table gives the widths of the various dot matrix* printing modes. A least common multiple was calculated so all* mode widths could be represented as a whole number* weights* columns per page = 80 lcm= 5280* if columns = 132 then lcm= 8712* normal = 80 columns 66* elongated = 40 columns 132* condensed = 132 columns 40* condensed elongated = 66 columns 80* condensed elite = 160 columns 33* elite = 96 columns 55* elongated elite = 48 columns 110** column width5280* pica and elongated condensed elite66* elongated pica132* condensed40* condensed elongated80* condensed elite33* elite55* elongated elite110** character translation table to accommodate non-Atari printers which* may not have the international set in 8 bit codes but instead use* character substitution. Set up currently for Atari printers*0x00,0x01,0x02,0x03,0x04,0x05,0x06,0x07,0x08,0x09,0x0a,0x0b,0x0c,0x0d0x0e,0x0f0x10,0x11,0x12,0x13,0x14,0x15,0x16,0x17,0x18,0x19,0x1a,0x1b,0x1c,0x1d0x1e,0x1f0x20,0x21,0x22,0x23,0x24,0x25,0x26,0x27,0x28,0x29,0x2a,0x2b,0x2c,0x2d0x2e,0x2f0x30,0x31,0x32,0x33,0x34,0x35,0x36,0x37,0x38,0x39,0x3a,0x3b,0x3c,0x3d0x3e,0x3f0x40,0x41,0x42,0x43,0x44,0x45,0x46,0x47,0x48,0x49,0x4a,0x4b,0x4c,0x4d0x4e,0x4f0x50,0x51,0x52,0x53,0x54,0x55,0x56,0x57,0x58,0x59,0x5a,0x5b,0x5c,0x5d0x5e,0x5f0x60,0x61,0x62,0x63,0x64,0x65,0x66,0x67,0x68,0x69,0x6a,0x6b,0x6c,0x6d0x6e,0x6f0x70,0x71,0x72,0x73,0x74,0x75,0x76,0x77,0x78,0x79,0x7a,0x7b,0x7c,0x7d0x7e,0x7f0x80,0x81,0x82,0x83,0x84,0x85,0x86,0x87,0x88,0x89,0x8a,0x8b,0x8c,0x8d0x8e,0x8f0x90,0x91,0x92,0x93,0x94,0x95,0x96,0x97,0x98,0x99,0x9a,0x9b,0x9c,0x9d0x9e,0x9f0xa0,0xa1,0xa2,0xa3,0xa4,0xa5,0xa6,0xa7,0xa8,0xa9,0xaa,0xab,0xac,0xad0xae,0xaf0xb0,0xb1,0xb2,0xb3,0xb4,0xb5,0xb6,0xb7,0xb8,0xb9,0xba,0xbb,0xbc,0xbd0xbe,0xbf0xc0,0xc1,0xc2,0xc3,0xc4,0xc5,0xc6,0xc7,0xc8,0xc9,0xca,0xcb,0xcc,0xcd0xce,0xcf0xd0,0xd1,0xd2,0xd3,0xd4,0xd5,0xd6,0xd7,0xd8,0xd9,0xda,0xdb,0xdc,0xdd0xde,0xdf0xe0,0xe1,0xe2,0xe3,0xe4,0xe5,0xe6,0xe7,0xe8,0xe9,0xea,0xeb,0xec,0xed0xee,0xef0xf0,0xf1,0xf2,0xf3,0xf4,0xf5,0xf6,0xf7,0xf8,0xf9,0xfa,0xfb,0xfc,0xfd0xfe,0xff** printer specific control strings* underline on27451255255255255255* underline off27450255255255255255* elongated on27871255255255255255* elongated off27870255255255255255* superscript on27830255255255255255* superscript off2784255255255255255255* subscript on27831255255255255255* subscript off2784255255255255255255* bold on27692771255255255255* bold off27702772255255255255* italics on2752255255255255255255* italics off2753255255255255255255* compressed on15255255255255255255255* compressed off18255255255255255255255* elite on2777255255255255255255* pica on2780255255255255255255* carriage return/line feed sequence0x0d0x0a255255255255255255* printer reset2764255255255255255255* draft quality print271200255255255255255* letter quality print271201255255255255255  )  . " 4 # < $F% U  Z  J $   "  "(  * 2     $                                                     4              Do Run Run STWRITER.PRG6 4 1 5 0 5 75 2 6 132ATARI ST-WRITER HELP SHEETFORMAT BLOCK (Top of page)CONTROL- "B" - Bottom margin "L" - Left margin "D" - Paragraph spacing "R" - Right margin "G" - Change font "S" - Line spacing 0=pica 1=bold 2=condensed "T" - Top margin 4=italics 8=elite "Y" - Page length "I" - Paragraph indentation "M" - Dbl. column left margin "J" - Justification toggle "N" - Dbl. column right marginFUNCTION KEYS F1 - Go to end of file SHIFT F1 - Go to start of file F2 - Insert block SHIFT F2 - Move block F3 - Uppercase Toggle SHIFT F3 - Underline On/Off F4 - Set tab SHIFT F4 - Clear tab F5 - Delete block SHIFT F5 - Set block marks F6 - Forward search SHIFT F6 - Reverse search F7 - Query replace SHIFT F7 - Global replace F8 - Merge file SHIFT F8 - Save block F9 - Form printing insertion SHIFT F9 - Expanded print toggle F10 - Subscript SHIFT F10 - SuperscriptOTHER COMMANDS CONTROL-A or CONTROL-[LEFT ARROW ] - Cursor beginning of line CONTROL-C - Center line of text CONTROL-CC - Block right line of text CONTROL-E - Page eject CONTROL-F - Footer CONTROL-H - Header CONTROL-K - Abort search or replace/ Insert comment in text CONTROL-O - Enter printer control code CONTROL-P - Paragraph mark CONTROL-Q-number - Page # to start numbering from CONTROL-U - Section heading, level CONTROL-V-Filespec - Chain print Filespec CONTROL-W - Page wait CONTROL-X - Before and after Control Characters when they are to be actually inserted into the text. CONTROL-Z or CONTROL-[RIGHT ARROW] - Cursor end of line @ - Replaced with page number in header or footer CONTROL-DELETE - Delete to end of file SHIFT-DELETE - Delete to end of line UNDO - Restores a deleted block of text INSERT - Toggles between Insert and Type-Over modes CLR HOME - Delete file in buffer CONTROL-TAB - Clear all tab stops SHIFT-TAB - Restores default tab stops SHIFT-[UP ARROW] - Up one page SHIFT-[DOWN ARROW] - Down one page ALT-X - Toggles between normal and international characters ALT-= - Byte count at cursor position CONTROL-(keypad) * - Prints delta character CONTROL-(keypad) minus - Prints overscore character CONTROL-CLR HOME - Toggles deadkey mode (",',~,`,^,/,-,_)   Do Run Run STWRITER.PRG  10This template can be cut out and taped above your function keys as a quick reference. 51603|------- F1 -------|-------- F2 -------|-------- F3 -------|------- F4 -------|-------- F5 -------|-------- F6 -------|| 7 Top of File 3 | 7 Move Block 3 | 7 Underline On/Off3 | 7 Clear Tab Stop 3 | 7 Mark Block 3 | 7 Reverse Search 3 || | | | | | || Bottom of File | Insert Block | Uppercase Toggle | Set Tab Stop | Delete Block | Forward Search |-----------------------------------------------------------------------------------------------------------------------|------- F7 -------|-------- F8 -------|-------- F9 -------|------- F10 ------|| 7 Replace 3 | 7 Save Block 3 | 7 Elongated On/Off3 | 7 Superscript 3 | 7 [Shift] 3 | | | | || Query Replace | Merge File | Form Character | Subscript |-------------------------------------------------------------------------------B(P!7n  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~--WWSTSTEGFH45MP @xx 66* elongated = 40 columns 132* condensed = 132 columns 40* condensed elongated = 66 columns 80* condensed elite = 160 columns 33* elite = 96 columns 55* elongated elite = 48 columns 110** column width5280* pica and elongated condensed elite66* elongated pica132* condensed40* condensed elongated80* condensed elite33* elite55* elongated elite110** character translation table to accommodate non-Atari printers Artist :______________________________________ Year :________ Cat no. :______________________ Side.a. :__________________________________________________ Side.a. :__________________________________________________ Side.b. :__________________________________________________ Side.b. :__________________________________________________ Label :____________________________ Special :__________________________________________________ Cost :__________________________________________________ Charts :__________________________________________________ ____________________________________________________________ track.6:______________________________________________________________________ track.7:______________________________________________________________________ label :______________________________________________________________________ x96,0x97,0x98,0x99,0x9a,0x9b,0x9c,0x9d0x9e,0x9f0xa0,0xa1,0xa2,0xa3,0xa4,0xa5,0xa6,0xa7,0xa8,0xa9,0xaa,0xab,0xac,0xad0xae,0xaf0xb0 Artist :____________________________________________________________________ Title :____________________________________________________________________ Year :_________ Cat.no :__________________________ Tracks :____________________________________________________________________ Tracks :____________________________________________________________________ Tracks :____________________________________________________________________ Tracks :____________________________________________________________________ ______________________________________________________ cost :______________ value:________________________________________ 255* subscript on27831255255255255255* subscript off2784255255255255255255* bold on2771255255255255255255* bold off2772255255255255255255* italics on2752255255255255255255* italics off2753255255255255255255* compressed on15255255255255255255255* compressed off18#a000000 #b000000 #c???000?000<00