NNNNNNmp NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNN%O`  @`! #@%`')+-/1 3@5`79;=?A C@E`GIKMOQ S@UWY[]_a c@e`gikmoq s@u`wy{} @` @ ` ` @ ` @ ` ǀ @ ` ٠ @/@`!Ao  !AoO`  @`! #@%`')+-/1 3@5`79;=?A C@E`GIKMOQ S@UWY[]_a c@e`gikmoq s@u`wy{} @` @ ` ` @ ` @ ` ǀ @ ` ٠ @/@`!Ao  !AoST_UK_PDSWPRINTER t 1ST_WORDPRGt {JGUIDE DOCt V71ST_PRNTPRGt ё1ST_WORDRSCt :TUTORIALDOCt $README t 1ST_PRNTDSYt "1ST_PRNTDOTt .  t..  tASCII HEXt RINSTALL PRGt %EPS_RX80HEX t h&EPS_LX80HEXt %BRO_HR15HEXt uQUME HEX#t SMM804 HEXt 9 `D&o + ЫЫO// Bg?<JNA IK#@~|N#"HkN .!Hm!"NBN(NVHxdHxNP-HJf GN^Nu/.NX f GN^NuHx /NP-HJf GN^Nu nC n""n n" nC0n" nC0n "/.NX/.NX nN^NuNV n h -H n hH-H n h-H n h-HA-H"nAP-HJg nN^Nu/.HxN)JP/./ n hT"F/N -HJg nN^Nu n h$-H n h(-H"n n//."n n I"F/N1* "n n//."n n I"F/N1* "n n"HA /. n"F"_"H G "n n"H n h  n/H0@CN_"_ Jg /. n hT"H F I/N*^P nH0@C g/. n hT/N*^P/.N*X G-H"nAl` R n`/. nC0"_/ n hT"H F I"_o /. nC0"_R P`/. nC0"_/ n hT"H F I"_f*/. nC("_"P no F` G gB/. nC0"_R P/. nC("_/"P n I"_"` nN^NuNVJg /. /N)~P/. /.N&@P n hX"H n hLm. n hX/ n hL"H n h"_l G` F g(/. n hX/ n hT/N `Jg/. N*X n h$-H"n n hXH0@N^NuNV n h$-H n h(-H. H0@C f AN^Nu"n n hXH0@C f8 n hX"HAm AN^Nu/. . H0@/NPN^Nu"n n hX"H. H0@  n h /"n n hXH0@/NP/. . H0@/N)P/. N*X GN^NuNV n h$-H n h(-H/.NHX-H n hX-H"n n I"F-H n"F"HAm AN^Nu"n n///.N1F "n n///.N1F /. n h/HxN) "n n"H. H0@ "n n"H n h /. /.N(P/."n F I"_H0@CN_ g/. "n F I/N(P"n n AXR P/H0@CN_"_  n hX/ n hL"H n h"_m$/. n hX/ n hT/N /. N*X G-H"nAl` R n`/. nC0"_"P n hTf*/. nC("_"P no F` G g/. nC("_R P` GN^NuNV G-H n h=HJf@ G-H"n nH0@C g0"n nH0@Cg"n nl F` G g R n`Jg/./. /.N -HJf"n ng G` F g`"n nH0@C f/.NX-H`D"n nH0@Cf* nHh"n R nH0@CN_"_""n R n-H "n n I-H` nC0n" nN^NuNV n h$-H n h(-H/.NHX-H n hX-H"n n I"F-H"n n"HAm AN^Nu"n n//./.N1F "n n//./.N1F /. "n n hX//.N1* n h/"n n hX//.N1 nAX/"P n"_" n hX/ n hL"H n h"_l/. n hT/N*^P/. n hX/ n hT/N G-H"nAl` R n`/. nC0"_"P n hTf*/. nC("_"P no F` G g&/. nC("_/"P n"_"`z GN^NuNV n h$-H n h(-H/.NHX-H n hX-H"n n I-H n hL"H n h"H F I-H"n nH0@C f AN^Nu"n n-H n"F//./.N1* "n n-H nH0@"GN_-H n"F//./.N1* n/H2@ nN_r"_ /. n hN_X/HxN) /."n F I"_H0@CN_ g/."n F I/N(P/./. n hT//N+$ n h /NX g/. n hT/N*^P`>/. n"F"_o*/."n F I/N(P/./.N(P/.N*X G-H"nAl` R n`/. nC0"_"P n hTf./. nC("_"P n hXo F` G g/. nC("_S P` GN^NuNV n h$N^NuNV n C\0n "Jn g$/. n hX/ n hT/N /. 0n /N)~P GN^NuNV"n n hX""n n hT" GN^NuNV/. n h"HAN_"_ I-H/.HxN-P gV/. n hP"H F I"_f n-H/. n hP"H n h"_f n hP"F-H"n n hPm(/. n hP"H n h"_l F` G g n hP-H/./. /./.N N^NuNV G-H n hP-H n h\-H/./N)~P nC\ G" n hP"H no/.N#X-H g`` n hP"H nl n h< m F` G g/.N#X-H g`` n hP-H"n n l(` R n`"n n hDf`` nCT n" nHh$/. n hT/N1fP-H"_" nHh(/. n hT/N1P-H"_"/.NHX-H/."n F I"_o"n F I-HJl G-H nCX n" n hX"H n hLm. n hX/ n hL"H n h"_l G` F gJg F` G gn n hX"H n hl nCL G"`8 nHhL n hX/ n hCN_"HAN_"_ I"_"/.NzX` /."n n hP I/N-P nC\ n"/.N*X n hT"H n f G-H`Jf A-H nN^NuNV G-H n h8 f/.N3"X-HJf& nAPS P nA8S P nA"n n hPm,/. nCK"H n hP I"_"H F"` n h /N X n h`"GW @N^NuNV G-H/.NX-HJg /. HxNH`Nd ml hP-H/-lHnHnN /.N>\X/.NX"nAn,/-lN24X/-lN2X/-l/NFP` /-l/"nA I/N /-l/././.N NN^NurNVHxNXN^NuNVjCnA AnR"HA A6-HjHn6Hx/.Np f`H njH0@Cf` njH0@C f&/-l ml hT/HxN njRj njH0@C fb njRj njRjH0@=HJno2nA I=H`0nN_X=H/-l ml hT/0n/N /.jAnC/NrP/-lHnnHnnNHX/N g`D njJg6 njRjH0@CfAnR"H njRjH0@ `` GN^NuNV/NDX fN^Nu/-zHxHnNY //HnN r /.HxHnHxNYC G /./0n/AT0P/AX0P/A\0P/NY=H0nCflAJgbHnHz^NcTP-HJf N`>/-lHxN$jPN/.NA X gN_N/.NXN&N^NuwNV/-l/HnHnN$/-lHxHnHnN$/-l/./.N n-H/-lN6X-H n-H"n nf "n n-H"n n I-H"n nf2 nS g nRH0@//.NP``././.NTP/-l/R/.N `T/.N X/.NXN^NuNV/NDX gNGD g F` G g| ml hP-H/-lHnHnN N|/-l/N%.PNG g/-l/./.N NI/-l/././.N NZN^NuNV/NDX gNGD g F` G g ml hP-H/-lHnHnN /-lHxN$jPN/-l/N%.PNG gXNE/-lHxN%.P/-l/N$jPNI/-lHxN$jPNZ mlCx F" mlC| F"/-l/././.N NdN^NuNV ml hP-H/NDX f GN^NuNGD f GN^Nu/-lHnHnN N/-l/N%.P/-lHxN$jPNG f/-NpX G+H /-l/././.N N m N^NuNVNrNINN^NuNV/NDX g&/-lHxN$jPNJ|g nS`*NV g mN_`+H GN^NuNU-H G+H|/.NUfX gJ"n mx I+H|/-l/-|/-N mCN_"F I/NX FN^NuJg nS"H mxf` `R nBJf``jNV g mN_`+H GN^Nu mx-HJg NU-H`.N^NuNV/-xNHX"H F I-H"n mo"n m I-H"mx nN^NuNV nB @Cf GN^NuA-H nBJgr nRB @-H nCf`Jg/.NV`X-H nCf A -H"n nRB @g GN^Nu` FN^NuNV/-l//- mCN_"F I"_+H/N -H/-lN6X+Hx nN^NuNV"nAam"nAzn nC-H nN^NuNVtNW=H/. 0nCA"_  n R"HA: 0n"F/ n T/tNW&P/. Hz"tNP/. /.tNPN^Nu\NVHxtN XN^NuNVHxG/./. tN N^NuNV/. tNHX-HJgP/. "n F I"_H0@ @C\g.H0@C:g F` G g F` G g nS`"n n"H G /. /.tNPN^NuNVJg/.0n//tNX0 `/.0n//tNX N^NuNV/.0nCN_"_C /tN\X-H/.0nCN_"_C /"n0n N_r/tN\PN^NuNV/.0nCN_"_C /tN\X-H/.0nCN_"_C /"n0n N_jN_/tN\PN^NuNV/.0n//. nT/tN nX//.0nCN_"_C/tN\X"_2 n\//.0nCN_"_C/tN\X"_2N^NuNV/.0nCN_"_C /tN\X-H/./. tN\P nC/0n /tN\PN^NuNVC0n2AT"H0n2AX"H0n2A\"H0n 2/.HnHn/tNZ/.0n/tNP=H/.HnHntN[ /.0n//tNl 0nN^NuNVJn g././. n T/ n X/ n \/tN<///// n 0P/ n T0P/ n X0P/ n \0P/t N$/ n0P/ nT0P/ nX0P/ n\0P/ n 0P/ n T0P/ n X0P/ n \0P/t N$/.//. tN[ Hx/tNPN^NuNV/.0n/Hx n0P/ nT0P/ nX0P/ n\0P/tNvN^NuNVHx/tNPHx n 0P/ n T0P/ n X0P/ n \0P/ n0P/ nT0P/ nX0P/ n\0P/t N$Hx n 0P/ n T0P/ n X0P/ n \0P/ n0P/ nT0P/ nX0P/ n\0P/t N$N^NuNV n PN^NuNV n0PN^NuNV"n 0n 2N^NuNV"n n"N^NuNVN"HA.lHxNX FN^NuJgHn/.N\P`"HnN^X-HJg nN^NuHnHznNcTP-HN+Hl ml h -H n0P;Hp0mp/HxHnN  Jf,Hx NX-H nCfNa FN^NuA;H/-l/.HnNc g,NaJg/.NXA;HAN^NuHnHx.NP-HJg/.HzN4P f F` G g mlCA" mlC F" mlP P-H0mp/Hx n h /N  Jg/.NXA;H GN^Nur.DOCNVHx/NPHmHmHnN Hx/NPJnf FN^NuAJg(/.HmN\P/.HmNWFP GN^Nu`N^NuNV0m/NXN^NuNVHxNXN^NuNVNcHnNLX fHnNX`NcN^NuNV/./. N\P/.Hx.NP-HJg/./.N\P`/./.NP nN^NuNV mlP P-H/-zHxHnNY /HxHnN r /.HxHnHxNYHn n h /N\P/./0n/AT0P/AX0P/A\0P/NY-H nCf(/HnNaP g FN^NuNa GN^Nu FN^NuNV mlP P-H/ n h /NaP g FN^NuNa GN^NuNV/-zHx!HnNY //HnN r /./0n/AT0P/AX0P/A\0P/NY-H nCfNiHNa GN^Nu FN^NuNV/-lNX/Hx HnHnHnHnN 80n;HpC0n P+HlN^NuNV ml h g ml h f F` G gHxNXCf FN^Nu/.HzNcTP-HJgb/.NXJ gHx NXCf FN^NuHn/.HzN HnNX/.HnNc4P/-l/NFPNJo2/-l/"n F I/tN /-ltN X-H`Hx(tNtX nN^NuNV/tNtXN^NuNVHxtNtXN^NuNV/-l/tNFP G-H n`>/-l/tNFP`/-ltNX`/-l/tNFP/-l/tNFP/-ltN X-H nN^Nu`/-l/tNP`n/-lHnHntN G-H nR/-l/./.tN -H nCf tN_N/-l/tNFPtNw-H`tNx-H`/-l/tNP`tNw-H`/-l/tNP``N_  $@(X,P0H4P8\.H2@ nfHm n"F"_H0@N^Nu nC-H`AN^NuNV/-lHnHntN Jf FN^Nu nS/-l/./.tN GN^NuNV/-ltNXtNN^NuNV"m mBfNxb g AN^Nu` GN^NuNV G=H mB-H G=H F=H/-lN6X-H nC-H G=H"n0nB @=H"n0nB @=H2n0m.f mB+H60nRn0nC f`0nCfJmZg F=H```:0nCf&JngA=H`A=H`V` G=H0n=H G=H0n/0n/Nz$P`&JmTg@Jng0nCf F` G g/-lNVX F;HVAN^Nu0nCg0nC-g F` G g F;HT"mB nf F;HV/-lNVX G;HZ0mVN^NuNV2n AN_"H0n=HJmTf0"mB0n2/-BNzzX+HB"mB mFf F;HTN^NuNVT"n m>e m:-H nN^NuNV/-lN6X-H nH0@C f/-lN%XN^NuN8N F;HZ G;HT;HV/NX;HN G;HL/-lHnHnN /-l//.N N^NuNVN{N|FJmVg F;HX`2JmRg2m 0m o F` G g N~D``N~tN^NuNV G;H,;H`;HR;HP;H;H;H ;H 0mN_`;HX0mN;H 0mL;H" m+HFN^NuNVN ft m0PCN_=H0nCf N|`(0nCf N|`0n/N}jX0nC-W @;H,/-NX+HN^NuNVRm0mN|N^NuNVJmPo A;HPN^NuNV0m Rm Jm"f 0m /2m F I"_l F` G g60m ;HL/NX"H0m I;HN0m`Rm` G;H G;HN^NuNVJmg2N~2m 0m;H 0m Rm JmPl 0mRm`Jm,gN~ G;H0m Rm 0n /N}XN^NuNV G;HP2n AAl Hz 0n /NP g F;HPN^Nu.,!?:;NV0m ;H0m ;H0m;H m+H F;HRN^NuNVJmRg"0m;H 0m;H 0m;H m+HN^NuNV G;H\;H^;H*;H(;H&;H$A;H00m ;HJ2m 0m I=HJm gJmXf F` G gv2n0m N_;H$2n0m N_ I=H2m 0m I;HJ2n0mn0n;H&`*0m;H&2n0m I;H*2m*AN_;H( G;HPA+HdA+Hh0m"/NX G;H"mF mg mF0P/NX`NHx N*X/N*X/-lHnHnN /-lHnHnN /-l/ n"F/N Jm0m0m0;H2 n;H4Jmg~A+HdA+Hh2m"Al A;H"0m"/NXHx N*X/N*X/-lHnHnN /-l/ nC/N N^NuNVJn gJ mF2PAN_CwN_ @bHxN*X2n Fo2n F I/NXN^NuNVB0. @CN_=HN0nCf^B0. "@AN_ @b-bH0@CwN_ @bJm\g A=H0n/N,X0m`Sm` F;H\`h G;H\0nCf"B0. "@AN_ @bN `4JmgNNB0. "@AN_ @b0n/N,X/-FNX+HFN^NuNV"mF m6f0m^;H0 G+H6N^NuNVNHxN*X0mRmN^NuNV0n /N*X0n /NXN^NuNVJm gJm`f F` G g0m$/NXJmPl&Jm&g/NXSm&0m& G;HP`LJm(g/NXSm(0m(Sm*0m*2mJ0m*n/NXSm*0m*SmJ0mJSm 0m G;HN^NuNV0n Sn gHxN*X`N^NuNV mdRd"H0n  mhRh/-bH0@CN_"_ 0m^Rm^N^NuNV/NX=HJmg/-lHnHnN /-lN6X-H/.HxNP-HJfN^Nu nRH0@Cf` nJfN^Nu"n0no(N8/.N,X//.NPN9(N^NuNV/-l/HnHnN$/-lHxHnHnN$"n ng"n ng G` F gN` 0nRn`C0n0P/C0n0P"_g G=H`Jng0n /HxHnN 0n /HnN6PN^NuNVC0n P-H n h -H/. n0PCCN_"_20n/Hx/.N 0n/Hx nP/N nP/ nHhNZP nT0P// nHhN< /.NX/. n0h "H n0h$ nX0PN_/ n0h"H0m n\0PN_/N N^NuNVA\0P=HAP0P-H ml hP"H ml hH-H2n0mpgN^Nu ml h< o"n ml h<-HJnN^Nu"n nN_"HAN_-H/-l//./.N N^NuNVA\0P=HAP0P-H ml hC I-H2n0mpgN^Nu"n nN_"HAN_-H mlCL n"/-lNXN^NuNV ml h -HHnHnHnHnN2n n0h 0ml0n/0n/NМPN^Nu2n nP0P0ml"0n/0n/0n/NZ N^NuJnfL/.HnHnN g,/-l0n/0n/N /NXN `Hx/NPHx/NP0n/0n/HxHxHnHnNHx/NP//NP0nCf0nCf F` G gF/.HnHnN g&/-l0n/0n/N /NXN^Nu0n/2nA I"_=H0n/0nC"_=H/.HnHnN g$/.HnHnN g F` G gP2n0ng G=H G=H0nRn0n/0n/0n/0n/N;/NlXN^NuNV n /2P nP0P I"_2 n/2P n0h I"_2 n JPl GN^Nu n /2P n0h$ I"_2 n JPl "n G2 n2P0mm0 n 2P n0h l n2P n0hl F` G g^/. ml hL/ n 2P ml hN_"_"_2/. ml hP/ n2P0m ml hN_"_"_2 FN^Nu GN^NuNV2nA" I=H m~-H///HnHn HnHnN\/-~0n/HnHnN2n0n0mXN_=H/.0nCN_"_C /N\X-H n P-H"n0nH0@C fN^Nu0nCN_/2nAN_"_/NXN^NuNV0mN_` g F;H/N zXN^NuNVJmg G;H/N zXN^NuNVC0n P-H n h -HA =H nT0P=H0n/0n/HnN A =HAXJPfA\JPf F` G g`Z/.HnNP g@HnHnNZP0n//HnN< G;H/.NX F;H`^0n// nHhN< N^NuNVA =H G=HJmg0n/0n/HnN A =HAXJPfA\JPf F` G g`B/-~0n /Hx0n/AT0P/AX0P/A\0P/Nv`vN^NuNV ml h=H0n "FN_=H2n0nN_"GW @=H ml h fHxNXN^Nu0n /0n/NpPJng,CP0n 0P=H Jn m0n //NpP ml h;HxN^NuNVCp0n0P=HC`0n0P=H0n"FN_=HJn g mlA/"P0nN_r"_"` mlA/"P0nN_jN_"_"/-z0n/0n /N Jng0n/0n /NPN^NuNV F=HJmvfN^Nu/-lN&X=H2n0mxN_|=HJng G=H2nAl`0nRn2n FN_=H`2n0nN_ g^2n0nN_"GV @=H/-zCp0n0P/0n/N C`0n0P/0n/NP`x mlC0n;Hx"N^NuNVJngf/-~0n/0n /NW /-~0n"F/0n /NW /-~0nC/0n /NW 0n/NXN^NuNVHx0n /HnN r //.NPN^NuNVHx@NX-HJg nC n" nC-H nC n" nC-H nC n" nC-H nC n" nC-H nC n"/.NfX nN^NuNV n h-H nT"HA2 nT"H G2 nT"H G2 nT"H G2 nC G" nCAB" nCA6" nC G" nCA" nCA" nC A" n h-H"n G  n h-H"n G  n h/Hm N\PN^NuNV/. Hn NP-HJg nTRP0P/. /.NPN^NuNV0n =H G=H/. HnNP-HJgZ nT0P"Ff0Jn f A=H/. "n0n/N(P-H nTSP0P/. /.NPN^NuNV/.HnNP-H n h-H n h"HAmHxNXN^Nu/. n h"F"_-HJnf"n0n 2`2n nT0Po`j"n ne nX"H n P" nY` nX"H0n 2 nT"H0n2 n\/2P0n I"_2 nA$H PR/./.NPN^NuNV n-H"n n hgd"nA I-H nT/2P n\0P"_2"n nX P" g nX` n AS P/. /.NP nN^NuNV n h-H n h=H F=H"n n"T n0P=HJnf GN^NuT nJPo2nT n0P=H` n 2P0nl`@0n/2n0n"H F0nN_"_=H n /2P0n I"_2`f0n/ n 2P0nN_"_=H0nN^NuNV n h-HJg/./.NP-H`N^NuNV n h=H nJPo"nA I-H` G=H2nT n0P=H2n0no2n0n I=H`T n0P=HJno02n0n"H0no"n0nN_X2 G=H`LJnl:0nN_X=H2n0n"H0nn"n0n2``` G-H``< nN^NuNV n h-H n2P nT0Pm6 nXJPf`& nT n/2P nT0P I"_2` nN^NuNV n h-H/. n hCN_"_-H nT$H0PRRN^NuNV n h-H/. n hCN_"_-H nTJPgX nC-H nT"H0n 2 nT"H G2 nT"H G2 nT"H G2 n A$H PRN^NuNVA\0P;HrAP0P;HtJmg40mt/NXCf/-z0mr//NB N^Nu0mt`TN`2/N\X fRmv0mvN^`N0`N` fSmv0mvN^`N_ fSmv0mvN^`N4`N_b`N=F`N?`Jmvg Na fSmv0mvN^`N/N(X`h mlHhHx#N*P ml h g mlC F"N^/-l/NZP/-lNX`HmHx$N*PHx0m/NP`NI/-zHx(/N `NKd/-zHx(/N `NR`/Hx/NP`HxHx0NP`HxHx1NP`pHxHx2NP`\/NFtX`NHxNFtX`>HxNFtX`.HxNFtX`N9X f./-zHx?/N ml h| g /NlX`N:z f./-zHx@/N ml h| g /NlX`JmgHx NXCf`NC g:0mN_` gHx NX F;H;H/-zHx8/N `< G;HND~`,NB(`"NB`ND/NlX`NF`NG`N?&@&A\TBtlCD9`/NXN N^Nu NVN^NuNV G=H/-l/NPCfP n h fN^Nu n hP=H/. HnHnN =H0n=H nXJPo2n nT0Pm F` G g&2n nT0P I=H nC-H` G=H2nAl$` 0nRn`C0n"H G2`C0n2Jnf^ n0PCfA/0PCP"_2`4 nJPoA/0PC"_2`A/0PC@"_2`,2n n hN_ I fA/0PC0"_2 n0PCgR n0P/NX=H2n0nl0Hm/2n0n I/ n2P G]/N G=HRn2n n hlbRn0nRn2n nT0Pf G=H nC-H nJPf `"` nJPo>C0n/0PC"_2Hm0n/ n0P//N`C0n/2PRn0n"_2 G=H n0PCgBC0n/0PC@"_2Hm0n/ n0PN_X//N`C0n/0PCP"_2`B2n n hN_ I f*C0n/0P/Rn0nC0"_"_2` nP0P=H n0h "H0m"H F I=H0n/0n/HnHnHnHnNX0n//NdP G=H2n n hl` 0nRn`C0n0P/"n0n0P"_g.0n/0n/0n/C0n0P/N"n0n/C0n0P"_22n0mZ=H`t0n/0n/HnHnHnHnNX0n/ n0hCN_/NdPN^NuNVC0n2AT"H0n2AX/2n0m"H F I"_2A\/2n0mZ"H F I=H"_20n//NP0n/HnNP0n/HxNP2n A N_=HJngJ0n/C0n0P/N~PA\"HAT0P20n/HxHnNz 0n CN_ gA\"H0n2HnAX/2PA I"_2"_2 F=H0n CN_ g A=H0n/C0n0P/N~P0n/HxHnNz 0nC=H0n CN_=H g2mAmD0n /HnHxN, 0n/0nC/0n/HnN`22n Fo&0n/0n"F/0n/HzNN^NupNVA=HJn g A =H0nSn g2nAl F` G g$"n0nRn/2P0nN_r"_2`N^NuNV nT0P=HC nP0P2AT"H n0h 2A\"H n0h2AX"H0m2HnHnNZP0n//NP0n/HnNPA/2P0m"_2AX"H0n20n//NP0n/HnNPA/0P/0m"F"_"_2AX/ n0h$"H0m F I"_2AXJPg4HnHnNZP0n//NP0n/HnNP G=H2nAl$` 0nRn`"n 0n"H G2`N^NuNVN(-H G=HC0nJPgH` 0nRn`C0n2P0n f /"n0n/NPN^Nu` GN^NuNVAfrN^NuNVT G=H/-zHxHnNY /Hx HmN r /-HxHnHxNY/-Hx!HnHxNY/-Hx"HnHxNY/-Hx'HnHxNY/-Hx(HnnHxNY/-Hx)HnTHxNYC G C G C G C G CT G HnnHzN\P G=H2nAlP` 0nRn`Cp0n//-lC0n0P"_ P"_20n//NnjP` ml h/HnHnHnNB ml h/HnHnnHnTNB/-HnHm/NZJnfB/-/NP=H0n`//NƐP`//NƐP`//NƐP`//NƐP`Hx/NƐP`Hx/NƐP`Hx/NƐP`Hx/NƐP`Hx/NƐP`Hx/NƐP`x F=H`n`jN_BJRZb l v`/-HnHmN[ /-0n//NW 0nCf G=H2nAl@` 0nRn`/-lC0n0P"_/Cp0n0P"_"` ml h/Hx1HnHnHnN ml h/Hx2HnHnnHnTN/-lNX/-l/NZPN^Nupage #NV nJgL nC-H/./.NŞP-H/./. NŞP-H/./.NŞP-HN^NuNV n R H0@=H0nCf`(0nC f` nR"H0n `"n G  n N^NuNV nR"HA  nR"H.H0@ /./.N\P/.HmNP/./. NP/.HmNP/./.NP/.HzNPN^Nu NV0n =HJnf0n N_`=HJngAp0h "Ff F` G gN^NuJn g@Cp0n0P/C|0n0P"_fN^NuCp0nRP0P`(Cp0nJPfN^NuCp0nSP0PJngApA SP0P`ApA RP0P0n//NnjPHx/NnjPN^NuNVC0n0P=H/-0nCN_"_C /N\X-H/.N\X-HCp0n0P//.C0n0P"F/N, Jn g/-0n/HmN[ N^NuNVJmvgHxNXN^NuN"HAPlHxNXN^NuHmtN^X fNȘ fNjN^NuNV/-zHxHnNY /Hx HnN r F;HhA;Hj/.Hx 0mpN_`/NW /.Hx 0mp/NW /.Hx0mr/NW /.Hx0mrN_`/NW /.Hx0mh/HxNʬ/.Hx0mj/HxNʬ/.Hx0ml/HxNʬ/.Hx 0mn/HxNʬ/./0n/AT0P/AX0P/A\0P/NY=H0nCf nC8C /N\X"FN_"GV @;Hp nCC /N\X"FN_"GV @;Hr/.HxNP;Hh/.HxNP;Hj/.HxNP;Hl/.Hx NP;Hn GN^NuAN^NuNV/.0nCN_"_C /N\X-H/.N\X-H/.Hz,N\P0n//.0n "F/N, N^Nu00NV/. 0n CN_"_C /N\X-H/.N\X-H/.NLXN^NuNVN8=H0n"FN_ gA`-H` Ad-H0nCN_ gAV-H` AQ-HHnHmtN\PHn/.NPHn/.NPHnHzNPHnHx:NP-H0mr/ nC-H/HxN, 0mh/ nC-H/HxN, 0mj/ nC-H/HxN, 0ml/ nC-H/HxN, 0mp/ nC-H/HxN, 0mn/ nC-H/HxN, HmRHn/NL N^Nu AUX: LST: NV?/.0n/N0P=H0n//NX"_nN^Nu2nAm A=H"n0n"HA] 2n0noX0n=H2n0nl&` 0nRn`"n0n"HA. `/.0n"F"_"H G `H2n0nl:0n=H2n0no$` 0nSn`"n0n"H G ``4N^Nu`,N_.][`/-lN,X///HnHnHnHnN\N^NuNV ml h-H/.Hx]NP-H"n n0n N^NuNV ml h-H/.Hx[NP-H"n n0n N^NuNV0mX=H0m=H n P2P n 0h$=H n 0h =H n 0h "H n 0h$ I=H0m=H0n/2n ml hL0mXN_"_=HHx/NPHx/NP0n/0n/0n/0n/0n/0n/0n/0n/HnHnNh(Hx/NP//NP0n/2mXAN_"_"H0n0mXN_"H ml hLN^NuNV ml h -H ml h -H0n=H0n=H/.HnHnN 0n=H2n ml hP I=H"n0n2PA N_=HJn f0n`/-l0n/HxN `Jngx/-lHnHnN nXJPo2n nT0Pm F` G g&2n nT0P I=H nC-H`/-l/.N(P`>N`4N_TL`XP``&0nCf Jng/.0n/NP`0n=H/-lHnHnN nXJPo2n nT0Pm F` G g&2n nT0P I=H nC-H` n0P/NX=H0nCg2n0nl F` G g2n0n I=H` G-H2n ml hP I=H/.0n/0n//.N\/-l/NZPN^NuNV n P0P=H0n=H n 0h "H0m=H0m=H n 0h"H0m I=H0n/2n ml hP0mZN_"_=HHx/NPHx/NP0m/0mZ/0n/0n/0n/0n/0n/0n/HnHnNh(Hx/NP//NP0n/2mZAN_"_=H/. HnHnN 2n0n g@/-lHn HnN /-l/.N(P/-l0n/HxN N^NuNV2m n0h =H0n=H G=H2n0mZN_"H0n=H2n0mZN_"H0n=H0n=H2n0nn2`2n0mZ=H`/.0n/NP0nRn`Hx/NPHx/NPHx/////0n/Hx0mZ/////////HnHnHnHnHnHnN\=HHx/NP0nCN_ g`0nCN_ g2n0nl40nSn o/.0n/NP2n0mZ I=H`0n/2n0mZ"_mL2n0mZ=H2nAclRnJno F` G g/.0n/NP``//NPJno0n=H0n=HJno2`2n0mZ=H0nSn`/.0n/NP`Jg "n0n2/-l/.NP`&/-l2n ml hP/0n/N `Jg/-l/.N(PN^NuNV n T0P=HC n P0P2AT"H0n 2AX/0n"H0m"H F I"_2A\/2n 0mZ"H F I"_20n/HxN(P0n//NP0n/HnNP0n//N(PN^NuNVNHx/NPHmXHmZHmHmN;HV0mZC;H0mV/Hx/HmN&0mV/Hx/HmN&0mV/HxHmN 0mV/HxHmzN /HxHm\N A\\2PA,l F;HA;HA;H G=H2nAl`0nC=H`Hm0n"F"_/Hm0n"F"_2PAN_C"_2Hm0nC"_/Hm0nC"_2PAN_"HA I"_2`rA\X2PAlzA ;H G=H2nAl^`0nC=H`Hm0n"G"_/2PAN_"_2Hm0nC"_/2PAN_"_2`N^NuNVvHxHxNP-HJf GN^Nu0mV=HHmdHnHnzNP nT"H0n20n//NP0n/HxNdP0n/HmHmHmHmAHh Nr G=H2nAlD` 0nRn`C0n/Hm0mCN_"H0n"_0P"_2` nX"H0mX2 n\"H0mZ2/.Hx0m\/A\T0P/A\X0P/A\\0P/NT"_2/Hx0n/AT0P/AX0P/A\0P/ nP/ nHh nHh nHhN (/.NX n0h"H0m0mZN_=H n0h "H n0h$0mXN_=H n0P/HxHz@N  A\X2PAN_/A\\2PAN_/HxHx0n/AT0P/AX0P/A\0P/N Rm0m n0P/0n/AT0P/AX0P/A\0P/N n0P/Hx nP/N nP/ nHhNZP0n// nHhN< /./N:P/.0n/0n/N` -HvC n0P"H nv" nvN^NuNV nP2P0m"FCN_=H0nC ICN_=H nHh$0m"F"H0n"_2N^NuNV G-H"nAl:` nR`C n P-HJg/.NX`0mV/HxAT/N 0mV/HxAT/N Hx/NPNHN^NuNV n h -H n0P/N XA\X2PAN_/A\\2PAN_/HxHx0m\/A\T0P/A\X0P/A\\0P/Nr n0P/N X nT0P/NXC n0P"H G"Sm0m/.NpX/.NHXN^NuNV n C. H0@2 n T0P/. H0@CN_/NdPN^NuNV n 0h=H/. NzX. H0@C f A @ C. H0@ AR"H G /. HnNPJng/. NXXN^NuNV G=H G=H/.NHX=H n 0h=H n T0P=H/. HnHnN| 2nAP0P=H0nCtN_ g0nC@N_ g0m=HA=HHnAX"H0n2"_2AP/AHh 0n/2mX0nN_"_"_2"_20nCN_ gfAX/2PA0h I"_2AP/2PA0h I"_2A/2PA0h"_2AA /2PA0h"_2AT/AHh2n F I"_2"_2A\/AHh 2n0mZ"_2"_20n/HxNP0n/0n/NP0n/0n/NP0n/HxHnND 0n//NP0n//NP0n/HxN(P0nC0N_ g^0n/HxHnHnHnHnNXJmf0nCN_ g F` G g2nA I=H0n/0n/0n//.N0mZCf&0n/Hx HnHnHnHnNX0n/ n 0h /N(P n A/2P0n"_2N^NuNV nT0P=H/.0n /HnN fN^NuHm\HnNP fN^NuHnHnNZP G=H2nAl^` 0nRn`Hn0nC"_/C0n/C0n/C0n0P"_2"_2"_2`JnlPAT/2P0n I"_2AA/2P0n"_2AT/A\2P0n"F"_2`PA\/2P0n I"_2AA /2P0n"_2A\/AT2P0n"H F I"_2C G"0n/HxHnHnHnN0n//NP0n/HnNPN^NuNV nT0P=H n0h=H/.0n /HnN fN^NuHm\HnNP fN^NuHnHnNZP/.NzX G=H2nAl^` 0nRn`Hn0nC"_/C0n/C0n/C0n0P"_2"_2"_2`JnoPAP/2P0n"_2AX/2P0n I"_2AX/0n"H0n"H F I"_2`FA/2P0n I"_2AA /2P0n"_2HnAX2P0n"F"_2C G"0n/HxHnHnHnN0n//NP0n/HnNPJng/.NXXN^NuNV n 0h=H/. 0n /HnN fN^NuHnHnNZP/. NzX n T0P//NP n T0P/HnNPJng/. NXXN^NuNV0n/0n/ n"G/ nC/ nC/ nC/N 8N^NuNV0n/0n/ n0P/ nT0P/ nX0P/ n\0P/N N^NuNV nT"H n 0P2 nT"H n T0P2 nT/ n 2P n X0P"H F I"_2 nT/ n T2P n \0P"H F I"_2N^NuNV"n nl n N^Nu nN^NuNV"n no n N^Nu nN^NuNV n2P nX0P/ n 2P n X0P/NP=H nT2P n\0P/ n T2P n \0P/N`P=H n0P/ n 0P/NhP=H nT0P/ n T0P/NJP=H nT"H0n2 nT"H0n2 nT/2n0n I"_2/.2n0n I"_22n0no2n0no F` GN^NuNVJn g/. NXX`/. NzXN^NuNV n0h f/.NXN^NuNV n0h g/.NXN^NuNV nT0P=H/.HnHnN| C0n2AT"H0n2AX/2n0mX"H F I"_2A\/2n0mZ"H F I"_20n/HxN(P0n//NP0n/HnNP0n/ n0h /N(P nC n0hN_`2N^NuNV/. n0h"H0mXN_"H nP0P"H n0h$"_2/. n0h"H0mZN_"H n0h "H0m"_2N^NuNV/.HnHnN Hm\HnNTP2n0mX"HAX0Pn"2n0mZ"HA\0Pn G` FN^NuNV n0h=H/.NX nC0n 2 nC0n2Jng /.NXN^NuNV/.HnHnN /. nP2P n0h$"_2 nT/ n0h "H0m"_2 nX/ n0h "H n0h$ I"_2 n\/ n0h"H0m I"_20n`j n\/2n nT0P I"_2`| nT/2n0mZ"_2`b"n0n2 nT"H0n2 n\"H0mZ2`8`4N_` nP//.NFPN^NuNV n0P/Hx nCN_/"n n I"_N_////N  n0P/Hx n CN_"H nN_////N N^NuNV"n n o& nCN_/"n n I"_N_-H n0P/Hx /.///N  n CN_"H nN_-H "n n0h"g0 nC" n 2 n0P/Hx/. ///N N^NuNVJmfN^Nu n0P/Hx HnHnHnHnN 82n n0Pg@ n0P/Hx n0P////N C n0P/NXN^NuNVN^NuNV/HztNDPN^Nu[3][This facility is not|implemented yet][CANCEL]NVC0n2 F=H2nAl,` 0nRn`C0n"H nT0P2`Hx/Hx0n/N=N^NuNVC0n2AT"H0n2Hxi//0n/N=/. A0P"_2/.AT0P"_2N^NuNV/. N>TX/.N>rXHxn//0n/N=N^NuNV/.N=XHxo/Hx%0n/N=HmN=XN^NuNVC0n2AT"H nT0P2AX"H n0P2/.N>TX/. N>rX/.N>XHxy//0n/N=HmN>XN^NuNVC0n 2Hxz//0n/N=N^NuNVHx{//0n /N=N^NuNV/.Hx|//0n/N="_2/. A>0P"_2/.A>T0P"_2N^NuNV/.Hx//0n/N="_2N^NuNVC0n 2Hx //0n/N=N^NuNVN=Z/.N=X/.N>(X nCZ/N>>XHxd/Hx n 0P/N=/. AA 0P"_2HmN=XHmN>(XHm>N>>XN^NuNVHxe//0n /N=N^NuNVC0n2/. N>TX/.N>rX/.N>XHxmHx/0n/N=HmN>XN^NuNV/.N>XC0n2HxHx/0n/N=HmN>XN^NuNV/.N>XHx0n//0n/N=HmN>XN^NuNVC0n 2Hx//0n/N=A0PN^NuNVC0n 2AT"H G2Hx//0n/N=A>0PN^NuNVC0n 2Hx//0n/N=A0PN^NuNVC0n2AT"H0n 2Hxl/Hx0n/N=N^NuNVC0n 2Hxq//0n/N=N^NuNVC0n2AT"H0n2 G=HC0nRn"H nRB @2 g`Hx/Sn0n/0n/N=N^NuNVC0n2AT"H0n2/. Hx'/Hx0n/N="_2/.AT0P"_2N^NuNVC0n 2Hxj//0n/N=N^NuNVA-HA-H nT"H0n2 nT"H0n2 nT"H0n2"n G2 nT"H0n2 nT"H0n 2 nT"H nRB @2 g`AC A 2Hx HxU"nA FN_/0n"/N=N^NuNVC G2AT"H0n2Hx //0n/N=/.A>0P"_2/.A>T0P"_2/. A>X0P"_2/.A>\0P"_2N^NuNVC0n 2Hx //0n/N=N^NuNVC0n 2Hx//0n/N=N^NuNVC0n2Hxk//0n/N=/.A>0P"_2/.A>T0P"_2/. A>X0P"_2/.A>\0P"_2A0PN^NuNVC0n 2Hx//0n/N=A0PN^NuNVC0n 2Hx//0n/N=A0PN^NuNVC0n 2Hx//0n/N=A0PN^NuNV/.N>XHxrHx/0n/N=HmN>XN^NuNV/.N>XHx 0n//0n/N=HmN>XN^NuNVC0n 2C0n2AT"H0n2Hxg//0n/N=N^NuNVC0n 2Hxh//0n/N=A0PN^NuNV/. N=XHxp/0n CN_/0n/N=HmN=XN^NuNVC0n2AT"H0n2/.N>(XHx/Hx0n/N=HmN>(XN^NuNVHx//0n/N=/.A0P"_2/.A0P"_2/. A>0P"_2/.A>T0P"_2 nT/A>\0P"_2 nX/A>A 0P"_2 n\/A>A0P"_2 nP/A>A0P"_2/.A>X0P"_2 nT/A>P0P"_2 nX/A>A 0P"_2N^NuNVCA"AX"HA"AP"HA"AC A"ACA>"N^NuNVC0n2AT"H0n2A\"H0n2AC 0n 2N=A0PN^NuNVA"psNBN^NuNVAX"H n"N^NuNVAP"H n"N^NuNVAC n"N^NuNVAC n"N^NuNVAA-H"n n"N^NuNVAA-H"n n"N^NuNV/.N>TXN^NuNVAA-H"n n P"N^NuNVHm.AF"_"A.X/AN"_"A.P/Al"_"A.Hh A"_"A.HhA"_"A.HhA"_"A.+H*Hx NKXAB0 @;H( FN^NuNVHxNKX FN^NuNVCl0n"2AlT"HB0. @2AlX"HB0. @2HxNKX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2AB0 @N^NuNVClB0.b @2AlT"HB0.^ @2AlX"HB0.Z @2Al\"HB0.V @2AlP"HB0.R @2AlC B0.N @2AlC B0.J @2AlCB0.F @2AlCB0.B @2AlCB0.> @2AlCB0.: @2AlCB0.6 @2AlCB0.2 @2AlCB0.. @2C n("AlCB0.& @2AlCB0." @2HxNKX/.ATB0 @"_2/.AXB0 @"_2/.A\B0 @"_2/.APB0 @"_2/. AA B0 @"_2/.AA B0 @"_2AB0 @N^NuNVC n "Cl0n 2HxNKXN^NuNVC n"Cl0n2AlT"H0n 2HxNKXN^NuNVC n"Cl0n2AlT"H0n 2Hx NKXN^NuNVC n"Cl0n2AlT"H0n 2Hx!NKXN^NuNVC n "Cl0n2AlT"H0n2AlX"H0n2Al\"H0n2AlP"H0n2AlC 0n 2Hx*NKXN^NuNVC n"Cl0n2Hx,NKX/. ATB0 @"_2/.AXB0 @"_2AB0 @N^NuNVC n"Cl0n2AlT"H0n2AlX"H0n2Al\"H0n 2Hx+NKXN^NuNVC n "Cl0n 2Hx2NKXN^NuNVCl0n*2AlT"H0n&2AlX"H0n"2Al\"H0n2AlP"H0n2AlC 0n2AlC 0n2AlC0n2AlC0n 2Hx3NKXN^NuNVC n"Hx6NKX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2AB0 @N^NuNVCl0n 2Hx5NKXN^NuNVCl0n2C n"Hx4NKXN^NuNVCl0n&2AlT"H0n"2AlX"H0n2Al\"H0n2AlP"H0n2AlC 0n2AlC 0n2AlC0n 2HxINKXN^NuNVCl0n&2AlT"H0n"2AlX"H0n2Al\"H0n2AlP"H0n2AlC 0n2AlC 0n2AlC0n 2HxJNKXN^NuNVCl0n2AlT"H0n2AlX"H0n2Al\"H0n2HxFNKX/. ATB0 @"_2/.AXB0 @"_2AB0 @N^NuNVCl0n.2AlT"H0n*2AlX"H0n&2Al\"H0n"2AlP"H0n2AlC 0n2AlC 0n2AlC0n2HxGNKX/. ATB0 @"_2/.AXB0 @"_2AB0 @N^NuNVHxMNKX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2AB0 @N^NuNVCl0n2C n"HxNNKXN^NuNVHxONKX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2N^NuNVC n"AX"H n "HxZNKX/.ATB0 @"_2AB0 @N^NuNVClB0. @2AlT"H0n2AlX"H0n2Al\"H0n2AlP"H0n 2HxdNKXN^NuNVCl0n2AlT"H0n2AlX"H0n2Al\"H0n2AlP"H0n 2HxeNKXN^NuNVCl0n 2HxfNKXN^NuNVCl0n 2HxgNKXN^NuNVCl0n2AlT"H0n2HxhNKX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2AB0 @N^NuNVCl0n2AlT"H0n2AlX"H0n2Al\"H0n2AlP"H0n2AlC 0n 2HxiNKXN^NuNV0n/0n/"nAN_//.//NIN^NuNVCl0n2AlT"H0n 2HxjNKXN^NuNVCl0n 2HxkNKXN^NuNVCl0n.2AlT"HB0.* @2AlX"H0n&2Al\"H0n"2AlP"H0n2AlC 0n2HxlNKX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2AB0 @N^NuNVC n"HxnNKXN^NuNVCl0n2AlT"H0n2HxpNKX/.A P"_"AB0 @N^NuNVCF0n 2Hm2n A ICN_"_-H F=H2nAl0` 0nRn`CF0n"H nRH0@2`NL6AB0 @N^NuNV"-*0<NBN^NuNV/-!NQXN^NuNV/./-!NPPN^NuNV/./-!NQTPHx /-!NPPN^NuNVHx$/NWP-H fA+H! GN^Nu/. /./.NL o nN^Nu GN^NuNV n H0@/NZX-H n`H G-H F-H`Z F-HA-H`HA-HA-H`4A+H!N^Nu`$N_RWA`/.Hz@NZzP gB nCN_r-HJg/HxPHxHz/N2+H! m! -H`/.HzNZzP g$ nCN_r-H nC-H`/.HzNZzP f/.HzNZzP f G` F g2JfA-H` A-H nCN_r-H`N n"Ff*HxA/.N`PHx n/N`P"_" g AN^Nu nX/NXpX nHh nHh nX"H G""_""_" GN^NuNV n C fHx /.NU4P/. /.NU4P n C f/.NOX g F` G g /.NS X n h g AN^Nu n N^NuNV n Jg n R H0@//.NPP`N^NuNV/.NSPX-H nC f8/.NSPX-H nC f n-H`/./.NR$P nCf8/.NSPX-H nCf n-H`/./.NR$P nN^NuNV n hCf n Cg G` F g AN^Nu nC n "N^NuNV n-HS J o@/.NQX-HCf`$ nR"H n C f``"n G "n nf GN^Nu nN^NuNVJf m!N^Nu n hN^NuNV nC G"N^NuNV n h g/.NV X g AN^Nu GN^NuNV n h"FN_ f nCA"AN^Nu n h-HCg nCA" nN^Nu/.NOX gX nP"P n hm>/-!NS X nHh n/ nX/HxN2 "_" nP"H G"`^/.NOX g n/N`XN^Nu nP"P n hm/.NTX g F` G g AN^Nu nX"P nP$H PR-H nH0@CN_N^NuNVHx? n/Hx nX/N`-HJo nC n" nC G"`6 nC G"Jf nCA"` nC n" nP"H G" n hN^NuNV n hCN_ f nCA"AN^Nu/.NOXN_` g/.NOX g F` G g n//. N`P n N^Nu nX"P nP$H PR-H"n n  nC F" nP"PAm/.NV X g F` G g AN^Nu n N^NuNV/.NOX g8 nX P-H"n nP P"H G  n//.N2P`rHx@ n/ nP/ nX/N`-HJl nC n"`2"n nP Pl nCA"` nC G" nP/ nC G""_" n hN^NuNVHzNLpX. H0@/NW(XN^NuabortedNVNWHHxL. H0@/N`PN^NuNV m!-HJg/.NS X n h -H`N!bN^NuNV/.NLpX/. NW(XN^NuNV"n nN_//NWPN^NuNV/./NWPN^NuNV n CCN_-HHxH/.N`P-HJf GN^Nu nR"HA  n"FN_ g nR"HA  n-HJg" n S o nR"H G ` nN^NuNVS nH0@-H nCfS nH0@-H nCfHxI/.N`P GN^NuNVHxHHxN`PN^NuNV"nA _ @N^NuNV n Jg, n H2@. H0@f n N^NuR n ` GN^NuNV n H2@ nH0@f$ n Jf GN^NuR n R n` n H2@ nH0@ IN^NuNV n-H nS oH nR"H n R H0@  g` nS o nR"H G ``"n G  nN^NuNV"nAzn"nAam F` G g"nA IN^Nu nN^NuNV"n F I-HR nJg`"n n IN^NuNV n Jg@ n R H0@/NZX/ nRH0@/NZX"_g GN^Nu` nH0@"GW @N^NuNV G-HJgtHnHnHnHnNGJngT/N2X///HnHnHnHnN?\//N2P-H nCf /NW(X nN^NuHx N`X glHxN`XCN_-H nC f A -HJg8 nCfN2CN_-H` nCf /NW(X nN^NuNVJl nN_XN^Nu nN^NuNVJo FN^NuJf GN^NuAN^NuNVJl nN_X-HA- @` A @Jo"n S n"H G `4Jl nN_X-H`"n nJg R n`JgH"n S n/"nA N_ IC0"_ "nA N_-H f``Jg"n S n"H.H0@ Jo"n S n"HA ` n N^NuNV nH0@/NXX g R n` F-H nH0@`A-HR n`N_-+ G-H nH0@/N^X g0 nC N_"H nRH0@"HA0 I-H`"n nN_N^NuNV"n F I-HR nJg` nR"H nRH0@  g` n N^NuNV n -H nR"H nRH0@  g` n N^NuNV G-H n Jg, n H2@. H0@f n -HR n ` nN^NuNV"nA9n"nA0m F` GN^NuNVHxA/.N`P-H nC߳f GN^NuJg AN^Nu GN^NuNV/.N_XN^Nu D @Nu W @Nu F @Nu " @Nu " @Nu " @Nu " ANu " ANu " ANu"_ g "fNN BNu"$ 68HAHBBHABA҃ ANu$ma`DaD A"BNu$" a A"BNu" j DaDDNu cPgc $BNurBNu&BCHCR(*$a.$Â$&HCHCԃb DbR`S`NuHPBAHA62HAB42HA6Nu$O?*NA @.JNu$O?*?* `$O/*?* `$O?*/*?*`$O/*/*?*?*`$O?*?* /* ?*`$O/*/*/* ?*?*`NV G+H!+H!HzzHz{NLP+H! nRH0@-H nC//NWP-H/././.NY C!"A!r" nJg nH0@`R n`R/.HzHm!Nb -H`R nH0@C>f"R/.HzHm!Nb -H`/.HzHm!Nb -H`n"m!AlC!" m!R!"H n"/.NbX-H`$N_F H<^>``J!fHz1Hz2NLP+H!J!f m!+H!N^NuCON:WrawCON:RNV nJg< nH0@/NXX g nR"H G  nN^NuR n` nN^NuNV n-H/.NbX-H/././. NLP"_" nN^NuA 0g C" ӑ`Nu   $  ,04,044884@DH@DHLLHLLH .,!?:;_GST word processor[....................................................] DGFEHI#$&'*+,-45DEFGHIMNOQRS7:;=B""33ww!#$&'(*+,-/0124578:;=?@BDEFGHIKMNOQRS(T())|)*K*++~+,R,-#-----.J.J.J.J.///0Q011s121223[34-445]56)667Q[1][Use OPEN FILE to create or|edit a file in a window - up|to four can be open at once][OK|CANCEL][1][Use PRINT FILE to select a|file for printing - remember|to use SAVE FILE first][OK|CANCEL][1][Use SAVE FILE to save the file|in the current window to disk|and to close the window][OK|CANCEL][1][Use SAVE AS to save the file|in the current window to disk|but give it a new file name][OK|CANCEL][1][Use PAGE LAYOUT to define the|page layout and the head and|foot lines for your document][OK|CANCEL][1][Use DELETE FILE to delete a|file from the disk permanently|to make room for SAVE FILE][OK|CANCEL][1][Use READ FILE to insert a|complete file from disk at the|current window cursor position][OK|CANCEL][1][Use WRITE FILE to save the|contents of the marked block|in the window to a disk file][OK|CANCEL][1][Use QUIT EDIT to close the|window without saving the text|and to exit to the GEM Desktop][OK|CANCEL][1][Use WP MODE for document text|only - turn it off for editing|program sources or data files][OK|CANCEL][1][Use INSERT MODE to show if the|text you type must be inserted|or must overwrite the old text][OK|CANCEL][1][Use FIND to search for a text|string within the window and|to move the cursor there][OK|CANCEL][1][Use REPLACE to search for a|text string and replace it|with a second text string][OK|CANCEL][1][Use REPEAT FIND to repeat the|previous FIND or REPLACE|from the cursor position][OK]|CANCEL][1][Use SET MARK to remember a|position in the current window|so you can GOTO MARK later][OK|CANCEL][1][Use GOTO MARK to return to a|position in the text that you|have remembered with SET MARK][OK|CANCEL][1][Use START BLOCK to define or|modify the start position of a|block - then use END BLOCK][OK|CANCEL][1][Use END BLOCK to define or|modify the end position of a|block - use after START BLOCK][OK|CANCEL][1][Use CUT BLOCK to copy the text|in the block to the clipboard|so you can PASTE BLOCK later][OK|CANCEL][1][Use PASTE BLOCK to copy the|text on the clipboard to the|window at the cursor position][OK|CANCEL][1][Use COPY BLOCK to copy the|text in the block to the|window at the cursor position][OK|CANCEL][1][Use MOVE BLOCK to move the|text in the block to the|window at the cursor position][OK|CANCEL][1][Use DELETE BLOCK to delete the|text in the current marked|block - permanently][OK|CANCEL][1][Use FIND START to move the|cursor in the window to the|start of the marked block][OK|CANCEL][1][Use FIND END to move the|cursor in the window to the|end of the marked block][OK|CANCEL][1][Use HIDE BLOCK to remove the|start and end block markers|and undefine the block][OK|CANCEL][1][Use BOLD before typing text|that you want to see in bold|and before a RESTYLE command][OK|CANCEL][1][Use UNDERLINE before typing|text that you want to see|underlined and before RESTYLE][OK|CANCEL][1][Use ITALIC before typing text|that you want to see in italic|and before a RESTYLE command][OK|CANCEL][1][Use LIGHT before typing text|that you want to see in light|and before a RESTYLE command][OK|CANCEL][1][Use SUPER before typing text|that you want to see in|superscript and before RESTYLE][OK|CANCEL][1][Use SUBSCRIPT before typing|text that you want to see in|subscript and before RESTYLE][OK|CANCEL][1][Use RESTYLE to changed the|text style of a marked block|to the style options selected][OK|CANCEL][1][Use JUSTIFY to show if you|want 1st Word to justify your|text on the right margin][OK|CANCEL][1][Use WORD WRAP to show if you|want 1st Word to wrap onto the|next line at the right margin][OK|CANCEL][1][Use SPACING to show if you|want 1st Word to use double|line spacing in REFORMAT][OK|CANCEL][1][Use CENTRE to position an|existing line half way between|the left and right margins][OK|CANCEL][1][Use INDENT to define your|paragraph indent size before|typing or a REFORMAT command][OK|CANCEL][1][Use REFORMAT to rejustify a|paragraph after you have|changed the text or style][OK|CANCEL]c <@ABC=[1][To create or amend a document|use OPEN to open a text window|(up to 4 can be open at once)|then SAVE when you've finished][ OK ][1][Use LAYOUT in the File Menu|to specify page shape and size|and head and footline text][ OK ][1][To set the text margins move|the pointer to the ruler line|and drag the margin indicator|to the required position][ OK ][1][To set or clear tab points|move the pointer to the ruler|line and click the mouse at|the required position][ OK ][1][WORD WRAP handles line ends|for you automatically at the|right margin. JUSTIFY aligns|the text on the right margin][ OK ][1][To correct your document use|EDIT to open the file then|scroll through the file and|delete or add text as required][ OK ][1][The cursor shows where editing|or typing will happen. Move it|with the keys marked    |or move the mouse and click][ OK ][1][Click in the GEM scroll bars:|    for single line/column|shaded area for window scroll|or drag the white slider bar][ OK ][1][Use BACKSPACE for characters|to the left of the cursor.|Use DELETE for characters at|the cursor position][ OK ][1][INSERT = insert line|CONTROL+SPACE = fixed space|CONTROL+ or  = move word|CONTROL+DELETE = delete word][ OK ][1][Define a block with START and|END BLOCK or by dragging the|mouse in the window. Then use|the BLOCK menu to move text][ OK ][1][Use INSTALL PRINTER to|select type (DOT or DAISY) and|the port (PRINTER or MODEM).|Use PRINT to specify output|mode and print a document][ OK ][1][Click in the left border to|insert or delete page breaks.|F7 also inserts a new page.|Drag the mouse for a|conditional page break][ OK ]1ST_PRNT.PRGDSYDOT,X(KZ |FP *, R >  ~v0@< @8,NNL84`@X,* 8lH .ZB>n6^"(T Њ>:@0 `6,L|&2Z\x& Rz2*6, ,N( tVx:*D. HnT` l 4 T ($t0"t* &&$&   @P| b>.$ $p 2 2 4$ Zv   4 &,&(*,^4..   "B0..08   $ *\X$  6 T4*L.rPB&08.<(022TVp,<~ f̈(   <*"hd ("2"p4Z>n0L^6&. & 2.$><^HR$ D< :f:8.l$ V : $VD"J@$(@V N 4 2  BN" "<(J"   ,v,"&  l^4:p\L|,.6" $ > JX V ,&&F0Ąr     "        42 .24" ((((*0222(2 H"B ($4  &H0$L0P662N>tvX"p6(~J&40XFZ6D` $8>4   *4..$:2\&$$$$$n$,LBX(\N(Tj@&8@ v^"b ` bx@ .$NVrN$& ,v. &XTZ>"X* > J 0Z4X2@<6 2* JD""(h4ZZ:4, 3C, 8, 5F * <=: : < bsp _ F4 * Integral top piece: F5 * Integral bottom piece: F6, BF * Division sign: F7 * Twiddly =: F8, C6 * Degree symbol: F9 * Superior b0660203030466 1GST Software1st Word User Guide 23896.2 GST 36/1.04#23 January 1986 9[....................................................] 1STWORD USERGUIDE FORTHEATARIST  COPYRIGHT  Copyright(C)1985GSTHoldingsLimited.Allrightsreserved.No partofthispublicationmaybereproduced,transmitted, transcribed,storedinaretrievalsystem,ortranslatedintoany languageorcomputerlanguage,inanyformorbyanymeans, electronicormechanical,magnetic,optical,chemical,manualor otherwise,withoutthepriorwrittenpermissionofGSTHoldings Limited,91HighStreet,Longstanton,Cambridge,England. DISCLAIMER  GSTHOLDINGSLIMITEDMAKESNOREPRESENTATIONSORWARRANTIESWITH RESPECTTOTHECONTENTSHEREOFANDSPECIFICALLYDISCLAIMSANY IMPLIEDWARRANTIESOFMERCHANTABILITYORFITNESSFORANY PARTICULARPURPOSE.Further,GSTHoldingsLimitedreservesthe righttorevisethispublicationandtomakechangesfromtimeto timeinthecontentshereofwithouttheobligationofGSTHoldings Limitedtonotifyanypersonofsuchrevisionorchange. NOTICETOUSER  Fromtimetotimechangesaremadeinthefilenamesandinthe filesactuallyincludedonthedistributiondisk.Thismanual shouldnotbeconstruedasarepresentationorwarrantythatsuch filesorfacilitiesexistonthedistributiondiskoraspartof thematerialsandprogramsdistributed.Distributiondisksmay includea"README.DOC"file.Thisfileexplainsvariationsfrom themanualwhichdonotconstitutemodificationofthemanualand theitemsincludedtherewith.Besuretoreadthisfilebefore usingthesoftware. TRADEMARKS  1stWordand1stMailaretrademarksofGSTHoldingsLtd. GEMandGEMDesktoparetrademarksofDigitalResearchInc. AtariST,TOS,SF314andSF354aretrademarksofAtariCorp. EpsonRX-80,FX-80andLX-80aretrademarksofEpsonCorp. QumeSprintisatrademarkofQumeCorp. CONTENTS 1 INTRODUCTION 1.1 Welcometo1stWord 1.2ComponentsList 1.3 AbouttheUserGuide 1.4 EssentialReading 2 GETTINGSTARTED 2.1 MakingaBackupCopy 2.2 Loadingthe1stWordProgram 2.3 TheStartupScreen 2.4 HelpInformation 2.5 CreatingaDocumentFile 2.6 TheEditWindow 2.7 Typing 2.8 SavingtheDocumentFileonDisk 2.9 EditingaDocumentFile 2.10 ScrollingThroughtheDocument 2.11 PageBreakDisplay 2.12 PositioningtheCursor 2.13 DifferentTypesofSpaces 2.14 DeletingText 2.15 TextInsertandOverwriteModes 2.16 ParagraphFormatting 2.17 SavingtheDocumentFilewithaNewName 2.18 HowtoExitfrom1stWord 3 1STWORDUSERINTERFACE 3.1 TypingandEditing 3.2 WPMode 3.3 Keyboard 3.4 FontTable 3.5 FunctionKeyIcons 3.6 Drop-downMenus 3.7 EditWindows 3.8 Pagination 3.9 RulerLine 3.10 DocumentSizeRestrictions 4 ATARIMENU 4.1 1stWord... 4.2 DeskUtilities 5 FILEMENU 5.1 Open... 5.2 Print... 5.3 Save 5.4 Saveas... 5.5 Layout... 5.6 Read... 5.7 Write... 5.8 Delete... 5.9 Quit 6 EDITMENU 6.1 WPMode 6.2 InsertMode 6.3 Find... 6.4 Replace... 6.5 Repeatfind 6.6 Setmark 6.7 Gotomark 7 BLOCKMENU 7.1 Startblock 7.2 Endblock 7.3 Cutblock 7.4 Pasteblock 7.5 Copyblock 7.6 Moveblock 7.7 Deleteblock 7.8 Findstart 7.9 Findend 7.10 Hideblock 8 STYLEMENU 8.1 Bold 8.2 Underline 8.3 Italic 8.4 Light 8.5 Super 8.6 Subscript 8.7 Restyle 8.8 Justify 8.9 Wordwrap 8.10 Spacing 8.11 Center 8.12 Indent 8.13 Reformat 9 HELPMENU 9.1 Extrahelp 9.2 OtherHelpScreens APPENDIX A PRINTERDRIVERS A.1 StandardPrinterDrivers A.2 CreatingaNewPrinterDriver A.3 InstallingaNewPrinterDriver B 1STWORDDATAFORMAT B.1 CharacterSet B.2 ControlCodes 1 INTRODUCTION 1.1 Welcometo1stWord Welcometo1st WordfromGST Software,theprofessionalword processingpackagedesignedespeciallyforyourAtari ST computerandtheGEMoperatingenvironment. 1st Wordissuitableforallwordprocessingtasks,froma simplememoorlettertoan80pagereport,andis particularlyusefulinanenvironmentwheredocumentcutand pasteisacommonactivity.1st Wordcanalsobeusedto prepareformlettersformailmergeoperationswith1stMail, whichisavailableasanoptionalextrafromGST Software. 1st Wordhasbeendesignedtobeveryeasytolearnand operatewithoutimposingunnecessaryoverheadsonthe experienceduser.Fulladvantageistakenofuser-oriented GEMfeaturessuchaswindows,icons,drop-downmenusand forms.Thisensuresthattheonlytimeyouneedtousethe keyboardiswhenyouaretypingtext.Complexeditingtasks suchascutandpasteorchangesindocumentlayoutorstyle beingachievedbyuseofthemouseonly.  1.2ComponentsList 1st Wordissuppliedononesingle-sideddiskholding: README Initialinstructions GUIDE.DOC The1stWordUserGuide TUTORIAL.DOC Atutorialfileforediting 1ST_PRNT.DOT Installeddotmatrix... 1ST_PRNT.DSY ...anddaisywheelprintertables 1ST_PRNT.PRGTheprinterdriverprogram 1ST_WORD.PRG The1st Wordprogram... 1ST_WORD.RSC ...anditsGEMresourcesfile Inthefolder\PRINTER\youwillfind: ASCII.HEX Patchfile:ASCII-onlyprinter BRO_HR15.HEXPatchfile:BrotherHR-15/25daisy EPS_LX80.HEX Patchfile:EpsonLX80NLQmatrix EPS_RX80.HEX Patchfile:EpsonRX/FX-80matrix QUME .HEX Patchfile:QumeSprintdaisy SMM804.HEXPatchfile:AtariSMM804matrix INSTALL.PRGPrinterdriverinstallprogram Pleasecontactyourdealerifanyofthesecomponentsis missingordefective. 1.3 AbouttheUserGuide The1stWordUserGuideprovidesalltheinformationyouwill needtopreparedocumentsorprogramsourcefilesonyourST: *creatingdocumentsorsourcefiles, *editingexistingdocumentsorsourcefiles, *printingdocumentsonamatrixordaisywheelprinter. Thesearedescribedfully,butonlyintermsofoperatingthe program.TheUserGuidedoesnottellyou: *howtotype, *how(ingeneral)tooperateyourAtariST, *how(ingeneral)tooperateGEMwindows(thoughspecific GEMfunctionsusedby1st Wordaredescribedindetail). TheUserGuidecanbereadinthreeways: *asatutorialguidetohelpyougetstarted - essential forbeginnerswhohavenotusedawordprocessorbefore, *asareferencemanualforexperiencedusers, *asalastresortforthecomputerhackerwhonever botherstoreadthemanualinthefirstplace! Beforestartingtouse1stWord,werecommendthatyouread theUser Guideatleastonce,thoroughly. Chapter 2isatutorialthatwilltakeyoustep-by-step throughthebasic1stWordfeatures.BeginnerstoWPshould followthistutorialcarefullybeforeattemptingthemore advancedfeaturesdiscussedinlaterchapters.Experienced WPusersshouldreadchapter2butneednotworkthroughthe tutorial. WhetherornotyoualreadyhaveWPskills,afewsessions with1st Wordisallyou'llneedtobecomeanexpert. 1.4 EssentialReading Beforeattemptingtouse1stWord,itisessentialthatyou arefullyfamiliarwiththeoperationoftheAtariSTandthe GEMoperatingenvironment.Thesearedescribedindetailin yourAtariST Owner'sManual. 1.5 Using1stWordwithaSingleDiskSystem IfyourSThasasingleSF354diskdriveitisessentialto movesomeofthesuppliedfilesontoaseparatediskas follows: (a) ProgramDisk Makeabackupofthesupplieddiskasdescribedin2.1 andusethecopyasyourprogramdisk. (b) DataDisk Formatablankdisk.Copythefollowingfilesontoyour datadisk: 1ST_PRINT.PRG Printerdriver 1ST_PRINT.DOT Dotmatrixand/or... 1ST_PRINT.DSY...daisywheelprinttable(s) Notethattheprinttable(s)youcopyovershouldbe installedforyourprinterasdescribedinAppendixA. Tooperate1st WordwithasingleSF354disksystem,insert theprogramdiskandloadthe1st Wordprogramasdescribed in2.2.Whentheprogramhasloadedandthe1st Wordstartup screenisdisplayed(see2.3)removetheprogramdisk,insert thedatadiskandclicktheOKbuttonontheItemSelector form.Youmaynowproceedtoedityourdocument(s). Notethatyoumaycreateasmanydatadisksasyouwant,but eachdiskmustcontainthefilesdefinedin(b).Failureto dothiswillresultinanerrormessagewhenyouattemptto printafile. 1.6 FaultReportsandTechnicalEnquiries Ifyouhaveanyproblemsoperating1st Wordoranytechnical questions,youshouldfirstconsultyourdealerorlocal User'sGrouporAtariCustomerRelations. Iftheresponsefromthesesourcesisnotsatisfactory,you maycontactGSTdirectinwritingattheaddressgivenin AppendixB.Weregretthatwecannotanswerdirecttelephone enquiriesfromendusers. Faultreportsmustincludethe1st Wordversionnumbergiven ontheinformationscreen(see4.1)togetherwithadetailed descriptionoftheproblemandsufficientevidencetojustify thefaultreport.Wealsowelcomeyourcommentsandany suggestionsforproductenhancements. 2 GETTINGSTARTED 2.1 MakingaBackupCopy  Beforeyoudoanythingelse,itisessentialthatyoumakea backupcopyofthe1stWordmicrofloppydisk.Thisis carriedoutfromtheGEMDesktopprogramandtheprocedure dependsonwhetheryouhavesingle(SF354)ordouble-sided (SF314)diskdrivesandwhetheryouhaveoneortwodrives. Ifyouhavesingle-sideddrives,insertthe1st Worddisk intodrive Aandablankformatteddiskintodrive B.Now clickthemouseonthedrive Aiconanddragittothe drive Biconbyholdingdowntheleftbuttonandmovingthe mouse.Whenthedrive Biconchangestoblackreleasethe button.Answerthepromptsgivenbytheprogrambyclicking theOKbuttononlyifyouarecertainthatthedisksarein thecorrectdrives.Theprogramwillcopythecontentsof the1st Worddisktodrive B. Ifyouhavedouble-sideddrives,insertthe1st Worddisk intodrive Aandablankformatteddouble-sideddiskinto drive B.Obtainadirectorylistingofbothdisksby clickingineachofthediskwindowsandpressingtheESC key.Movethemousetothedrive Awindowanddragarubber bandaroundthefilelistoricons,thenreleasethebutton (thefilesshouldchangetoblack).Nowholddownthemouse buttoninsidetherubberbandanddragittothedrive B window,releasingthebuttonwhenthemouseiswithinthe window,answerthepromptandtheprogramwillcopyeachfile fromthe1st Worddisktodrive B. Ifyouonlyhaveonediskdrive,thesystemwillpromptyou toswapdisksfromtimetotimeduringthecopyoperation. Onceyouhavemadeacopy,storetheoriginal1st Worddisk inasafeplaceandusethecopyasyourworkingdisk. 2.2 Loadingthe1stWordProgram  1st Wordisbestusedinhighresolutionmodeonamonochrome monitor,thoughitcanalsobeusedsatisfactorilyinmedium orlowresolutionmodeonacolormonitororTV. Toloadtheprogram,insertthe1st Worddiskintoeither driveandobtainadirectorylistingofthediskbyclicking inthewindowandpressingtheESCkey.Nowmovethemouse totheiconordirectoryentrylabelled1ST_WORD.PRGand double-clicktheleftbutton.Thedesktopisclearedandthe titlelinewilldisplay1ST_WORD.PRGshowingthattheprogram isbeingloadedfromdisk.Afterashortwhile1st Wordwill displaythestartupscreen. 2.3 TheStartupScreen  When1st Wordisloaded(andbetweeneditingfiles)it displaysthestartupscreen.Thishasfourcomponents: (a) Drop-DownMenuBar  Thetoplineofthescreendisplaysthemenuheadings: Atari GEMdeskutilities File fileanddocumentlayoutfunctions Edit texteditingfunctions Block textcutandpastefunctions Style textformattingandcharacterstylefunctions Help on-screenhelpfunctions (b) FontTable(highandmediumresolutiononly) Atthecenterrightofthescreenisa(partially obscured)tableholdingthecharacterfont.Youmayuse themousetoselectcharactersfromthistablethatare notavailablefromthekeyboard. (c) FunctionKeyIcons(highandmediumresolutiononly) Thesearedisplayedatthebottomofthescreenand indicatetheWPfunctionsassignedtoeachoftheST functionkeys.KeysF1throughF5aretoggleswhich indicatethecurrentsettingsofthefollowing: F1 boldtexton/off F2 underlinedtexton/off F3 italictexton/off F4 lighttexton/off F5 insertmode/overwritemode KeysF6throughF10areactionsperformedwhenediting: F6 deleteline F7 newpage F8 centerline F9 indentparagraph F10 reformatparagraph Functionkeyscanbeoperatedeitherfromthekeyboard orbyclickingthemouseontheappropriatescreenicon. (d) GEMItemSelector Thisissuperimposedinthecenterofthescreenwhen theprogramisfirstloadedandisusedtoselectan itemforeditingfromalist.Forthemoment,ignore thisbyclickingtheCANCELbutton. 2.4 HelpInformation  1st Wordprovideshelpinformationatanytimebymovingthe mousetotheHelpdrop-downmenuandclickingonanyofthe menuentriestoobtainahelpwindow.Onceyouhavereadthe informationclicktheOKbuttontoremovethewindow.Trya fewhelpitemsnow. IfyouselecttheExtra helpentry,1st Wordwilldisplaya helpwindowautomaticallyeverytimeyouselectadrop-down menuitemandwillaskyoutoconfirmorcanceltheitem beforeproceeding. WerecommendthatyouselectExtra helpnow(anduseitfor yourfirstfewsessions)becauseyoucanbeconfidentthatno menuitemwillbeactioneduntilyouconfirmthatyouwantto proceed.TheExtra helpfeaturecanbeturnedoffby clickingtheExtra helpentryasecondtime. 2.5 CreatingaDocumentFile  Tocreateanewdocumentfile,firstmoveyourmousetothe Filedrop-downmenuandclicktheOpenitem.Thiswill displaytheGEM Item Selectorwhichcontainstwoeditable fieldsandalistoffiles: (a) DirectoryLine  Thiscontainsamasktodeterminewhichfilesare displayedinthefilelist,forexampleA:\*.DOCwhich means"allthefilesondiskAwitha.DOCextension". (b) DirectoryWindow  Thisshowsallthefilesontheselecteddisk(currently your1st Worddisk)witha.DOCextension.Becauseyou arecreatinganewfile,youcannotusethedirectory windowtoselectitsname. (c) SelectionLine  Thisfieldisusedfortypinganewfilename.First clearit(ifnecessary)bypressingESC,thentypethe nameofthedocumentyouwishtocreate,TEST.DOCfor example,andpresstheRETURNkey. YouhavenowcreatedanemptydocumentcalledTEST.DOCin memory.  2.6 TheEditWindow  EachfilethatyoueditappearsinaGEMwindow(youshould alreadybefamiliarwiththesefromusingtheGEMDesktop). Thewindowyouhaveopenedoccupiestheentirescreenexcept themenulineatthetopofthescreenandthefunctionkey iconsatthebottom. The1st Wordeditwindowconsistsofthefollowingareas: (a) TitleLine  Thisdisplaysthedocumentname(inthiscaseTEST.DOC) andisusedtochangethepositionofthewindowby dragging.Thetitlelineisboundedontheleftbythe GEMclosebox(usedtoquittheedit)andontheright bytheGEMfullbox(usedtoexpandthewindowtothe fullscreenarea). (b) RulerLine  Therulerlineisdisplayeddirectlybelowthetitle lineandshowstheleftandrightmarginandtabpoints inforceforthedocument. (c) TextArea  Thetexteditingarea(whichiscurrentlyblankbecause youarecreatinganewdocument)isdisplayedbelowthe rulerline.Thisareacontainsthetextcursor (displayedasareversevideorectangle)whichindicates wheretextinputoreditingoperationswilltakeplace. (d) PageMargin  Totheleftofthetextareaisthepagemarginwhich displaysuserdefinedandprogramgeneratedpagebreaks. Thiscurrentlydisplayspagenumber1.(Notinlow resolutionmode.) (e) VerticalandHorizontalScrollBars  Totherightofandbeneaththetextareaarethe standardGEMscrollbarswhichcanbeusedtoscroll textthroughthewindowbyline,pageordragging, eitherverticallyorhorizontally.Attheintersection oftheseareasinthebottomrightofthewindowisthe GEMsizebox.Thiscanbeusedtochangethesizeof thewindowbydragging. 2.7 Typing  Trytypingafewlinesoftextasyouwouldonatypewriter, usingtheRETURNkeytoendalineandtheBACKSPACEkeyto gobackandcorrectanymistakes.Usethisopportunityto getthefeelofthekeyboardandtoadjustthekeyboard variablesusingtheSTcontrolpanelandthevolumecontrol. NowtrytypingaparagraphwithoutusingtheRETURNkeyuntil theendoftheparagraph.Youwillobservetwoimportant features: (a) WordWrap  Attheendofeachline,whenyouattempttotypebeyond therightmargin,thewordyouaretypingwill automaticallybecarriedovertothenextline. (b) RightJustifiedText  Afterwordwraphastakenplace,eachlineisaligned withtherighthandmarginbytheautomaticinsertionof extrastretchspacesbetweenthewords.Notethatthe lastlineoftheparagraphisexcludedfromthis process. Bothwordwrapandrightjustificationcanbeswitchedoffby selectingtheappropriateentriesintheStylemenu,allowing longlinesandleftjustifiedtext. Notethat1st Wordwillscrollthetextthroughthewindow foryouautomaticallywheneveryouapproachtherightor bottomedgeofthewindow.Notealsohowthewhitesliders inthescrollbarscorrespondtothescrollingmovement. Finally,toendthisbriefexample,trychangingyourtext styleasyoutypebyusingthefunctionkeysoriconsmarked F1toF4toswitchthevariousstylesonandoff.Further textstyleoptionsareavailableusingtheStylemenu. Experimentwithpotentialstylecombinationstodiscover theireffect. 2.8 SavingtheDocumentFileonDisk  TosavethedocumentfileondiskmovethemousetotheFile menuandselecttheSaveoption.Thiswillsaveyour document(inthiscaseTEST.DOC)ondiskandwillclosethe documentwindow. 2.9 EditingaDocumentFile  Inthissectionyouwilldiscoverthebasicfunctionsusedin editingadocumentfile.Moreadvancedfunctions(suchascut andpaste)areexplainedlater. ToeditadocumentmovethemousetotheFilemenuandclick theOpenoption.ThiswilldisplaytheGEMItemSelectoryou usedwhencreatingadocument(inSection2.5). ThedirectorywindowshouldcontaintheentryTUTORIAL.DOC whichisthedocumentfileyouaregoingtoedit.Select thiseitherbyclickingthemouseonthedirectorywindow entryfollowedbyaclickontheOKbutton,oradouble-click onthedirectorywindowentry. 2.10 ScrollingThroughtheDocument TUTORIAL.DOCshouldnowbedisplayedinthetextwindow. Thisdocumentismuchlargerthanthewindowareasoyouwill needtoscrolltoviewitall.Thisisachievedusingthe GEMscrollbarsattherightandthebottomofthetextarea. Thewhiteslidersinthescrollbarsrepresentthevisible portionofthedocumentasfollows: *theverticalslidershowsthesizeandverticalposition ofthetextarearelativetothesizeofthewhole document, *thehorizontalslidershowsthehorizontalpositionof thetextarearelativetoamaximumlinelengthof160 characters. TryscrollingthedocumentusingtheGEMscrollbars, observingtheeffectsonthetextwindow,slidersandcursor position: *clickingthearrowboxesscrollsverticallybyoneline atatimeandhorizontallybyfivecharactersatatime, *clickingtheshadedareasscrollsbothverticallyand horizontallyone'screenful'atatime, *draggingtheslidersmovesthewindowtextareathrough thedocumenttothepositionindicated. Notethatittakesalittlewhiletodragtheverticalslider fromoneendofthedocumenttotheother - thisdelaywill increasewiththesizeofyourdocument. 2.11 PageBreakDisplay Examinethepagebreakdisplaytotheleftofthewindow whileyouscrollthetext.Youwillnoticethreetypesof pagebreakindicatedbyhorizontallinesinthepagemargin: *ahardpagebreakisindicatedbyasolidline.Youcan inserttheseyourselfwiththeF7keyorbyclickingthe mouseinthepagemarginatthedesiredposition, *asoftpagebreakisindicatedbya50%dashedline. Theseareinsertedautomaticallyby1st Wordwhenthe maximumpagelengthisexceeded. *aconditionalpagebreakisindicatedbya25%dashed lineaccompaniedbya25%dashedverticalline indicatingthescope.If1st Worddecidestoinserta pagebreakwithinscopeoftheconditionalthenthenew pagenumberisinsertedatthestartandthedashes increaseto75%. Ifyouareusingahighormediumresolutionmonitor,page numbersarealsoindicatedintheappropriatepositions withinthepagemargin. 2.12 PositioningtheCursor Tochangethetextinadocumentbydeletingorinserting characters,itisnecessarytomovethecursortothedesired position.Thiscanbeachievedinthreeways: *pointthemouseatthedesiredpositionandclick, *usethefourcursorkeys(markedwitharrows)tomove thecursorinthedirectionindicated, *presstherightorleftcursorkeywhentheCONTROLkey ishelddowntomovethecursorhorizontallywholewords atatime. Experimentwithcursorpositioning.Youwillnoticethatit ispossibletoscrollthetextbyattemptingtomovethe cursoroutofthevisibletextareawiththecursorkeys(but notwiththemouse). Notethatscrollingasaresultofcursormovementcannot keepupwithareasonableauto-repeatratefromthekeyboard. Thisisnotabugin1st WordbutafeatureofGEM(thereis nowaytoinhibitkeyboardbuffering),soyoushouldavoid usingkeyboardauto-repeatwhenscrollingtext. 2.13 DifferentTypesofSpaces Youwillhavenoticedwhenmovingthecursorhorizontally acrosswhitespaceinthetextthatitwilloccasionallyjump overoneormorespacepositions.Thisisbecausethereare fourdifferenttypesofspacethatarevisibleonthescreen: (a) VariableSpace Whenyoupressthespacebaravariablespaceis insertedintothetext.Thisspacemaybestretchedby 1st Wordduringtheprocessoflinejustification.You canalwaysplacethecursoronavariablespace. (b) StretchSpace Whenalineisjustifiedonthescreen,oneormore stretchspacesmaybeinsertedafteravariablespace. Thesearetreatedby1st Wordaspartofthevariable spaceitself.Youarenotpermittedtopositionthe cursoronastretchspace.Notealsothatwhena variablespaceisdeleted,anystretchspacesassociated withitaredeletedaswell. (c) FixedSpace WhenyoupressthespacebarwhiletheCONTROLkeyis helddownafixedspaceisinsertedinthetext.This spaceisneverstretchedorusedasapotentialword wrappointduringlinejustification.NotethattheTAB keyalsoinsertsfixedspacesintothetextuptothe nexthorizontaltabposition.Youcanalwaysplacethe cursoronafixedspace. (d) Indents WhenyoupresstheF9keyoneormoretimesanindentis insertedintothetext.Thisissimilarinappearance toaTABbutinsertsasingleindentspacefollowedby stretchspacestothenexthorizontaltabposition.The cursorcanbepositionedontheindentspaceonlyand deletingthiswilldeletetheassociatedstretchspaces. Theindentvalueinthefirstlineofaparagraphis usedby1st Wordtodeterminethelocalleftmarginfor theparagraphduringlinejustification,theindent valueforsubsequentlinesbeinggeneratedautomatically bytheprogram.Ifmorethanoneindentappearsinthe firstline,thepositionofthelatterisused. 2.14 DeletingText Fourtextdeletionfunctionsareprovidedby1st Wordfrom thekeyboard: *theBACKSPACEkeydeletesthecharactertotheleftof thecursorposition, *theDELETEkeydeletesthecharacteratthecursor position, *pressingDELETEwhentheCONTROLkeyishelddown deletesfromthecursorpositiontotheendoftheword, *theF6keydeletestheentirelinecontainingthe cursor. Muchlargerunitscanbedeletedusingthecutandpaste functionsdescribedlater. Afewpointstoremember: *bewarekeyboardauto-repeat,especiallywhenusing deleteline(F6), *bewarewhendeletingindentsandstretchedvariable spacesbecauseallthestretchspacesaredeletedtoo. Experimentwiththedeletefunctionsuntilyouarefamiliar withtheiroperation. 2.15 TextInsertandOverwriteModes Whenediting,itispossibletoenternewtextintoa documentinoneoftwomodes: *textinsert modeisthedefaultcondition,characters areinsertedatthecursorpositionwithoutdestroying theexistingtext, *textoverwrite modeisthealternativecondition.New textiswritten"ontopof"theexistingtextatthe cursorposition(exceptatendoflineordocumentwhen itisinsertedasusual).TABandRETURNkeysinthis modesimplymovethecursorwithoutinserting. YoucanswitchbetweenthesemodesbyusingtheF5keyor iconorbyusingtheInsertmodeentryintheEditmenu. 2.16 ParagraphFormatting TUTORIAL.DOCcontainsmanydifferentstylesofparagraphs, eachofwhichdescribeshowitwasformatted.Thissection describesthegeneralrulesforformattingparagraphswithin 1stWord: (a) Justification Aparagraphcaneitherberight justified(textis alignedontherightmarginbyinsertingstretchspaces) orleft justified(textisflushedleftwithnostretch spaces).Ineithercasenolineisallowedtoexceed therightmargin. Toswitchrightjustificationonandoff,selectthe JustifyoptionfromtheStylemenu.Notethattheentry ischecked(ticked)whenrightjustificationison. Whenyouaretypinganewparagraph,justificationis automaticandnospecialactionisrequired(otherthan settingtherequiredjustificationstyle).However,if youchangeeitherthejustificationstyleorcontentsof aparagraphyouwillneedtoreformatitbyusingthe F10keyoriconwhenthecursorisinthefirstline. (b)  IndentingtheWholeParagraph Toindentthewholeparagraphbythesameamountusethe F9keyoricontospecifytheindentsizebeforetyping theparagraph. Indentsarerememberedby1st Wordsoyoudonotneedto respecifythemwhenyoureformataparagraphunlessyou wanttochangetheindentsize.Tochangethesizeof anindentusethedeletionand/orindentfunctionsas requiredonthefirstlineoftheparagraphandthen reformatit. (c) IndentingtheFirstLineofaParagraph Toindentthefirstlineofaparagraphbyalarger valuethantheremaininglinesusefixedspaces (generatedbytheTABkeyorCONTROLkeyplusspacebar) afteranyindentandbeforethefirsttextcharacter. (d) HangingIndents(Outdents) Thisstylehasthefirstlineatstandardlengthwith subsequentlinesfurtherindented.Justifythetext withtheinitialindent(ifany),thenonthesecond lineinsertanextraindentandreformat.Thisstyleis notpreservedbyareformatfromthefirstline. (e) NumberedParagraphs Thisstyleisobtainedbytypingtheparagraphnumberor letterfollowedbyoneormoreindentsbeforethefirst textcharacter.Subsequentlineswillbeleftaligned ontheindent. Experimentwiththesebasicstylesandinventsomeofyour own. Although1st Wordisverygoodatrememberingthestylewhen youreformataparagraph,hangingindentsandcentered paragraphswillrequiremanualinterventionfromyou.You shouldalsoconfirmwhetheranyspecialformattingstyles thatyouhaveinventedrequiremanualinterventionwhen reformatting. 2.17 SavingtheDocumentFilewithaNewName Youhavenowlearnedhowtousemostofthebasicfeaturesof 1st Word,soTUTORIAL.DOCisnowreadytobesavedondisk. Evenintheunlikelyeventthatyouhavemadeacompletemess oftheediting,youroriginalversionofTUTORIAL.DOCwill notbedestroyedbecause1st Wordwillrenamethisto TUTORIAL.BAKforsecurity. Alternatively,youcansavetheeditedversioninanewfile inwhichcasetheoriginalversionretainsitsoriginalname. SelecttheSaveasentryintheFilemenuwhichwilldisplay aformcontainingthecurrentname(TUTORIAL.DOC).Youcan editthisfieldtogivethedocumentanewname(sayNEW.DOC) andthenclickonOK. 1st Wordwillsavethedocumentwiththenewfilenameand closethewindow,returningtothestartupscreen. 2.18 HowtoExitFrom1stWord Toexitfrom1st WordyoumustfirstselectSaveorSave as fromtheFilemenutocloseyourdocumentandreturntothe startupscreen.ThenselectQuitfromtheFilemenuto returntotheGEMDesktop. Thisendsthetutorialsectionofthemanual. 3 1STWORDUSERINTERFACE Thischapterdescribesthemajorcomponentsofthe1st Word userinterfaceingeneralterms. 3.1 TypingandEditing 1st Wordhasbeendesignedfortwomodesofoperation: (a) Typing Whenyouarecreatingadocumentforthefirsttimeor addingnewtexttoanexistingdocument,itisusualto operate1st Wordintypingmode,usingonlythemain QWERTYkeyboardandthe10functionkeyswhoseactions aredisplayedpermanentlyatthebottomofthescreen. Thefunctionkeycommandshavebeenchosentomaximize efficiencybyensuringthatyourfingersrarelyneedto leavethekeyboardwhenoperatingintypingmode. (b) Editing Whenyouhavecreatedadocument,youwillusuallyneed tochangeitatleastoncetocorrectstyle,spellingor grammarortorearrangethedocumentcontents. Ineditingmodeitisunusualtochangemorethana smallportionofthetext,thebulkoftheediting processbeingscrolling,searching,stylechangesand blockmovementoperations,wherecontinuoususeofthe keyboardisnotnecessary.Therefore1st Wordhasbeen designedtoenableeditingtobeachievedalmost entirelybyuseofthemouse.  Notethatthereisnoformaldistinctionbetweenthetwo modes(norarethereanycommandsprovidedtoswitchbetween them).Thedistinctionispurelyoneofoperation.Ifyou haveneverusedamouse-drivencomputerbefore,wesuggest thatyoutrythesuggestedmethodfirstbeforeselectingyour ownoperationalstyle. 3.2 WPMode TextcanbeenteredoreditedwithWPModeonoroff.This tells1st Wordwhethertostorespecialstylecodesinyour textortoproducepureASCIIfiles.SwitchWPModeonfor wordprocesseddocumentsandoffforprogramsourceordata files.1st Wordwillusuallydefaulttothecorrectmodefor thefileyouedit(see5.1fordetails). 3.3 Keyboard TheSTkeyboardisaverygoodexampleofamoderncomputer keyboard.Itslightactionandaudiofeedbackoptionenable veryfasttypingspeedstobeattained,comparablewiththe bestelectronictypewriters. Thekeyboardisdividedintofourareas: *theQWERTYbankisusedfortypingintheusualway, *thefunctionkeysareusedtoactionasubsetoftheWP stylecommands, *thecursorkeysareusedtomovethetextcursoraround thedocumentwindow, *thenumerickeypadisnotparticularlyusefulforWP, butcanbeusedtoenterlongstringsofnumbers. WiththeexceptionofALTERNATE,CAPSLOCK,CONTROLand SHIFT,allkeysonthekeyboardwillauto-repeatifhelddown forashortwhile.Thisisnotalwayssynchronizedwiththe screenupdateandyoumayfindthatthekeyboardwill occasionallyraceaheadofthescreen,especiallywhenyou areforcingthescreentoscroll. 1st Wordallocatesspecialfunctionstocertainkeysandkey combinations: * INSERT insertline * CONTROL+SPACE fixedspace * CONTROL+or moveleftorrightoneword * CONTROL+DELETE deletefromcursortoendofword NoactionisperformedbytheHELP,UNDOorCLR/HOMEkeys. 3.4 FontTable NotalloftheST's256charactersetisavailablefromthe keyboard,andtheparticularcharactersavailablewilldiffer fromcountrytocountry.Toremedythis,1st Wordprovidesa fonttableonthedesktop.(Highandmediumresolutiononly.) Toselectacharacterfromthedesktop,dragtheGEMsizebox atthebottomrightofyourdocumentwindowtorevealthe fonttable.Thenselectthecharacteryouwantbyclicking themouseattheappropriatepositionand1st Wordwillcopy thecharactertoyourwindowatthecurrentcursorposition. 3.5 FunctionKeyIcons 1st Wordprovides10functionkeyiconsatthebottomofthe screen.(Onlyinhighandmediumresolution.)Theseare providedforthreepurposes: * asavisualreminderoftheactionsoffunctionkeys, *asavisualreminderofthestatusofsomeofthestyle functions, *asanalternativetothefunctionkeysduringeditingby clickingtherequirediconwiththemouse. NotethattheF1-F5iconsaretoggleswhichareshownin reversevideo(whiteonblack)iftheeffectisinforce. 3.6 Drop-downMenus Sixmenuheadingsareshownatthetopofthescreen: (a) Atari 1st WordprograminformationscreenandyourSTdesk utilities. (b) File Fileopenandclosefunctionsanddocumentlayout commandsthathavescopeacrossanentirefile. (c) Edit Texteditingmodeselectionandsearch,replaceand positionmarkerfunctions. (d) Block Textblockmanipulationfunctionsforcutandpaste operations. (e) Style Commandsthataffectlocaltextstyleandformatting. (f) Help Briefhelpscreens,displayedeitherondemandor automaticallywhenadrop-downmenuitemisselected. Atcertainstagesduringaneditsomeofthemenufunctions willbeinvalid(showninlightface).Ifamenuentryisa togglefunctionitwillbechecked(ticked)wheninforce. 3.7 EditWindows  Typingandeditingisperformedineditwindows.Youcan openuptofourwindows,enablingcutandpasteoperations betweendocuments.Toswitchwindows,clickthemouseatany pointinthetargetwindowtomakeitthecurrentwindow.  Windowscrollingandsizeandpositionmanipulationcanbe performedbyusingthemouseintheeditwindowborder: (a) VerticalScrolling Textinthewindowcanbescrolledverticallywiththe verticalscrollbartotherightofthewindow: *clickthearrowstoscrollalineatatime, *clicktheshadedareastoscrollapageatatime, *dragthewhitesliderbartotherequiredposition. (b) HorizontalScrolling Textinthewindowcanbescrolledhorizontallywiththe horizontalscrollbaratthebottomofthewindow: *clickthearrowstoscroll5characterpositions, *clicktheshadedareastoscrollapageatatime, *dragthewhitesliderbartotherequiredposition. (c) SizingtheWindow Theeditwindowcanhaveitssizechangedasfollows: *clicktheGEMfullboxinthetoprightcornerto expandtofullsizeorshrinktooriginalsize, *dragtheGEMsizeboxinthebottomrightcornerto changethehorizontalandverticaldimensions. (d) MovingtheWindow Dragthewindowtoanewpositionusingthetitleline. (e) ClosingtheWindow Theeditwindowcanbeclosed(andtheeditabandoned) byclickingtheGEMcloseboxatthetopleftcorner. Inadditiontowindowmanipulationfunctions,paginationand rulerfunctionsarealsocarriedoutinthewindowborders. 3.8 Pagination 1st Worddisplayspagebreaksandactionspaginationcommands intheleftmarginoftheeditwindow.Threetypesofpage breaksarerecognizedby1st Word: (a) HardPageBreak Ahardpagebreakisalwaysinsertedbytheuserandis indicatedbyasolidhorizontallinewiththenewpage numberdirectlybeneathit. Youcansetorclearthesebyclickingthemouseinthe leftmarginatthedesiredposition.Ahardpagebreak canalsobeinsertedabovethelinecontainingthetext cursorwiththeF7keyoricon. (b) ConditionalPageBreak Aconditionalpagebreakwithadefinednumberoflines ofscopeisalsoinsertedbytheuser.Itisusedto protectagroupoflinesthatyoudonotwishtobe splitacrossapageboundary.Ifthescopeofthe conditionalbreakspansapotentialpageboundarythena newpageisinsertedatthestartpositionofthescope. Aconditionalpagebreakiscreatedbydraggingthe mousedownintheleftmargintoindicatethescope. Thiscansubsequentlybeincreasedordecreasedinscope bydraggingtheendpositioninthedesireddirection, ordeletedbyclickingthemouseatthestartposition. If1st Wordinsertsapagebreakatthestartposition, theconditionalbreakisdisplayedasa75%dashed horizontallinewiththenewpagenumberdisplayed directlybeneathit.Otherwisetheconditionalpage breakisdisplayedasa25%dashedlinewithnopage number.Ineithercasethescopeisdisplayedasa verticallineinamatchinglinestyle. (c) SoftPageBreak Asoftpagebreakisinsertedbythe1st Wordprogramif youhaveexceededthetotalnumberoflinespermittedon apageandisindicatedbya50%dashedhorizontalline withthenewpagenumberdirectlybeneathit. Youcanconvertthesetohardpagebreaksbyclickingat theappropriatepositioninthemargin. Notethatthetotalnumberoftextlinesonapageisdefined globallyforadocumentbyusingtheLayoutcommandinthe Filemenu. 3.9 RulerLine Therulerlineisdisplayedimmediatelybeneaththedocument titleandisusedtoindicateandchangethemarginandtab positionsforformattingthedocument.Ifyouchangethe rulerline,onlythoseparagraphsyoutypeorreformatafter thechangewillbeaffected. ThedefaultrulerlineissetupforPicapitch(10cpi)on 81/2by11inchpaperandallows66characterpositionsper linewithtabpointsevery5characters. Therulerlineismodifiedbyuseofthemouseasfollows: (a) TabPoints Tabpointsareusedtodeterminehowmanyfixedor indentspacestoinsertwhenusingtheTABandF9keys.  Tabpointscanbesetandclearedbyclickingthemouse intherulerlineatthedesiredposition. (b) LeftMargin Itisneitherpossiblenornecessarytochangetheleft margininadocument. Theeffectiveleftmarginpositioncanbechangedeither byusingindentsinthedocumentorbyspecifyingapage offsetatprinttime. (c) RightMargin Therightmarginisusedtoindicatewherewordwrapand rightjustificationoccur. Youmaychangetherightmarginbydraggingitwiththe mousetothedesiredposition.Tosetarightmargin outsidethecurrentwindowarea,youmustfirst horizontallyscrollthewindow. TherulerlineineffectwhenyouSavethedocumentwillbe storedtogetherwiththetext(WPmodeonly).Thestored rulerwillberedisplayedwhenyounextOpenthedocument. 3.10 DocumentSizeRestrictions Ona520STwiththeoperatingsysteminROM,thereisenough spacetoeditadocumentofaround80pages.Thisreducesto around40pagesonearlysystemswithaRAMbasedoperating system.1st Wordwillwarnyouwhenyouarerunningshortof spaceinRAMorondisk. 4 ATARIMENU Menuentriesendingwith"..."invokeadialogue,othersare actionedimmediately. 4.1 1stWord... Thisfunctiondisplays1st Wordprograminformationincluding theauthors'namesandprogramrevisionnumber.ClicktheOK buttontocontinue. 4.2 DeskUtilities TheremainingitemsintheAtarimenuarethedeskutilities thatwereloadedwithyourversionoftheSToperatingsystem whenyoubootstrappedthesystem. Anynumberofdeskutilitiesmaybestartedorquitduring 1st Wordoperationwithoutaffectingyourtext(providedthat yourdeskutilitiesarewellbehaved)!Thisisbecausethey areallocatedmemorywhenyoubootstrapthesystemanddonot grabanymorewheninvokedfromthedrop-downmenu. 5 FILEMENU Menuentriesendingwith"..."requireadialogue,othersare actionedimmediately. 5.1 Open... ThiscommandinvokestheGEMItemSelectortoselectafile forediting(uptofourdocumentscanbeeditedatonce). TheItemSelectorhasthreefieldswhichyoucanmodify(use thecursorkeysorthemousetoselectthefields): (a) DirectoryLine Thisfieldholdsamasktodeterminewhichfilesare displayedinthedirectorywindow.Bydefaultthiswill besettodisplayallthe.DOCfilesonthediskfrom whichyouloaded1st Word,forexampleB:\*.DOC.Ifyou editthismasktochangethefilesdisplayedinthe directorywindowyoumustalsoclickthemouseinthe directorywindowtodisplaythenewlist. (b) DirectoryWindow Thisdisplaysallthefilesmatchingthedirectoryline maskandcanbescrolledjustlikeaGEMDesktopwindow. Clickonanentryinthiswindowtocopyittothe selection lineordouble-clickanentrytoopenitfor editing.  Notethatifafolderisdisplayedinthiswindowits contentscanbedisplayedbyclickingit.Thishasthe sideeffectofupdatingthedirectorylinemask. (c) SelectionLine Thisdisplayseitherthelastfileyouopenedorthe fileyouhavejustselectedfromthedirectorywindow, andyoucaneditthislineifyouwishtochangethe name.Whentheselectionlinecontainsthefilenameyou want,clicktheOKbuttonorpresstheRETURNkey. Ifyouhaveselectedafilenamethatdoesnotexist, 1st Wordwillconfirmthatyouwishtoopenanewfile. Afteryouhaveselectedthefiletoopen,1stWordwill createaneditwindow,readthetextfromdiskintomemory anddisplaythestartofthedocumentintheeditwindow. Ifthefilehasa.DOCextensionorifrulerandpagination dataareheldinthetext,thefileisopenedinWPmode. Otherwiseitisopenedinnon-WPmode. 5.2 Print... Usethiscommandtoprintadocumentfileafteryouhave savedittodisk.Youcanonlyprintafileifthereareno editwindowsopen,otherwise1st Wordwillissueanerror prompt. ThePrintcommandwilluseeithertheinstalleddotmatrix printerdriverortheinstalleddaisywheelprinterdriver, dependingonthestatusoftheInstallPrintermenu.(See AppendixAfordetailsofprinterdriverinstallation.) WhenyouprintadocumentthePRINTFILEformisdisplayed. Thisasksanumberofquestions: *startandendpagenumbers, *pagenumberoffsettobeaddedtothepagenumbers generatedinthedocument, *leftmarginoffsettofurtherindentthedocumentat printtime(tocopewithsheetandtractorpaperfeeds), *swapleft&rightheadingsonalternatepages.Ifthis optionisselected,evennumberedpageswillhavethe leftandrighthandcomponentsoftheheadandfoot linesinterchanged, *printquality.Ifyouhaveinstalledandselecteda near-letterqualitydotmatrixprinterthendraftorNLQ printingisselectedbythisoption. Ifyouhaveinstalledandselectedadaisywheelprinter thenselectingNLQmodewillmaketheprinterpause wheneveritisaskedtoprintitalicorlighttext.The printerdriverwillpromptyoutochangedaisywheelsat eachstylechange. Whenprinting,1st Worddisplaysasmallwindowwhosetitle lineshowstheprintertype.Thiswindowdisplaysthename ofthefilebeingprintedandtheprintquality. Topauseprinting,holdthemousebuttondownuntilthe pointerappears.Torestartprintingclickinthewindow. Toabandonprintingclickintheclosebox. 5.3 Save  Thiscommandwillwritethecontentsofthecurrentedit windowtodiskwiththesamefilenameastheoriginalfile, afterfirstrenamingtheoriginalwitha.BAKextension.The editwindowisthenclosed. Ifthereisnotenoughspaceonthediskwhenyousavethe file,analertwillbedisplayedsayingthatthediskis full.Thefileisnotsaved,andyouhaveanopportunityto deletefilestomakespace,oryoucanchangedisksifyou wishandthensaveontoanotherdisk. 5.4 Saveas... Thiscommandpromptsforanewfilenameandthenwritesthe contentsofthecurrenteditwindowtodiskwiththefilename specified.Ifafilealreadyexistswiththesamenameit willberenamedwitha.BAKextension.Theeditwindowis thenclosed. 5.5 Layout... Thiscommanddisplaysaformthatallowsyoutospecifythe runningheadandfootlinesandpagelayoutforadocument: (a) HeadLCandR Thesefieldsspecifytheleftaligned,centeredand rightalignedcomponentsoftherunningheadlinethatis outputatthestartofeachpage. (b) FootLCandR Thesefieldsspecifytheleftaligned,centeredand rightalignedcomponentsoftherunningfootlinethatis outputattheendofeachpage. Notethatahashcharacter(#-ASCIIhexadecimal23)placed inanyofthesixheadorfootlinefieldswillbereplacedat printtimebythepagenumber. (c) Paperlength Totallengthofthepaperinlines(defaultvalue66). (d) TOFmargin Numberoflinesbetweentopofformandtheheadline excludingtheheadline(defaultvalue1). (e) Headmargin Numberoflinesbetweentheheadlineandfirsttextline includingtheheadline(defaultvalue3). (f) Footmargin Numberoflinesbetweenthelasttextlineandthe footlineincludingthefootline(defaultvalue3). (g) BOFmargin Numberoflinesfromthefootlinetothebottomofform, excludingthefootline(defaultvalue5). Values(c)through(g)canbemodifiedbyclickingthearrows asrequired.Thevaluesareusedtocalculate: (h) Lines/page Thisvalueisgivenbytheformula:h=c-(d+e)-(f+g) Alittleexperimentationwillbenecessaryforyourprinter. 5.6 Read... Thiscommandrequeststhenameofafiletobereadintothe currentdocument.Thetextisinsertedatthecurrentcursor position. 5.7 Write... Thiscommandwritesthecontentsofthecurrentmarkedblock (seechapter7)tothespecifiedfile.Allstylecommands arestrippedoutofthetext. 5.8 Delete... Usethiscommandtodeleteafilefromyourdiskifthereis insufficientroomtostoreyourdocument.Deleteinvokesthe GEMItemSelector(see5.1)tospecifythefiletodelete. Deleterepeatsdisplayingafileselectoruntilyouselect CANCEL,toallowseveralfilestobedeletedatonce. Notethatitissafetodeletetheoriginalversionofthe documentand/orthe.BAKversionprovidedyouarecertain thatyouhavenotlostanytextduringthecurrenteditand youSavethedocumentimmediatelyafterwards.  Alternatively,youcanalwaysSaveyourfiletoanotherdisk. 5.9 Quit Thiscommandhastwofunctions: (a) AbandonEdit IfQuitisusedwhenyouareeditingadocument,the currenteditisabandoned(retainingtheoriginal versionofthedocument)andtheeditwindowisclosed. (b) Quitfrom1stWord IfQuitisusedwhennodocumentsarebeingeditedor printed,1st Wordwillterminateandreturncontrolto theGEMDesktop. Notethatyoucanalsoquitadocumenteditbyclickingthe windowclosebox. 6 EDITMENU Menuentriesendingwith"..."requireadialogue,othersare actionedimmediately.TheWPmodeandInsertmodeentries willbechecked(ticked)whenenabled. 6.1 WPMode ThiscommandswitchesWPmodeonandoff. WP modeisdesignedforwordprocesseddocumentssuchas lettersorreports.SwitchWP modeontotell1st Wordto storetherulerline,paginationdataandstylechangesin yourdocument. Non-WPmodeisdesignedforprogramsourcesanddatafiles. SwitchWP modeoffforprogramsourceordatafiles,only ASCIIdataisstoredinthefile. 6.2 InsertMode Thiscommandswitchesinsertmodeonandoff. Insertmodedetermineswhethernewtextbeingenteredatthe cursorpositionisinsertedoroverwritesanyexistingtext. Notethatattheendofalineordocument,overwritemode doesallowtexttobe'inserted'.Notealsothattheaction oftheTABandRETURNkeysinoverwritemodeisoneofcursor movementonly. 6.3 Find... Thiscommandisusedtosearchforaspecifiedtextstringin yourdocument.Aformisdisplayedaskingyoutospecify: * Stringtext, * Directionofsearch(forwardorbackward), * Casematchingduringstringcomparison. Findwillsearchforthefirstoccurranceofthespecified string.Ifthestringisfound,thecursorwillbeplaced eitheronthefirstcharacterofthestring(backwardsearch) oronthecharacterimmediatelyafterthestring(forward search).  Ifthestringisnotfound,thecursorwillbeplacedatthe startorendofdocumentdependingonthesearchdirection. 6.4 Replace... Thiscommandisusedtosearchforaspecifiedtextstringin yourdocumentandreplaceitwithasecondstring.Aformis displayedaskingyoutospecify: * Searchstringtext, * Replacementstringtext, * Directionofsearch(forwardorbackward), * Casematchingduringstringcomparison. * Scopeofsearch(replaceone,someorallmatches) Ifyouhavespecifiedreplacementofoneorallmatches, Replacewillsearchandreplaceautomatically,withoutuser intervention. Ifyouhavespecifiedreplacementofsomematches,Replace willfindanddisplayeachmatchandaskyouwhetherornot toreplacethestringorcancelthesearch. Ifthesearchstringisnotfound,thecursorwillbeplaced atthestartorendofdocumentdependingonthesearch direction. 6.5 Repeatfind ThiscommandwillrepeatthelastperformedFindorReplace operation,usingthesameparametersasdefinedinthe originalcommand. IftheFindorReplacecommandterminatedatthestartorend ofthedocumentthenthesearchdirectionisautomatically reversedfortheRepeatoperation. 6.6 Setmark Usethiscommandtosetorredefineoneofthefourposition markersanywhereinyourdocument.Themarkerpositionis definedbythecurrentcursorposition.  6.7 Gotomark Usethiscommandtomovethecursortooneofthepreviously definedpositionmarkers. 7 BLOCKMENU Thesecommandscreateandmanipulatetextblocksusedincut andpasteoperations.Thesearevariablelengthtext strings,highlightedbyastippledbackground(monochrome monitor)orfluorescentyellowbackground(colormonitor). Eachdocumentopeninawindowmayhaveoneandonlyone blockdefinedatanytimeanddefiningasecondblockwill causethefirsttobehidden.Althoughblockstartandend positionsmustbewithinthewindowwhentheyaredefined, 1st Wordwillremembertheblockpositionwhenitisscrolled offthescreen. TheBlockmenucommandsgiveyoutheflexibilitytocreate irregularshapedblocksbydefiningthestartandend positionsinseparateoperations.Amoreconvenientmethod fordefiningregularshapedblocksistousearubber band asfollows: *Tomarkasectionofasinglelineasablock,pointthe mouseatthefirstcharacteranddragithorizontallyto thefinalcharacter,thenreleasethebutton. *Tomarktwoormorecompletelinesasablock,pointthe mouseatanypositioninthefirstlineanddragitto anypositioninthefinalline,thenreleasethebutton. (Itisnotnecessarytoenclosethelinesintherubber band.) Blocksdefinedinthiswaycanhavetheirstartandend positionsmodifiedbytheBlock startandBlock endcommands. 7.1 Startblock Usethiscommandtodefineorredefinetheblockstart positionatthecurrentcursorposition. 7.2 Endblock Usethiscommandtodefineorredefinetheblockendata positionimmediatelyprecedingthecurrentcursorposition. Blockstartandendpositionscanbedefinedinanyorder, butthestartpositionmustplacedbeforetheendpositionin thedocument,orthecommandisignored. Whenavalidblockisdefined,theblockbackgroundisdrawn inandwillremainuntiltheblockishiddenordeletedora Reformatcommandisactioned.  7.3 Cutblock Usethiscommandtocopythecontentsofthemarkedblockin thecurrentwindowexcludingstylecommandstothecutand pastebuffer.Theblockinthewindowremainsmarked.The textinthebuffercanlaterbepastedtoanypositionin oneoftheopendocumentwindows. 1st Wordmaintainsasinglecutandpastebuffer.Youwill bewarnedwhenyouattempttocutablockintothebufferif thecurrentbuffercontentshavenotbeenpastedtoawindow. NotethatCopyblockandMoveblockalsousethecutand pastebufferandwillchangeitscontents. 7.4 Pasteblock Usethiscommandtoinsertacopyofthecutandpastebuffer tothecursorpositioninthecurrentwindow.Thetextin thebufferremainsintact,soyoucanpasteittomorethan onepositionordocument. 7.5 Copyblock Usethiscommandtoinsertcopiesofthemarkedblocktothe currentcursorpositionwithinthesamewindowandthecut andpastebuffer. Themarkedblockremainsunaffected,butthecopiedtexthas allstylechangesremoved. 7.6 Moveblock  Usethiscommandtoinsertcopiesofthemarkedblocktothe currentcursorpositionwithinthesamewindowandthecut andpastebuffer. Themarkedblockisdeletedandthecopiedtexthasallstyle changesremoved. 7.7 Deleteblock Usethiscommandtodeletethecontentsofthemarkedblock. Thecontentsofthecutandpastebufferareunaffected. 7.8 Findstart Thiscommandmovesthecursortothestartofthemarked block.Thecontentsofthecutandpastebufferare unaffected. 7.9 Findend Thiscommandmovesthecursortotheendofthemarkedblock. Thecontentsofthecutandpastebufferareunaffected. 7.10 Hideblock Thiscommandremovestheblockmarkersandthestippledor coloredbackgroundfromthemarkedblock.Thecontentsof thecutandpastebufferareunaffected. 8 STYLEMENU TheStylemenuisusedtodeterminethecharacterstyleand textformattingparameters.Allstylecommandsareactioned immediately. 8.1 Bold Usethiscommandtoselectorturnoffboldfacecharacters beforeyoutypeandbeforeaRestylecommand.TheF1icon displayisinverted. ThiscommandhasanidenticaleffecttotheuseoftheF1key oricon. 8.2 Underline Usethiscommandtoselectorturnoffunderlinedtextbefore youtypeandbeforeaRestylecommand.TheF2icondisplay isinverted. ThiscommandhasanidenticaleffecttotheuseoftheF2key oricon. Notethatunlikemostwordprocessors,1st Wordcorrectly underlineswholeparagraphs,bothonscreenandinthe printedoutput,includingstretchedspacesbutexcludingthe paragraphindent!  8.3 Italic Usethiscommandtoselectorturnoffitaliccharacters beforeyoutypeandbeforeaRestylecommand.TheF3icon displayisinverted. ThiscommandhasthesameeffectasusingtheF3keyoricon. Becausethefinalitaliccharacterinastringoverlapsthe nextcharacterpositionitisagoodideatofinishanitalic stringwithanitalicspace.Thisitalictrailingspace ensurescorrectscreendisplayofitalictext. 8.4 Light  Usethiscommandtoselectorturnofflightcharacters beforeyoutypeandbeforeaRestylecommand.TheF4icon displayisinverted. ThiscommandhasthesameeffectasusingtheF4keyoricon. 8.5 Super Usethiscommandtoselectorturnoffsuperscriptcharacters beforeyoutypeandbeforeaRestylecommand. 8.6 Subscript Usethiscommandtoselectorturnoffsubscriptcharacters beforeyoutypeandbeforeaRestylecommand. 8.7 Restyle Otherthandeletionandretyping,thiscommandistheonly methodprovidedby1st Wordtochangetextstyle. Convertthestringyouwishtorestyleintoamarkedblock usingarubberbandortheStartblockandEndblockcommands describedinChapter7.Nextselectthestylecombination youwantusingthefunctionkeys,functionkeyiconsorthe Stylemenu.FinallyclicktheRestylemenuentrytocomplete theoperation. 8.8 Justify Usethiscommandtotell1st Wordwhethertoleftjustifyor rightjustifyyourparagraphs.IfJustifyisswitchedon, themenuentryischecked(ticked)andparagraphswillbe rightjustified. 8.9 Wordwrap Usethiscommandtotell1st Wordwhethertowrapwordsonto thenextlinewhenyouexceedtherightmargin.IfWordwrap isswitchedon,themenuentryischecked(ticked)andwords arewrappedattheendofline,otherwisetherightmarginis releasedandyoucancontinuetypingonthesamelineuntil youpressRETURNorreachthe160characterlimit. 8.10 Spacing Usethiscommandtotell1st Wordwhethertousesingleor doublelinespacing.IfSpacingisswitchedon,themenu entryischecked(ticked)andlinesaredouble-spacedwhen youtypeorreformatparagraphs.Thedefaultconditionhas Spacingswitchedoffandsinglelinespacing. 8.11 Center Usethiscommand(ortheF8keyoricon)tocentertheline containingthecursorbetweenthemarginswithequalspacing ontheleftandright. 8.12 Indent Usethiscommand(ortheF9keyoricon)toindentyourtext byoneormoretabstopsforthedurationofaparagraph. Thetabpositionsaretakenfromtherulerline.  Atthestartofeachparagraph,Indenttotherequired positionthensimplytypethetext.Whenwordwraptakes place1st Wordwillautomaticallyindentthenextline.When youpressRETURNattheendoftheparagraph,theindentis cancelled. 1st Wordremembersindentvalues,soyouwillnotneedto respecifythemwhenreformattingafteratextchange. Ifyouwanttochangetheindentvalue,movethecursorto thestartofparagraph,theneitherdeletetheindent(be careful,onlyonekeystrokeisrequired)oraddtothe indentvalueandReformattheparagraph. Theindentneednotbeplacedatthestartofalineandyou canevenhavemorethanoneindentinthesameline. 1st Wordwillalwaysalignsubsequentlinesonthefinal indentdetected.(Section2.16containsdetailsofusing indentstocreatethemostcommonlyusedparagraphstyles.) 8.13 Reformat Alwaysusethiscommand(ortheF10keyoricon)toreformat aparagraphifyou: * changethetextbydeletionorinsertion, * changetheindentvalueorstyle, * changethejustificationmode, * changetherightmargin. Youwillnotneedtoreformatifyouhaveonlychangedthe textstyle. 9 HELPMENU Thehelpmenuisprovidedtogiveyoubriefnotesonprogram operationwhileyouarestilllearning1st Word.AllHelp functionsgenerateahelpwindowandyoumustclickOKto removethem. 9.1 Extrahelp Ifyouselectthisoption,1st Wordwillgenerateahelp windowwheneveryouuseamenufunction.Thehelpwindow informsyouwhatthecommandwilldoandgivesyoutheoption ofproceeding(clickOK)orcancelling(clickCANCEL). Thisfeatureisrecommendedforyourinitialsessionswith 1st Word. 9.2 OtherHelpScreens Theremaininghelpscreensprovidegeneralinformationabout thoseaspectsof1st Wordoperationnotfullycoveredbythe Extrahelpmenus. A PRINTERDRIVERS Thischaptertellsyouhowtocreateandinstallprinter driversfor1stWord. Installingaprinterdriverisacomplexoperationrequiring greatattentiontodetailandadegreeoftrialanderror. However,thismethodprovidesthegreatestpossible flexibility,andyoucanbesurethatthedriveryouproduce willmatchyourprinterexactly. Thetemplatepatchfilessuppliedfordotanddaisywheel printershavetheircodesdefinedinhexadecimal.Youshould ensurethatalistofyourprinter'scontrolcodefunctions inhexadecimalisavailable,beforeattemptingtoinstalla specialprinter. A.1 StandardPrinterDrivers 1st Wordissuppliedwithpatchtemplatesforthesestandard printerdrivers: * ASCIIonlydrivertodriveanyprinter, *EpsonLX-80,EpsonRX-80andAtariSMM804dotmatrix printerdrivers, *QumeSprintseriesandBrotherHR-15/25series daisywheelprinterdrivers. Onthe1st Worddisksupplied,theinstalleddotmatrix driver(1ST_PRNT.DOT)isconfiguredforASCIIoperationand theinstalleddaisywheeldriver(1ST_PRNT.DSY)isconfigured forQumeoperation. Evenifyouhaveoneofthestandardprinters,itmaybe necessarytomodifytheprinterconfigurationfile.For example,ifyouuseanon-standardpaperlength(1st Word assumes11inchpaper),itmaybenecessarytoincludea commandintheprinterverticalinitializationsequenceto makeformfeedsworkproperlywithatractorfeedinstalled. A.2 CreatingaNewPrinterDriver Thefolder\PRINTER\containsthesourcesofthepatchfiles forthestandardprinters(theseareheavilycommentedand shouldbeself-explanatory): ASCII.HEX ASCII-onlyprinter BRO_HR15.HEXBrotherHR-15/25daisy EPS_LX80.HEX EpsonLX80NLQmatrix EPS_RX80.HEX EpsonRX/FX-80matrix QUME .HEX QumeSprintdaisy SMM804.HEXAtariSMM804matrix Use1st Wordtoeditthefileclosesttothespecificationof thetargetprinter,thenuseSaveastogivethenewfilea uniquenamewitha.HEXextension. LinesintheHEXfilestartingwithanasterisk(*)are comments.Forexample,therearesomecommented-outentries intheEpsonRX-80fileforcommandssupportedbytheFX-80, removetheasteriskstoinstallthesefeatures. A.3 InstallingaNewPrinterDriver Toinstallanewprinterdriver,selectthe\PRINTER\folder andruntheprogramINSTALL.PRGwhichdisplaystheGEMItem Selector.Selectyournew.HEXfile. INSTALL.PRGwillreadyourfileandcreateeither 1ST_PRNT.DOTor1ST_PRNT.DSY(dependingonwhetheryouare creatingadotmatrixordaisywheeldriver). Havingcreatedyournewdriver,youmustcopythenew.DOTor .DSYfiletothe1st Wordrootdirectory(aftersavingthe currentversionifrequired).Ifyouareusingasingle-disk systemyoumustalsocopythisontoyourdatadisk(s)as definedin1.5. B 1STWORDDATAFORMAT AppendixBisprovidedforprogrammerswhointendtoprocess the1st Wordtextfilesforinputtoothercomputer applications(suchasspellingcheckers,typesettingfront- endsystems,databasesorelectronicmailsystems). GSTreservestherighttoenhanceandupdatethisdataformat withoutnotice,thoughwewillattempttousethoseareas definedas"reservedforexpansion"whereverpossible. Companiesintendingtoproducecommercialsoftwareproducts basedon1st WorddataformatsareurgedtocontactGST directlyfornewsofpotentialupdatestothedataformat. Nochargewillbemadeforreasonableuseofthisservice. Pleasecontact: GSTSoftware TheGreen Willingham  CAMBRIDGE CB45JA England B.1 CharacterSet 1st WordusesthefullSTstandard256-codecharactersetas showninthefonttableonthe1st Worddesktop.Ofthese,a numberofthecontrolcodesintherange00to20hexadecimal areusedforspecialpurposes. Enhancementsto1st Wordwillalmostcertainlyusemorecodes inthisrange,andprogrammersarerecommendedtoregardthe entirecontrolcoderangeasreservedforexpansion. Theremainingcodesintherange21toFFhexadecimalare definedtobeprintingcharacterswithnospecialsemantics. 1st Wordwillemployidenticalcoderangesformultiplefonts whentheseareimplemented. B.2 ControlCodes  Regardthisentirerangeasreserved: Code Display Data Function  00 Null:reserved 01  02  03  04  05  06  07  08  09 Tab:reserved 0A Linefeed 0B 1 Conditionalpagebreak 0C Formfeed 0D Carriagereturn 0E  0F  10  11  12  13  14  15  16  17  18  19  1A 1B 1 Stylechange 1C Stretchspace 1D Indentspace 1E Variablespace 1F N Formatline 20 Fixedspace Notes: (1)Thenumberofdatabytesthatfolloweachcontrolcode isshowninthe"Data"column. (2)Formatlinescontainrulerandlayoutdata.Ignoreall datauntilendofline. Hx4NXN^NuNVC 0n&2A T"H0n"2A X"H0n2A \"H0n2A P"H0n2A C 0n2A C 0n2A C0n 2HxINXN^NuNVC 0n&2A T"H0n"2A X"H0n2A \"H0n2A P"H0n2A C 0n2A C 0n2A C0n`&o + ЫЫO// Bg?<JNA IK~|NHkN~.HmN`BN9NV/HxHnHnHnHntNu m P-H/.0nC/0nC/HxHxdtNM/.Hz@tN?P/.tNNX n C g/tN9XA-HSJm8C n//. nC"_/tNyX"_2` n h /tNBX g/tN9X/./-tN?PHz/-tN3P nX//-tN3P0n gHzh/-tN3P`Hzk/-tN3P nX/ nP/HntNp /tN9XN^NuPRINTERPrinting in Letter Quality mode in Draft mode NV G=HHnHztNzPHn/.tNzDPHnHztN/.P-H g`/./HxtN| N g/.tN|PX"F-H/.tN:PX+H g\/.tN|8XN g /-//./.tNz`"/.tN5X/tNrX F=H`/HztNrP F=H`"/.tN5X/tNrX F=H/.tN2X/-/-tNAN^NutN N^NuHmtN XN^NuHmtN XN^Nu`,Nh012`tN N^NuNV G-H"nAlj` R n`HnC n P"F//-tN5 f FN^NuCf n/HntNyX"_"`tN N^NuNV n/tN "X-HCfH nX/tN "X-HCf( nP/tN "X-HC f F` G g GN^Nu nCf AN^Nu FN^NuN^NuNV/-tN4X-H`*"n G  nN^Nu nR"H n `$Nh ``N^NuNV/-tN4X-HC g nCf AN^Nu` GN^NuNVC0mB @Cf tNCB0- @Rm"H n C0m"HA  GN^NuNVAfX P-HJg` S n`tN`AfP P-H g$HmtN@XSJg tN`N^NuNVAf h g<0m/ mf"HAf h F I"_l tN`HmtN@XC0mB @CgtN^2m m~T0PmC0mRB @C0m"H G  G;HRm0mN^NuNVB- @ @B-/tNX m~\2P0m-H m~PJPg n"FN@N g F` G g nP P-H n P-H` n P-H nP P-HHn/./.tN -HHnJ nX//.tN -HHn/./.tN -H"nAf hoAf h-H/.Af h"H nʓ FNJ"_oAf h"H nʓ FNJ-HAf h"H nʓ FNJ"H nғ I-H/.Af h"H nғ nΓ nʓ I"_o$Af h"H nғ nΓ nʓ I-HAf h"H nғ nΓ nʓ n“ I-HA-HJg$ nRH0@/tNXS n`SJm tN`AJ-HJg$ nRH0@/tNBXS n`SJm tNV`A-HJg$ nRH0@/tNXS n`tNtB./tNXN^NuNV G-H n R H0@ @ gh` R n`.H0@C#f0/./.tNxPR nJg R n`` nR"H.H0@ `"n G  nN^NuNVB. @C?N@ @C0mBJfjC:0mB/C0mB @"_/C0mB @"_ g*B."@B- @N6CN@ g F` G gC0m"H F C0mBJf,B. @ @C0m"HB- @ `B. @ @tNN^NuNV nJg n R "H nRH0@ ` n N^NuNVC0mB @Cf62m m~T0Pm tNr G;HA;HtNB`C0mBJg tNBN^NuNVRm2mAdm G;HtNJmf m~0h g F` G gZC: m~0h B- @CN@ g4A/B @CN@"_ C F  F;HtN2m m~T0Pl G;HtNN^NuNVC0m"H G C0m"HB- @ Cr0m"HB0- @2C:0m/C0m/C0m"H G "_ "_ N^NuNV/-HztN;P f F;H ` /-HztN;P f F;H mRH0@ @ @ mTH0@ @ mXH0@ @Hx-H0@/tN,xPHx -H0@/tN,xPA @/tN%XN^NuLST:AUX:NVHx!/tN,xPN^NuNV m/tNNX mJftN` tN8C0mB/C0mB/tN*dPN^NuNV G=H2n0mlC0nB/tN%XC:0nB/C0nB @"_/C0nB @"_=H0nSn gHx tN)X`Hmr0n"F"_B0/Cr0nB0 @"_ I=HHmCr0nB0 @"_-H0nSn g nRH0@/tN)X`Rn0n`C0nB/tN%XC:0nB @=H0nSn gHx tN)X`N^NuNVtNLB-/tN#,X @CB. @BJg,B.//tNPCB. @"H G A @CB. @BJgH m~JPgB./tN#XB.//tNPCB. @"H G B. @S. g`Jmg(B-/tN#,X//tNP G;HN^NuNV G=H=H G=H2n0mn` Rn0n`HmC0nB/tN#,X"_"H F C0nB @CN@ g F;HC0nB @Cg>0n/C0nB @"_=H0n/C0nB @"_=H`P2n0n"H-H0@N~=HJng22n0nN=H0n/2n0nN~"_ I=H` G=H G=H-H2@AN=H G=H2n0mn` Rn0n`C0n/2n0n"_2C0n/C:0nB"@-H0@N~"_2C0nB @Cf G=H`C0n/0P/C0nB"@0nN~"_"_2JngC0nBJg F` G gC0nRP0PSn0nHmr0n"F"_B0/Cr0nB0 @"_ I=H0n/C0n0P"_=HCx0n/2n0n"_20n/2n-H0@N~"_=HC@0n/2n0n I"_2Jng$C0nB @"FN@ g F` G g C@0n/2P-H0@"_2`N^NuNV G=H=HJn g0n/tN)zXHx tN)X0m/-H2@0nN~"_;HN^NuNV2n -H0@g/0n /tN,xP0n @N^NuNV/-. H0@/tN-FP-H gx n"GB"@A I @B.Jg> nC-H nRB/tN-XS.B.Jg``Hx tN-X`. H0@/tN-XN^NuNVB.Jg mJg F` G g2 mVH2@-H0@N~=H0n/0n/tNPB. @S. g/-HxtN-FP g0B- @CN@/tNXHx/tN,xP` mf"HB- @ I/tN+X mZJg/Hz6tNrP G @ G @`\B. /tN+XN^Nu[1][When the printer stops,|change the paper then|click on CONTINUE][CONTINUE]NVB. Jg/-HxtN-FP gZB- @CN@/tNXHxB-"@B. @/tN,xPB-"@B. @ @`.//tN,xPR-B- @S. B. Jg`N^NuNV/-B./tN-FP-H g n"GB"@A I @ nC-HB. @S. gl nRB @ @B. @CN@ g.B. @CN@"HB. @/tN-X`B./tN-X`N^NuNV n "FB"@B. @d2/. n "GB @"_-H n BJf GN^Nu` n "FB"@B. @f n N^Nu GN^NuNVtN.Jm gB. /tN.^X`B. //-tN7PN^NuNVJm g"tN. g/tN=xX``,Jm g$HxtN~@X f/tN=xX`N^NuNV n;H tN g`CVNN^NuNVCN 0m N^Nu/ ?<&NN\Nu"|)f)-gByNu3Nu"|09@/NuNV/-NXN^NuNV/./-NlPN^NuNV/./-NPHx /-NlPN^NuNVHx$/NdP-H fA+H GN^Nu/. /./.N~ o nN^Nu GN^NuNV n H0@/NX-H n`H G-H F-H`Z F-HA-H`HA-HA-H`4A+H N^Nu`$NhRWA`/.Hz@NP gB nCN,-HJg/HxPHxHz/NȢ+H m -H`/.HzNP g$ nCN,-H nC-H`/.HzNP f/.HzNP f G` F g2JfA-H` A-H nCN,-H`N n"Ff*HxA/.NZPHx n/NNP"_" g AN^Nu nX/N X nHh nHh nX"H G""_""_" GN^NuNV n C fHx /.NP/. /.NP n C f/.NX g F` G g /.NX n h g AN^Nu n N^NuNV n Jg n R H0@//.NlP`N^NuNV/.NX-H nC f8/.NX-H nC f n-H`/./.NP nCf8/.NX-H nCf n-H`/./.NP nN^NuNV n hCf n Cg G` F g AN^Nu nC n "N^NuNV n-HS J o@/.NX-HCf`$ nR"H n C f``"n G "n nf GN^Nu nN^NuNVJf m N^Nu n hN^NuNV nC G"N^NuNV n h g/.NX g AN^Nu GN^NuNV n h"FN@ f nCA"AN^Nu n h-HCg nCA" nN^Nu/.NX gX nP"P n hm>/-NX nHh n/ nX/HxN* "_" nP"H G"`^/.NhX g n/N@XN^Nu nP"P n hm/.N6X g F` G g AN^Nu nX"P nP$H PR-H nH0@CN@N^NuNVHx? n/Hx nX/Nv-HJo nC n" nC G"`6 nC G"Jf nCA"` nC n" nP"H G" n hN^NuNV n hCN@ f nCA"AN^Nu/.NXN g/.NhX g F` G g n//. NNP n N^Nu nX"P nP$H PR-H"n n  nC F" nP"PAm/.NX g F` G g AN^Nu n N^NuNV/.NX g8 nX P-H"n nP P"H G  n//.NP`rHx@ n/ nP/ nX/Nv-HJl nC n"`2"n nP Pl nCA"` nC G" nP/ nC G""_" n hN^NuNVHzN X. H0@/NXN^NuabortedNVNHxL. H0@/NNPN^NuNV m -HJg/.NX n h -H`NBN^NuNV/.N X/. NXN^NuNV"n nN~//NdPN^NuNV/./NdPN^NuNV n CCN@-HHxH/.NZP-HJf GN^Nu nR"HA  n"FN@ g nR"HA  n-HJg" n S o nR"H G ` nN^NuNVS nH0@-H nCfS nH0@-H nCfHxI/.NZP GN^NuNVHxHHxNZPN^NuNV"nA _ @N^NuNV n Jg, n H2@. H0@f n N^NuR n ` GN^NuNV n H2@ nH0@f$ n Jf GN^NuR n R n` n H2@ nH0@ IN^NuNV n-H nS oH nR"H n R H0@  g` nS o nR"H G ``"n G  nN^NuNV"nAzn"nAam F` G g"nA IN^Nu nN^NuNV"n F I-HR nJg`"n n IN^NuNV n Jg@ n R H0@/NX/ nRH0@/NX"_g GN^Nu` nH0@"GW @N^NuNV G-HJgtHnHnHnHnNJngT/NX///HnHnHnHnN`//N4P-H nCf /NX nN^NuHx N@X glHxN@XCN@-H nC f A -HJg8 nCfNƄCN@-H` nCf /NX nN^NuNV n P-H nA P-HJgZ nHh nC n""_" nHh( nHh, nC. G2"_2"_2 nC6 F2"n G `> nA P-H nA40P-H nS g nR"H G `/.tN΄X/.tNXN^NuNV n P-H n PJg, n P"H n" nT0P/Hx/.tN N^NuNV n P-H n X"H n" nT0P/Hx/.tN N^NuNV n P-H nA JfN^Nu/.N΄X/.NXN^NuNV n P-H nA JfN^Nu/.N΄X/.N.XN^NuNV n P-H n A JfN^Nu. H0@C fN^Nu/. NX. H0@C g& nA(0P/ nA00P"_l G` F g/. /.NnP. H0@C gt/.HnHnN0 n A/ nA($H0PRR"_-H"n. H0@  nR"H G  n0P/0n/0n//.Nb/. NX/. NXN^NuNV n A/ nA(0P"_-H nR"H G  nC( G2 nA6RP0P/. n A P"_e n A P-H n C n" n A/ n A P"_ I=HJnm$0n/ nA00P"F"_n G` F g` n A P-H nRJg`/. n A P"_e n A P-H n C n" nA./0P/ nA"0P"_ I"_2 nA6SP0P`,"n G /. NXN^NuNV n P-H n A JfN^Nu/. NX n A P-H nA(0P=H0n/ nA00P"_l0 nH0@ @ g.H0@C g F` G g<.H0@C g"n0nRn"H.H0@ R n`z"n0n"H G  nC(0n2/. nA60P//.NԲ nJf`0 nH0@C f R n/. /.NnP`/. NXN^NuNV G=H n P-H nA P-H nA(0P=H nA JfN^Nu2n A I=H nA00P/ nA(0P"_ I=H2n0n l 0n=H Jn n"n G  GN^Nu/.N΄XNƄ=HB0. @`/.A =H/NFP`"Jngx/.NXSn0n/. nA(SP0P"_"H G /.HnHnN0 n0P/0n/0n/Hz"Nb/.NX/.NX`B0. @CN@=HB0."@A e(B0."@Ab2n0n l F` G gRn0n/.B0./NFP`.Nh `dB0. @C f``/. "n0n/NP"n 0nRn"HA "n 0n"H G 0nN^Nu NV//N4P=HB0. @C f A =HB0. @Cf A'=HB0. @N^NuNV n P-H G=H/.HnHnN0 0n/ nA0P"_m 0n/ nA0P"_l G` F gf F=H nHh,/ nA 0P/ nA(0P/ nA0P/ nA 0PCN~"_N"_ I"_N~/NP"_20n/ nA0P/ nA"0P"_"_o\ F=H0n/ nA0P"_o>0n/ nA"0P"_ I=H nA./0P/ nA"0P"_"_2`Jng/.NX`00n/ nA0P"_o/. nA"0P/NlP/.NXN^NuNVNCf HxNX/NX F;H N^NuNVJm fNtHnAT/AX/A\/N=HHm HnHm N8 Jnf HxNXC 0nJg/HzFNPNC 0n"H F HxxNlX-H nA(-H"n n" nX"H n " nP"H n""n0n20n//HxHnHnN G=H2nAl:` 0nRn`/.0nC"_/C0n0P"_2`Jnf0n/HxNP=H0n/HxNP=H nC00n2 nC20n20n/HxNP=H nHh40n"F/0nC"_N~"_2 nHh nHh nHh nA40P/NlX"_""_""_" nHh nA/0n"F/0n"F"_N~"_"_" nC6 F2`/./.N P nPJg nX"HA2` nX"HA2/HxHm N /Hx nP/N /./.NˀP nN^Nu[3][please re-boot and try again][ok]NV nX0P/ nP0P/ nA 0P/ nA 0P/ nA0P/N=HJnl HxNX n\"H F2C 0n"H n " nT"H0n2 nA00P/ nA 0P"_N~/A X0P/NP=H nA20P/ nA"0P"_N~/A \0P/NP=H/ nX0P/Hx Hx0n/0n/HnHnHnHnN,(/. nP0P/0nCN~"_/ nA 0P/0nCN~"_/0n/A X0P/0nCN~"_ I/NP/0n/A \0P/0nCN~"_ I/NP/N͈0n/Hx n X/N n PJg0n/Hx n P/N N^NuNV n P-H nT0P=H nP"H0n2 nC 0n2 nC 0n2 nC0n 2Hm nP/N

@2A CB0.: @2A CB0.6 @2A CB0.2 @2A CB0.. @2C n("A CB0.& @2A CB0." @2HxNX/.ATB0 @"_2/.AXB0 @"_2/.A\B0 @"_2/.APB0 @"_2/. AA B0 @"_2/.AA B0 @"_2AB0 @N^NuNVC 0n 2Hx5NXN^NuNVC 0n2C n"Hx4NXN^NuNVC 0n&2A T"H0n"2A X"H0n2A \"H0n2A P"H0n2A C 0n2A C 0n2A C0n 2HxINXN^NuNVC 0n&2A T"H0n"2A X"H0n2A \"H0n2A P"H0n2A C 0n2A C 0n2A C0n 2HxJNXN^NuNVHxMNX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2AB0 @N^NuNVC 0n2C n"HxNNXN^NuNVHxONX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2N^NuNVC B0. @2A T"H0n2A X"H0n2A \"H0n2A P"H0n 2HxdNXN^NuNVC 0n2A T"H0n2A X"H0n2A \"H0n2A P"H0n 2HxeNXN^NuNVC 0n 2HxfNXN^NuNVC 0n 2HxgNXN^NuNVC 0n2A T"H0n2HxhNX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2AB0 @N^NuNVC 0n2A T"H0n2A X"H0n2A \"H0n2A P"H0n2A C 0n 2HxiNXN^NuNV0n/0n/"nANJ//.//NRN^NuNVC 0n2A T"H0n 2HxjNXN^NuNVC 0n 2HxkNXN^NuNVC 0n.2A T"HB0.* @2A X"H0n&2A \"H0n"2A P"H0n2A C 0n2HxlNX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2AB0 @N^NuNVC 0n 2Hm*2n A ICN~"_-H F=H2nAl0` 0nRn`C 0n"H nRH0@2`NnAB0 @N^NuNV"- 0<NBN^NuNV n-H n -H l n N-H nR/"n A N IC0"_ "n A N-H o`Jl nR"HA- "n G /.NXN^NuNV nH0@/NxX g R n` F-H nH0@`A-HR n`Nh-+ G-H nH0@/NX g0 nC N~"H nRH0@"HA0 I-H`"n nN~N^NuNV/./.NX"_"H F I-H"n nd< nH0@-H nR"H nH0@  nS"H n `N^NuNV"n F I-HR nJg` nR"H nRH0@  g` n N^NuNV n -H nR"H nRH0@  g` n N^NuNV"nA9n"nA0m F` GN^NuNV/./."n nN~/NZ N^NuNV/./."n nN~/N -HCf GN^Nu nN^NuNVHx? n//./. Nv-HJf nCA"`Jl nC n" G-H nN^NuNVHx@ n//./. Nv-HJf nCA"`Jl nC n" G-H nN^NuNV nA PCW @N^NuNV/.//N N^NuNV/.NhX g GN^NuHxB/ n//NN^NuNV/.NhX g AN^Nu/.NXHxB/. n//.N-H nC G" nCA"Jl nC n"AN^Nu nC G" GN^Nu D @Nu W @Nu F @Nu " @Nu " @Nu " @Nu " ANu " ANu " ANu"_ g "fNN BNu"$ 68HAHBBHABA҃ ANu$ma`DaD A"BNu$" a A"BNu" j DaDDNu cPgc $BNurBNu&BCHCR(*$a.$Â$&HCHCԃb DbR`S`NuHPBAHA62HAB42HA6Nu$O?*NA @.JNu$O?*?* `$O/*?* `$O?*/*?*`$O/*/*?*?*`$O?*?* /* ?*`$O/*/*/* ?*?*`NV G+H+HHzzHz{N.P+H nRH0@-H nC//NdP-H/././.N* CA" nJg nH0@`R n`R/.HzHmN -H`R nH0@C>f"R/.HzHmN -H`/.HzHmN -H`n"mAlC mR"H n"/.NTX-H`$NhF H<^>``JfHz1Hz2N.P+HJf m+HN^NuCON:WrawCON:RNV nJg< nH0@/NxX g nR"H G  nN^NuR n` nN^NuNV n-H/.NTX-H/././. N.P"_" nN^NuA 0g C" ӑ`Nu<P    *, ":D\"  l f8tZb6*(2 ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~   File Edit Block Style Help 1st Word... -------------------- Desk Accessory 1 Desk Accessory 2 Desk Accessory 3 Desk Accessory 4 Desk Accessory 5 Desk Accessory 6 Open... Print... ------------- Save Save as... ------------- Layout... ------------- Read... Write... ------------- Delete... ------------- Quit WP mode Insert mode --------------- Find... Replace... Repeat find --------------- Set mark #1 Set mark #2 Set mark #3 Set mark #4 --------------- Goto mark #1 Goto mark #2 Goto mark #3 Goto mark #4 Start block End block --------------- Cut block Paste block --------------- Copy block Move block --------------- Delete block --------------- Find start Find end --------------- Hide block Bold Underline Italic Light Super Subscript ------------ Restyle ------------ Justify Word wrap Spacing ------------ Center Indent Reformat Extra help -------------- Editing Layout Margins Tab points Typing Correcting Cursor Scrolling Deletion Keyboard Page breaks Cut & paste Printing PAGE LAYOUT FORM66__9901__9903__99Paper lengthTOF marginHead marginCANCEL03__9954__9905__99Foot marginBOF marginLines/pageOK_________________________XXXXXXXXXXXXXXXXXXXXXXXXXHead LHead CHead R_________________________XXXXXXXXXXXXXXXXXXXXXXXXX_________________________XXXXXXXXXXXXXXXXXXXXXXXXXFoot LFoot CFoot R_________________________XXXXXXXXXXXXXXXXXXXXXXXXX#_________________________XXXXXXXXXXXXXXXXXXXXXXXXX_________________________XXXXXXXXXXXXXXXXXXXXXXXXX PRINT FILE Print pages from001___999to999___999Page number offset00__99Left margin offset05__99Swap left & right headings onNOYESPrint qualityDRAFTNLQOKCANCELalternate pages?[3][The marked block is too big|for CUT and PASTE operations][ CANCEL ][3][Not enough memory available|for CUT and PASTE operations][ CANCEL ][3][Not enough memory available|to OPEN another document][ CANCEL ][3][Completely out of memory!|SAVE your file(s) NOW!][ CANCEL ][3][The disk is full! To SAVE you|must DELETE some files or use|another disk with enough room][ CANCEL ][3][Unable to read or write file.|See if the file or directory|exists, or see if the disk|is protected or missing][ CANCEL ][3][Block start or end not marked.|Use START BLOCK and END BLOCK|to define block position][ CANCEL ][3][Unable to REPLACE text string|because this would exceed the|maximum line length (160)][ CANCEL ][3][Unable to perform REPEAT FIND|because you have not used a|FIND or REPLACE command yet][ CANCEL ][3][Line too long.|You cannot create a line that|is longer than 160 characters][ CANCEL ][2][This file does not exist. Do|you want to create a new file?][OK| CANCEL ][2][A document already exists|with that name. It will be|renamed to "filename.BAK"][OK| CANCEL ][2][If you use CUT now you will|overwrite the buffer without|having PASTEd its contents][OK| CANCEL ][1][The block has been saved in|the buffer ready for PASTE][ OK ][3][This function is only valid|when in Word Processor mode][ CANCEL ][2][QUIT abandons the current edit|and leaves the file unchanged.|Use SAVE to save your work][OK| CANCEL ][1][Use EXTRA HELP to display an|alert like this for each menu|command before executing it][OK| CANCEL ][3][You can only PRINT a file|if there are no windows open.][ CANCEL ][3][There is not enough RAM|to run the printer driver][ CANCEL ][3][The file will be saved without|any style or layout data.|If you want to save the style|first select WP MODE from the|EDIT menu then SAVE the file.][OK|CANCEL][3][There are too many page|breaks in the file: the limit|is 256 hard or conditional|page breaks.][ OK ][1][Nearly out of memory:|save your file soon][ OK ][1][Nearly out of memory:|close one of the other windows][ OK ]Ja+4'B&$)*+HIJhit $ %&'FGHIi  !67W   %6JKp'  %& './09: ;ABCLM NWX Ybc dmn oxy z  1   "  " -."/QR"Suv"w"""")*"+MN"Oqr"s"""" 4 F G H K N Q T W Z ] `       3 M N h  7DE W[_fjn"b~j%q'  # '%  % $   &B           ' $^ z  m     rt  v    {     '(  "$, '3 '> L#py      Z  !CMv!C E          : V r# * 1 68 Rn >  "1, !#!$!%!&!'2!(N!)j!*!+!, !- !. !/ !0. !1J!! f! P P$       & TP  - <Qf{ "!       # 1 ? M [  i !w  3#2 $ % &'()*+ , - # . 3 / C 0 S 1 c 2 s" C4B5 6 7 8 9 : ; < = > # ? 3 @ C A S B c 3 sTDS E F  G  H  I  J  K  L  M  N O  P  Q  R , S 9 C F  UcV SW bX qY Z [ \ ] ^ _ ` a b  c  T %#&   @@@@  @ @   c   p   {     @@@@*          #" "F   ! "b~$)"% & ' ()#(' F c&rB  ^            z !"b$Z$%*47entspaceonlyand deletingthiswilldeletetheassociatedstretchspaces. Theindentvalueinthefirstlineofaparagraphis usedby1st Wordtodeterminethelocalleftmarginfor theparagraphduringlinejustification,theindent valueforsubsequentlinesbeinggeneratedautomatically bytheprogram.Ifmorethanoneindentappearsinthe firstline,thepositionofthelatteris0660103030566 1 2Page # of 5 9[....................................................]  1STWORDTUTORIAL  ThisdocumentisprovidedforusewithChapter2ofthe1st WordUserGuide,GettingStarted. Usethisfiletogetusedtoeditingadocumentwith1stWord withoutworryingtoomuchabouttheresults. VerticalScrolling Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Aprogramgeneratedpagebreakinthenextparagraph... Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Aconditionalpagebreak-potentialbreakonly... Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Conditionalpagebreak-newpagegenerated... Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. HardpagebreakinsertedafterthislinewithF7... HorizontalScrolling ThislinehasbeeninputwithWordWrapturnedoffandextendsbeyondtheendoftheotherlines. Notethatthelineabovecanbeviewedbyhorizontal scrollingeitherusingthecursorwithinthelineorthe mousewiththehorizontalscrollbar. Correction Thesepargraphcontaneavrylaregnomberoffspeeling mistooks!UesingthCURSRkeesandBCKSPACEandDEELETEkees tyrttocorrekttheesbludners.Wenyoohavfinnished,goback adnpresf10innthfristlynefothpargraph. Theparagraphabovecontainsaverylargenumberofspelling mistakes.UsingthecursorkeysandBACKSPACEandDELETE keys,trytocorrecttheseblunders.Whenyouhavefinished, gobackandpressF10inthefirstlineoftheparagraph. ParagraphFormatting Thisparagraphhasbeensettothefulllinelengthjustbytyping withnopreamblecommands.Thedefaultconditioniswordwrapon andrightjustifiedasshownhere. Thisparagraphhasagainbeensettothefulllinelength,but thistimeJustifyhasbeenswitchedoff,sotheparagraphwillbe leftjustifiedasshown. Thisparagraphhasanindentonthefirstlinecreatedby pressingtheTABkeyatthebeginningoftheparagraph.Onlythe firstlineisindented. Thisparagraphisindentedoneveryline.Thiseffectis createdbypressingtheF9keyatthestartoftheparagraph togiveanIndentoneachlineautomatically.  Thisparagraphisindentedoneachlinebutthefirst lineisfurtherindentedbypressingTABimmediatelyafter theF9keyatthestartoftheparagraph.  Thisparagraphhasasmallerextraindentonthefirstline bypressingCONTROL+SPACEafterF9togenerateafixedspace character. 1Thisparagraphhasareferencenumberinthemargincreated bypressingF9afterthenumber. (a)ThisparagraphwasgeneratedbypressingTABfollowedby "(a)"thenF9. Thisparagraphhasa'hangingindent'.Thisiscreatedbyfirst typingtheparagraphnormallywithnoindent,thengoingback toline2andinsertinganindentwithF9followedbyF10to reformatfromline2onwards.Notethisstyleisnot automaticallyregeneratedwhenyoureformattheparagraphby pressingtheF10key. Thisparagraphwasinputbypressing F9threetimestogetherwithavery reducedrightmargin. Thisparagraphiscenteredbetweenthemargins.Itwasinputby typingnormallywithnoindentation.Followingthiseachlinewas centeredusingtheF8key.Notethatthisstyleisnot automaticallyregeneratedwhenyoureformattheparagraphby pressingtheF10key. edtoenterlongstringsofnumbers. WiththeexceptionofALTERNATE,CAPSLOCK,CONTROLand SHIFT,allkeysonthekeyboardwillauto-repeatifhelddown forashortwhile.Thisisnotalwayssynchronizedwiththe screenupdateandyoumayfindthatthekeyboardwill occasionallyraceaheadofthescreen,especiallywhenyou areforcingthescreentoscroll. 1st Wordallocatesspecialfunctionstocertainkeysandkey combinations: * INSERT insertline * CONTROL+SPACE fixedspace * CONTROL+or moveleftorrightoneword * CONTROL+DELETE deletefromcursortoendofword NoactionisperformedbytheHELP,UNDOorCLR/HOMEkeys. 3.4 FontTable NotalloftheST's256 1ST WORD (tm) RELEASE NOTE VERSION 1.04 This disk contains 1st Word, the GEM word processor written by GST of Cambridge, England and supplied with your Atari ST computer. In order to provide you with a fully working word processor as soon as possible, the 1st Word User Guide has been supplied on the microfloppy disk together with the 1st Word software. Backing up Before you do anything else, backup the 1st Word disk. Viewing the User Guide To view the User Guide on screen, do the following: * Obtain a directory window of the 1st Word disk * Double-click the item 1ST_WORD.PRG to load the program * Double-click the item GUIDE.DOC to open the manual * Scroll through the text using the vertical scroll bar * Click the window close box when finished * Click Quit in the File menu to exit 1st Word Printing the User Guide To print the User Guide, do the following: * Use Install Printer in the Desk menu to select Dot * Obtain a directory window of the 1st Word disk * Double-click the item 1ST_WORD.PRG to load the program * When the Item Selector is displayed click CANCEL * Click Print in the File menu * Select GUIDE.DOC from the directory listing * Answer the questions on the PRINT MENU then click OK * To pause printing, hold the mouse button until the pointer appears then click when you are ready to continue. Click in the close box to cancel the print. * Click Quit in the File menu to exit 1st Word You may need to experiment with the page offset value. 1st Word is initially configured with an ASCII-only print driver which should be capable of driving all printers, but will not print special styles such as bold or underlined. You should print a good copy of your manual (which may require editing for page layout changes) when you have configured 1st Word to drive your printer intelligently. If you have been using version 1.00 or 1.01 of 1st Word, please make sure you use all of the new files on this disk, including printer configuration files. To convert an old configuration file, you must add a sixth number to the "Miscellaneous Configurable Variables" which should normally be zero. A non-zero value causes the print program to pause between pages. indowborder: (a) VerticalScrolling Textinthewindowcanbescrolledverticallywiththe verticalscrollbartotherightofthewindow: *clickthearrowstoscrollalineatatime, *clicktheshadedareastoscrollapageatatime, *dragQUME ( 56 DUDUUDUD 5  ! I|^|v-><-   0123456789#/C,u"e'a^a"a`ac,e^e"e`i"i^i`AAEo^o"o`u^u`y"OUc|#Y-fa'i'o'u'n~Na_o_ a~o~O/o/AAO"'yY+_>_<_:-licktheGEMfullboxinthetoprightcornerto expandtofullsizeorshrinktooriginalsize, *dragtheGEMsizeboxinthebottomrightcornerto changethehorizontalandverticaldimensions. (d) MovingtheWindow Dragthewindowtoanewpositionusingthetitleline. (e) ClosingtheWindow Theeditwindowcanbeclosed(andtheeditabandoned) byTeletype  |^|v-><-   0123456789C,uea^aa`ac,e^ee`ii^i`AAEo^oo`u^u`yOUc|Y-faioun~Na_o_a~o~O/o/AAOyY+_>_<_:-hardpagebreakisalwaysinsertedbytheuserandis indicatedbyasolidhorizontallinewiththenewpage numberdirectlybeneathit. Youcansetorclearthesebyclickingthemouseinthe leftmarginatthedesiredposition.Ahardpagebreak canalsobeinsertedabovethelinecontainingthetext cursorwiththeF7keyoricon. (b) ConditionalPageBreak Aconditionalpagebreakwithadefinednumberoflines ofscopeisalsoinsert`%r&o + ЫЫO// Bg?<JNA IK"Z~|N". H0@C;g,. H0@C:g. H0@C|g G` F g FN^Nu GN^NuNV/./. /.tN /.tN\X g/HztNPN^Nu[3][Error writing binary file]NVtN\=H/. 0nCA"_  n R"HA: 0n"F/ n T/tNpP/. HztN:P/. /.tN:PN^Nu\NVHxtNXN^NuNVHxG/./. tN N^NuNVJmftNT F;HN^NuNVtNN^NuNV/-NXN^NuNV/./-NBPN^NuNV/./-NPHx /-NBPN^NuNVHx$/N:P-H fA+H GN^Nu/. /./.NT o nN^Nu GN^NuNV n H0@/NrX-H n`H G-H F-H`Z F-HA-H`HA-HA-H`4A+HN^Nu`$NRWA`/.Hz@NP gB nCN-HJg/HxPHxHz/N+H m-H`/.HzNP g$ nCN-H nC-H`/.HzNP f/.HzNP f G` F g2JfA-H` A-H nCN-H`N n"Ff*HxA/.NPHxX f, nHhHx> n/NP"_" g AN^Nu nX/NX nHh nHh nX"H G""_""_" GN^NuNV n C fHx /.NP/. /.NP n C f/.N`X g F` G g /.NX n h g AN^Nu n N^NuNV n Jg n R H0@//.NBP`N^NuNV/.NX-H nC f8/.NX-H nC f n-H`/./.NP nCf8/.NX-H nCf n-H`/./.NP nN^NuNV n hCf n Cg G` F g AN^Nu nC n "N^NuNV n-HS J o@/.NX-HCf`$ nR"H n C f``"n G "n nf GN^Nu nN^NuNVJf mN^Nu n hN^NuNV nC G"N^NuNV n h g/.NX g AN^Nu GN^NuNV n h"FN f nCA"AN^Nu n h-HCg nCA" nN^Nu/.N`X gX nP"P n hm>/-NX nHh n/ nX/HxN "_" nP"H G"`^/.N>X g n/NXN^Nu nP"P n hm/.N X g F` G g AN^Nu nX"P nP$H PR-H nH0@CNN^NuNVHx? n/Hx nX/N-HJo nC n" nC G"`6 nC G"Jf nCA"` nC n" nP"H G" n hN^NuNV n hCN f nCA"AN^Nu/.N`XNz g/.N>X g F` G g n//. NP n N^Nu nX"P nP$H PR-H"n n  nC F" nP"PAm/.NX g F` G g AN^Nu n N^NuNV/.N`X g8 nX P-H"n nP P"H G  n//.NP`rHx@ n/ nP/ nX/N-HJl nC n"`2"n nP Pl nCA"` nC G" nP/ nC G""_" n hN^NuNVHzNX. H0@/NXN^NuabortedNVNHxL. H0@/NPN^NuNV m-HJg/.NX n h -H`NN^NuNV/.NX/. NXN^NuNV"n nN//N:PN^NuNV/./N:PN^NuNV n CCN-HHxH/.NP-HJf GN^Nu nR"HA  n"FN g nR"HA  n-HJg" n S o nR"H G ` nN^NuNVS nH0@-H nCfS nH0@-H nCfHxI/.NP GN^NuNVHxHHxNPN^NuNV"nA _ @N^NuNV n Jg, n H2@. H0@f n N^NuR n ` GN^NuNV n H2@ nH0@f$ n Jf GN^NuR n R n` n H2@ nH0@ IN^NuNV n-H nS oH nR"H n R H0@  g` nS o nR"H G ``"n G  nN^NuNV"nAzn"nAam F` G g"nA IN^Nu nN^NuNV"n F I-HR nJg`"n n IN^NuNV n Jg@ n R H0@/NrX/ nRH0@/NrX"_g GN^Nu` nH0@"GW @N^NuNV G-HJgtHnHnHnHnNJngT/NX///HnHnHnHnN//NP-H nCf /NX nN^NuHx NX glHxNXCN-H nC f A -HJg8 nCfNCN-H` nCf /NX nN^NuNVHmA"_"AX/A"_"AP/A"_"AHh A<"_"AHhAJ"_"AHhAR"_"A+HHx NXXAf"R/.HzHmN -H`/.HzHmN -H`n"mAlC mR"H n"/.NX-H`$NF H<^>``JfHz1Hz2NP+HJf m+HN^NuCON:WrawCON:RNV nJg< nH0@/NNX g nR"H G  nN^NuR n` nN^NuNV n-H/.NX-H/././. NP"_" nN^NuA 0g C" ӑ`Nu *, eletefilestomakespace,oryoucanchangedisksifyou wishandthensaveontoanotherdisk. 5.4 Saveas... Thiscommandpromptsforanewfilenameandthenwritesthe contentsofthecurrenteditwindowtodiskwiththefilename specified.Ifafilealreadyexistswiththesamenameit willberenamedwitha.BAKextension.Theeditwindowis thenclosed. 5.5 Layout... Thiscommanddisplaysaformthatallowsyoutospecifythe runningheadandfootlinesandpagelayoutforadocument: (a) HeadLCandR**************************************************************** * * Epson RX-80 Matrix Printer Driver Configuration Table * * some commands for FX80 LX80 and JX80 are also included, * but they are commented out. * * This file contains tables defining the code sequences * to be sent to the printer to perform various functions * and to access the characters from codes in the Atari * character set. * **************************************************************** * * Name of printer * =============== * Epson RX-80 * * Miscellaneous configurable variables * ==================================== * * 1: printer type, 0=dot matrix, 1=daisy wheel * Note if printer type is 0 the following 4 variables are never used. * 2: unit width of one character * 3: unit height of one line * 4: Approximate middle of carriage after formfeed * 5: Carriage shift for bold overstrike * 6: 1 to pause between pages * 0, 0, 0, 0, 0, 0 * * Printer characteristics * ======================= * * This table specifies the printer command sequences. * If the top bit of a code is set, then this indicates the position * of a parameter passed to the printer. The code whose top bit is set * in this table is added to the parameter passed before being sent to the * printer. It is not used in all command sequences, only in those where * the printer requires a variable value such as the length of a vertical * tab. * * 0 * Character width 1, D, A * Linefeed WITH return * 2 * Forward print * 3 * Reverse print * 4, 1B, 42, 80, 0, B * Vertical tab to line (FX or LX) * 5 * Absolute horizontal tab 6, 1B, 45 * Draft bold on 7, 1B, 46 * Draft bold off * 8, 1B, 45 * Near Letter Quality (NLQ) bold on (LX80) * 9, 1B, 46 * NLQ bold off A, 1B, 34 * Draft italic on B, 1B, 35 * Draft italic off * C, 1B, 78, 0, 1B, 34, 1B, 47 * NLQ italic on * D, 1B, 48, 1B, 35, 1B, 78, 1 * NLQ italic off * E * Draft light on * F * Draft light off * 10, 1B, 78, 0 * NLQ light on * 11, 1B, 78, 1 * NLQ light off 12, 1B, 53, 0 * Draft superscript on 13, 1B, 54 * Draft superscript off * 14, 1B, 78, 0, 1B, 53, 0 * NLQ superscript on * 15, 1B, 54, 1B, 78, 1 * NLQ superscript off 16, 1B, 53, 1 * Draft subscript on 17, 1B, 54 * Draft subscript off * 18, 1B, 78, 0, 1B, 53, 1 * NLQ subscript on * 19, 1B, 54, 1B, 78, 1 * NLQ subscript off 1A, 1B, 2D, 1 * Draft underline on 1B, 1B, 2D, 0 * Draft underline off * 1C, 1B, 2D, 1 * NLQ underline on * 1D, 1B, 2D, 0 * NLQ underline off 1E, C * Formfeed 1F, 12 * Horizontal initialisation 20 * Vertical initialisation 21, 1B, 40 * Termination: printer reset 0 * NULL termination byte * * Translation Table * ================= * * This table provides translation from single Atari input bytes into * multiple Epson printer codes, and is useful for printing extraneous * characters such as accented characters etc. All characters are * subjected to translation, but if there is no entry in the table for * a particular code, then the original code is sent to the printer. * * The entries must be arranged in ascending order of Atari input * code. The table is NULL terminated. * 0 * NULL: print a space 1, 1B, 52, 0, 7C, 8, 5E * Up arrow: USA | backspace USA ^ 2, 1B, 52, 0, 7C, 8, 76 * Down arrow: USA | backspace USA v 3, 2D, 8, 3E * Right arrow: - backspace > 4, 3C, 8, 2D * Left arrow: - backspace < 5 * No close box 6 * No size box 7 * No full box 8 * No tick 9 * No clock A * No bell B * No musical note E * No LH Atari symbol F * No RH Atari symbol 10, 30 * LCD 0 11, 31 * LCD 1 12, 32 * LCD 2 13, 33 * LCD 3 14, 34 * LCD 4 15, 35 * LCD 5 16, 36 * LCD 6 17, 37 * LCD 7 18, 38 * LCD 8 19, 39 * LCD 9 23, 1B, 52, 0, 23 * # from USA fount 24, 1B, 52, 0, 24 * $ from USA fount 40, 1B, 52, 0, 40 * @ from USA fount 5B, 1B, 52, 0, 5B * [ from USA fount 5C, 1B, 52, 0, 5C * \ from USA fount 5D, 1B, 52, 0, 5D * ] from USA fount 5E, 1B, 52, 0, 5E * ^ from USA fount 60, 1B, 52, 0, 60 * ' from USA fount 7B, 1B, 52, 0, 7B * { from USA fount 7C, 1B, 52, 0, 7C * | from USA fount 7D, 1B, 52, 0, 7D * } from USA fount 7E, 1B, 52, 0, 7E * ~ from USA fount 7F * No triangle 80, 43, 8, 2C * Capital C cedilla: C backspace , 81, 1B, 52, 2, 7D * Lower case u umlaut from German fount 82, 1B, 52, 1, 7B * Lower case e acute from French fount 83, 61, 8, 1B, 52, 0, 5E * Lower case a circumflex: a backspace USA ^ 84, 1B, 52, 2, 7B * Lower case a umlaut from German fount 85, 1B, 52, 1, 40 * Lower case a grave from French fount 86, 1B, 52, 4, 7D * Lower case a boll from Danish 1 fount 87, 1B, 52, 1, 5C * Lower case c cedilla from French fount 88, 65, 8, 1B, 52, 0, 5E * Lower case e circumflex: e backspace USA ^ 89, 65, 8, 1B, 52, 1, 7E * Lower case e umlaut: e backspace French umlaut 8A, 1B, 52, 1, 7D * Lower case e grave from French fount 8B, 69, 8, 1B, 52, 1, 7E * Lower case i umlaut: i backspace French umlaut 8C, 69, 8, 1B, 52, 0, 5E * Lower case i circumflex: i backspace USA ^ 8D, 1B, 52, 6, 7E * Lower case i grave from Italian fount 8E, 1B, 52, 2, 5B * Capital A umlaut from German fount 8F, 1B, 52, 4, 5D * Capital A boll from Danish 1 fount 90, 1B, 52, 9, 40 * Capital E acute from Norwegian fount 91, 1B, 52, 4, 7B * Lower case ae dipthong from Danish 1 fount 92, 1B, 52, 4, 5B * Capital AE dipthong from Danish 1 fount 93, 6F, 8, 1B, 52, 0, 5E * Lower case o circumflex: o backspace USA ^ 94, 1B, 52, 2, 7C * Lower case o umlaut from German fount 95, 1B, 52, 6, 7C * Lower case o grave from Italian fount 96, 75, 8, 1B, 52, 0, 5E * Lower case u circumflex: u backspace USA ^ 97, 1B, 52, 1, 7C * Lower case u grave from French fount 98, 79, 8, 1B, 52, 1, 7E * Lower case y umlaut: y backspace French umlaut 99, 1B, 52, 2, 5C * Capital O umlaut from German fount 9A, 1B, 52, 2, 5D * Capital U umlaut from German fount 9B, 63, 8, 1B, 52, 0, 7C * c cent: c backspace USA | 9C, 1B, 52, 3, 23 * Pound sterling from UK fount 9D, 1B, 52, 8, 5C * Yen from Japanese fount 9E, 1B, 52, 2, 7E * Esszet from German fount 9F, 66 * Lower case swash f: print f A0, 61, 8, 27 * Lower case a acute: a backspace ' A1, 69, 8, 27 * Lower case i acute: i backspace ' A2, 6F, 8, 27 * Lower case o acute: o backspace ' A3, 75, 8, 27 * Lower case u acute: u backspace ' A4, 1B, 52, 7, 7C * Lower case n tilde from Spanish fount A5, 1B, 52, 7, 5C * Capital N tilde from Spanish fount A6, 61, 8, 5F * Lower case a underline: a backspace underline A7, 6F, 8, 5F * Lower case o underline: o backspace underline A8, 1B, 52, 7, 5D * Inverted ? from Spanish fount A9 * No top left corner AA * No top right corner AB * No 1/2 fraction AC * No 1/4 fraction AD, 1B, 52, 7, 5B * Inverted ! from Spanish fount AE * No << AF * No >> B0, 61, 8, 1B, 52, 0, 7E * Lower case a tilde: a backspace USA ~ B1, 6F, 8, 1B, 52, 0, 7E * Lower case o tilde: o backspace USA ~ B2, 1B, 52, 4, 5C * Capital crossed O from Danish 1 fount B3, 1B, 52, 4, 7C * Lower case crossed o from Danish 1 fount B4 * No lower case oe dipthong B5 * No capital OE dipthong B6, 41 * No capital A grave: print A B7, 41 * No capital A tilde: print A B8, 4F * No capital O tilde: print O B9, 1B, 52, 1, 7E * Umlaut from French fount BA, 27 * Acute: print ' BB * No dagger BC * No paragraph symbol BD * No copyright symbol BE * No Registered symbol BF * No Trademark symbol C0, 79, 8, 1B, 52, 1, 7E * ij ligature: y backspace French umlaut C1, 59 * Capital IJ ligature: print Y C2 * No Hebrew... C3 C4 C5 C6 C7 C8 C9 CA CB CC CD CE CF D0 D1 D2 D3 D4 D5 D6 D7 D8 D9 DA DB DC DD, 1B, 52, 2, 40 * Section mark from German fount DE * No dropped circumflex DF * No infinity E0 * No alpha E1, 1B, 52, 2, 7E * Esszet from German fount E2 * No Greek.... E3 E4 E5 E6 E7 E8 E9 EA EB EC ED EE EF F0, 3D, 8, 5F * Equivalence: = backspace _ F1, 2B, 8, 5F * +-: + backspace _ F2, 3E, 8, 5F * >=: > backspace _ F3, 3C, 8, 5F * <=: < backspace _ F4 * No integral top piece F5 * No integral bottom piece F6, 3A, 8, 2D * Division sign: : backspace - F7 * No twiddly = symbol F8, 1B, 52, 1, 5B * Degree symbol from French fount F9 * No superior bullet FA * No inferior bullet FB * No square root sign FC * No superior n FD * No superior 2 FE * No superior 3 FF * No macron 0 Moveblockalsousethecutand pastebufferandwillchangeitscontents. 7.4 Pasteblock Usethiscommandtoinsertacopyofthecutandpastebuffer tothecursorpositioninthecurrentwindow.Thetextin thebufferremainsintact,soyoucanpasteittomorethan onepositionordocument. 7.5 Copyblock Usethiscommandtoi**************************************************************** * * Epson LX-80 Matrix Printer Driver Configuration Table * * This file contains tables defining the code sequences * to be sent to the printer to perform various functions * and to access the characters from codes in the Atari * character set. * **************************************************************** * * Name of printer * =============== * Epson LX-80 (NLQ) * * Miscellaneous configurable variables * ==================================== * * 1: printer type, 0=dot matrix, 1=daisy wheel * Note if printer type is 0 the following 4 variables are never used. * 2: unit width of one character * 3: unit height of one line * 4: Approximate middle of carriage after formfeed * 5: Carriage shift for bold overstrike * 6: 1 to pause between pages * 0, 0, 0, 0, 0, 0 * * Printer characteristics * ======================= * * This table specifies the printer command sequences. * If the top bit of a code is set, then this indicates the position * of a parameter passed to the printer. The code whose top bit is set * in this table is added to the parameter passed before being sent to the * printer. It is not used in all command sequences, only in those where * the printer requires a variable value such as the length of a vertical * tab. * * 0 * Character width 1, D, A * Linefeed WITH return * 2 * Forward print * 3 * Reverse print 4, 1B, 42, 80, 0, B * Vertical tab to line (FX or LX) * 5 * Absolute horizontal tab 6, 1B, 45 * Draft bold on 7, 1B, 46 * Draft bold off 8, 1B, 45 * Near Letter Quality (NLQ) bold on (LX80) 9, 1B, 46 * NLQ bold off A, 1B, 34 * Draft italic on B, 1B, 35 * Draft italic off C, 1B, 78, 0, 1B, 34, 1B, 47 * NLQ italic on D, 1B, 48, 1B, 35, 1B, 78, 1 * NLQ italic off * E * Draft light on * F * Draft light off 10, 1B, 78, 0 * NLQ light on 11, 1B, 78, 1 * NLQ light off 12, 1B, 53, 0 * Draft superscript on 13, 1B, 54 * Draft superscript off 14, 1B, 78, 0, 1B, 53, 0 * NLQ superscript on 15, 1B, 54, 1B, 78, 1 * NLQ superscript off 16, 1B, 53, 1 * Draft subscript on 17, 1B, 54 * Draft subscript off 18, 1B, 78, 0, 1B, 53, 1 * NLQ subscript on 19, 1B, 54, 1B, 78, 1 * NLQ subscript off 1A, 1B, 2D, 1 * Draft underline on 1B, 1B, 2D, 0 * Draft underline off 1C, 1B, 2D, 1 * NLQ underline on 1D, 1B, 2D, 0 * NLQ underline off 1E, C * Formfeed 1F, 12 * Horizontal initialisation 20, C * Vertical initialisation 21, 1B, 40 * Termination: printer reset 0 * NULL termination byte * * Translation Table * ================= * * This table provides translation from single Atari input bytes into * multiple Epson printer codes, and is useful for printing extraneous * characters such as accented characters etc. All characters are * subjected to translation, but if there is no entry in the table for * a particular code, then the original code is sent to the printer. * * The entries must be arranged in ascending order of Atari input * code. The table is NULL terminated. * 0 * NULL: print a space 1, 1B, 52, 0, 7C, 8, 5E * Up arrow: USA | backspace USA ^ 2, 1B, 52, 0, 7C, 8, 76 * Down arrow: USA | backspace USA v 3, 2D, 8, 3E * Right arrow: - backspace > 4, 3C, 8, 2D * Left arrow: - backspace < 5 * No close box 6 * No size box 7 * No full box 8 * No tick 9 * No clock A * No bell B * No musical note E * No LH Atari symbol F * No RH Atari symbol 10, 30 * LCD 0 11, 31 * LCD 1 12, 32 * LCD 2 13, 33 * LCD 3 14, 34 * LCD 4 15, 35 * LCD 5 16, 36 * LCD 6 17, 37 * LCD 7 18, 38 * LCD 8 19, 39 * LCD 9 23, 1B, 52, 0, 23 * # from USA fount 24, 1B, 52, 0, 24 * $ from USA fount 40, 1B, 52, 0, 40 * @ from USA fount 5B, 1B, 52, 0, 5B * [ from USA fount 5C, 1B, 52, 0, 5C * \ from USA fount 5D, 1B, 52, 0, 5D * ] from USA fount 5E, 1B, 52, 0, 5E * ^ from USA fount 60, 1B, 52, 0, 60 * ' from USA fount 7B, 1B, 52, 0, 7B * { from USA fount 7C, 1B, 52, 0, 7C * | from USA fount 7D, 1B, 52, 0, 7D * } from USA fount 7E, 1B, 52, 0, 7E * ~ from USA fount 7F * No triangle 80, 43, 8, 2C * Capital C cedilla: C backspace , 81, 1B, 52, 2, 7D * Lower case u umlaut from German fount 82, 1B, 52, 1, 7B * Lower case e acute from French fount 83, 61, 8, 1B, 52, 0, 5E * Lower case a circumflex: a backspace USA ^ 84, 1B, 52, 2, 7B * Lower case a umlaut from German fount 85, 1B, 52, 1, 40 * Lower case a grave from French fount 86, 1B, 52, 4, 7D * Lower case a boll from Danish 1 fount 87, 1B, 52, 1, 5C * Lower case c cedilla from French fount 88, 65, 8, 1B, 52, 0, 5E * Lower case e circumflex: e backspace USA ^ 89, 65, 8, 1B, 52, 1, 7E * Lower case e umlaut: e backspace French umlaut 8A, 1B, 52, 1, 7D * Lower case e grave from French fount 8B, 69, 8, 1B, 52, 1, 7E * Lower case i umlaut: i backspace French umlaut 8C, 69, 8, 1B, 52, 0, 5E * Lower case i circumflex: i backspace USA ^ 8D, 1B, 52, 6, 7E * Lower case i grave from Italian fount 8E, 1B, 52, 2, 5B * Capital A umlaut from German fount 8F, 1B, 52, 4, 5D * Capital A boll from Danish 1 fount 90, 1B, 52, 9, 40 * Capital E acute from Norwegian fount 91, 1B, 52, 4, 7B * Lower case ae dipthong from Danish 1 fount 92, 1B, 52, 4, 5B * Capital AE dipthong from Danish 1 fount 93, 6F, 8, 1B, 52, 0, 5E * Lower case o circumflex: o backspace USA ^ 94, 1B, 52, 2, 7C * Lower case o umlaut from German fount 95, 1B, 52, 6, 7C * Lower case o grave from Italian fount 96, 75, 8, 1B, 52, 0, 5E * Lower case u circumflex: u backspace USA ^ 97, 1B, 52, 1, 7C * Lower case u grave from French fount 98, 79, 8, 1B, 52, 1, 7E * Lower case y umlaut: y backspace French umlaut 99, 1B, 52, 2, 5C * Capital O umlaut from German fount 9A, 1B, 52, 2, 5D * Capital U umlaut from German fount 9B, 63, 8, 1B, 52, 0, 7C * c cent: c backspace USA | 9C, 1B, 52, 3, 23 * Pound sterling from UK fount 9D, 1B, 52, 8, 5C * Yen from Japanese fount 9E, 1B, 52, 2, 7E * Esszet from German fount 9F, 66 * Lower case swash f: print f A0, 61, 8, 27 * Lower case a acute: a backspace ' A1, 69, 8, 27 * Lower case i acute: i backspace ' A2, 6F, 8, 27 * Lower case o acute: o backspace ' A3, 75, 8, 27 * Lower case u acute: u backspace ' A4, 1B, 52, 7, 7C * Lower case n tilde from Spanish fount A5, 1B, 52, 7, 5C * Capital N tilde from Spanish fount A6, 61, 8, 5F * Lower case a underline: a backspace underline A7, 6F, 8, 5F * Lower case o underline: o backspace underline A8, 1B, 52, 7, 5D * Inverted ? from Spanish fount A9 * No top left corner AA * No top right corner AB * No 1/2 fraction AC * No 1/4 fraction AD, 1B, 52, 7, 5B * Inverted ! from Spanish fount AE * No << AF * No >> B0, 61, 8, 1B, 52, 0, 7E * Lower case a tilde: a backspace USA ~ B1, 6F, 8, 1B, 52, 0, 7E * Lower case o tilde: o backspace USA ~ B2, 1B, 52, 4, 5C * Capital crossed O from Danish 1 fount B3, 1B, 52, 4, 7C * Lower case crossed o from Danish 1 fount B4 * No lower case oe dipthong B5 * No capital OE dipthong B6, 41 * No capital A grave: print A B7, 41 * No capital A tilde: print A B8, 4F * No capital O tilde: print O B9, 1B, 52, 1, 7E * Umlaut from French fount BA, 27 * Acute: print ' BB * No dagger BC * No paragraph symbol BD * No copyright symbol BE * No Registered symbol BF * No Trademark symbol C0, 79, 8, 1B, 52, 1, 7E * ij ligature: y backspace French umlaut C1, 59 * Capital IJ ligature: print Y C2 * No Hebrew... C3 C4 C5 C6 C7 C8 C9 CA CB CC CD CE CF D0 D1 D2 D3 D4 D5 D6 D7 D8 D9 DA DB DC DD, 1B, 52, 2, 40 * Section mark from German fount DE * No dropped circumflex DF * No infinity E0 * No alpha E1, 1B, 52, 2, 7E * Esszet from German fount E2 * No Greek.... E3 E4 E5 E6 E7 E8 E9 EA EB EC ED EE EF F0, 3D, 8, 5F * Equivalence: = backspace _ F1, 2B, 8, 5F * +-: + backspace _ F2, 3E, 8, 5F * >=: > backspace _ F3, 3C, 8, 5F * <=: < backspace _ F4 * No integral top piece F5 * No integral bottom piece F6, 3A, 8, 2D * Division sign: : backspace - F7 * No twiddly = symbol F8, 1B, 52, 1, 5B * Degree symbol from French fount F9 * No superior bullet FA * No inferior bullet FB * No square root sign FC * No superior n FD * No superior 2 FE * No superior 3 FF * No macron 0 otherHR-15/25daisy EPS_LX80.HEX EpsonLX80NLQmatrix EPS_RX80.HEX EpsonRX/FX-80matrix QUME .HEX QumeSprintdaisy SMM804.HEXAtariSMM804matrix Use1st Wordtoeditthefileclosesttothespecificationof thetargetprinter,thenuseSaveastogivethenewfilea uniquenamewitha.HEXextension. LinesintheHEXfilestartingwithanasterisk(*)are comments.Forexample,therearesom**************************************************************** * * Brother Daisy Printer Driver Configuration Table * * Standard QUME with a different printer reset sequence. * * This file contains tables defining the code sequences * to be sent to the printer to perform various functions * and to access the characters from codes in the Atari * character set. * * This is installed to PAUSE BETWEEN PAGES * (see below in order to change this) * * For Brother HR-15 or HR-25 * (NOT HR-1) * **************************************************************** * * Name of printer * =============== * Brother * * Miscellaneous configurable variables * ==================================== * * 1: printer type, 0=dot matrix, 1=daisy wheel * Note, if the printer type is 0, the following 4 variables are never used. * 2: unit width of one character * 3: unit height of one line * 4: Approximate middle of carriage after formfeed * 5: Carriage shift for bold overstrike * 6: 1 to PAUSE BETWEEN PAGES * 1, C, 8, 28, 1, 1 * * Printer characteristics * ======================= * * This table specifies the printer command sequences. * If the top bit of a code is set, then this indicates the position * of a parameter passed to the printer. The code whose top bit is set in * this tabl is added to the parameter passed, before being sent to the * printer. It is not used in all command sequences, only in those where * the printer requires a variable value such as the length of a vertical * tab. * 0, 1B, 1F, 81 * Set horizontal movement increment (HMI) to (n-1) 1, A * Linefeed WITHOUT return 2, 1B, 35 * Forward print 3, 1B, 36 * Backwards print 4, 1B, B, 81 * Absolute vertical tab to (n-1) * 5 * Absolute horizontal tab to (n-1) * 6 * Draft bold on * 7 * Draft bold off * 8 * Near Letter Quality (NLQ) bold on * 9 * NLQ bold off * A * Draft italic on * B * Draft italic off * C * NLQ italic on * D * NLQ italic off * E * Draft light on * F * Draft light off * 10 * NLQ light on * 11 * NLQ light off 12, 1B, 44 * Draft superscript on 13, 1B, 55 * Draft superscript off 14, 1B, 44 * NLQ superscript on 15, 1B, 55 * NLQ superscript off 16, 1B, 55 * Draft subscript on 17, 1B, 44 * Draft subscript off 18, 1B, 55 * NLQ subscript on 19, 1B, 44 * NLQ subscript off * 1A * Draft underline on * 1B * Draft underline off * 1C * NLQ underline on * 1D * NLQ underline off 1E, C * Formfeed 1F, 1B, 1F, 81, 1B, 35, D * Horizontal initialisation: set HMI (n-1), forward print, return 20, 1B, 1E, 81 * Vertical initialisation: set VMI (n-1) 21, D, 1B, 0D, 50 * Tidy up: return and printer reset 0 * * Translation Table * ================= * * This table provides translation from single Atari input bytes into * multiple Epson printer codes, and is useful for printing extraneous * characters such as accented characters etc. All characters are * subjected to translation, but if there is no entry in the table for * a particular code, then the original code is sent to the printer. * * The entries must be arranged in ascending order of Atari input * code. The table is NULL terminated. * 0 * NULL: print a space 1, 7C, 8, 5E * Up arrow: | backspace ^ 2, 7C, 8, 76 * Down arrow: | backspace v 3, 2D, 8, 3E * Right arrow: - backspace > 4, 3C, 8, 2D * Left arrow: - backspace < 5 * No close box 6 * No size box 7 * No full box 8 * No tick 9 * No clock A * No Bell B * No musical note E * No Atari left hand symbol F * No Atari right hand symbol 10, 30 * LCD 0 11, 31 * LCD 1 12, 32 * LCD 2 13, 33 * LCD 3 14, 34 * LCD 4 15, 35 * LCD 5 16, 36 * LCD 6 17, 37 * LCD 7 18, 38 * LCD 8 19, 39 * LCD 9 23, 1B, 2F * HASH: phantom rubout 7F * No triangle 80, 43, 8, 2C * Capital C cedilla: C backspace , 81, 75, 8, 22 * lower case u umlaut 82, 65, 8, 27 * Lower case e acute: e backspace quote 83, 61, 8, 5E * Lower case a circumflex: a backspace ^ 84, 61, 8, 22 * lower case a umlaut 85, 61, 8, 60 * Lower case a grave: a backspace ` 86, 61 * No lower case a boll 87, 63, 8, 2C * Lower case c cedilla: c backspace , 88, 65, 8, 5E * Lower case e circumflex: e backspace ^ 89, 65, 8, 22 * lower case e umlaut 8A, 65, 8, 60 * Lower case e grave: e backspace ` 8B, 69, 8, 22 * lower case i umlaut/diaresis 8C, 69, 8, 5E * Lower case i circumflex: i backspace ^ 8D, 69, 8, 60 * Lower case i grave: i backspace ` 8E, 41 * No capital A umlaut 8F, 41 * No capital A boll 90, 45 * No capital E acute 91 * No lower case ae dipthong 92 * No capital AE dipthong 93, 6F, 8, 5E * Lower case o circumflex: o backspace ^ 94, 6F, 8, 22 * lower case o umlaut 95, 6F, 8, 60 * Lower case o grave: o backspace ` 96, 75, 8, 5E * Lower case u circumflex: u backspace ^ 97, 75, 8, 60 * Lower case u grave: u backspace ` 98, 79, 8, 22 * lower case y umlaut 99, 4F * No capital O umlaut 9A, 55 * No capital U umlaut 9B, 63, 8, 7C * c cent: c backspace | 9C, 23 * Pound Sterling 9D, 59, 8, 2D * Yen: Y backspace - 9E * No esszet 9F, 66 * Lower case swash f: print f A0, 61, 8, 27 * Lower case a acute: a backspace quote A1, 69, 8, 27 * Lower case i acute: i backspace quote A2, 6F, 8, 27 * Lower case o acute: o backspace quote A3, 75, 8, 27 * Lower case u acute: u backspace quote A4, 6E, 8, 7E * Lower case n tilde: n backspace ~ A5, 4E * No capital N tilde A6, 61, 8, 5F * Lower case a underline: a backspace _ A7, 6F, 8, 5F * Lower case o underline: o backspace _ A8 * No inverted ? A9 * No top left corner AA * No top right corner AB, 1B, 20 * 1/2 fraction: phantom space AC * No 1/4 fraction AD * No inverted ! AE * No << AF * No >> B0, 61, 8, 7E * Lower case a tilde: a backspace ~ B1, 6F, 8, 7E * Lower case o tilde: o backspace ~ B2, 4F, 8, 2F * Capital crossed O: O backspace / B3, 6F, 8, 2F * Lower case crossed o: o backspace / B4 * No lower case oe dipthong B5 * No capital OE dipthong B6, 41 * No capital A grave: print A B7, 41 * No capital A tilde: print A B8, 4F * No capital O tilde: print O B9, 22 * No umlaut: use double quote BA, 27 * Acute: quote BB * No dagger BC * No paragraph symbol BD * No copyright symbol BE * No Registered symbol BF * No Trademark symbol C0, 79 * ij ligature: print y C1, 59 * Capital IJ ligature: print Y C2 * No Hebrew... C3 C4 C5 C6 C7 C8 C9 CA CB CC CD CE CF D0 D1 D2 D3 D4 D5 D6 D7 D8 D9 DA DB DC DD * No section mark DE * No dropped circumflex DF * No infinity E0 * No alpha E1 * No esszet E2 * No Greek... E3 E4 E5 E6 E7 E8 E9 EA EB EC ED EE EF F0 * No equivalence F1, 2B, 8, 5F * +-: + backspace _ F2, 3E, 8, 5F * >=: > backspace _ F3, 3C, 8, 5F * <=: < backspace _ F4 * No integral top piece F5 * No integral bottom piece F6, 3A, 8, 2D * Division sign: : backspace - F7 * No twiddly = symbol F8 * No degree symbol F9 * No superior bullet FA * No inferior bullet FB * No square root sign FC * No superior n FD * No superior 2 FE * No superior 3 FF * No macron 0 **************************************************************** * * QUME Daisy Printer Driver Configuration Table * * This file contains tables defining the code sequences * to be sent to the printer to perform various functions * and to access the characters from codes in the Atari * character set. * **************************************************************** * * Name of printer * =============== * QUME * * Miscellaneous configurable variables * ==================================== * * 1: printer type, 0=dot matrix, 1=daisy wheel * Note, if the printer type is 0, the following 4 variables are never used. * 2: unit width of one character * 3: unit height of one line * 4: Approximate middle of carriage after formfeed * 5: Carriage shift for bold overstrike * 6: 1 to pause between pages * 1, C, 8, 28, 1, 0 * * Printer characteristics * ======================= * * This table specifies the printer command sequences. * If the top bit of a code is set, then this indicates the position * of a parameter passed to the printer. The code whose top bit is set in * this tabl is added to the parameter passed, before being sent to the * printer. It is not used in all command sequences, only in those where * the printer requires a variable value such as the length of a vertical * tab. * 0, 1B, 1F, 81 * Set horizontal movement increment (HMI) to (n-1) 1, A * Linefeed WITHOUT return 2, 1B, 35 * Forward print 3, 1B, 36 * Backwards print 4, 1B, B, 81 * Absolute vertical tab to (n-1) * 5 * Absolute horizontal tab to (n-1) * 6 * Draft bold on * 7 * Draft bold off * 8 * Near Letter Quality (NLQ) bold on * 9 * NLQ bold off * A * Draft italic on * B * Draft italic off * C * NLQ italic on * D * NLQ italic off * E * Draft light on * F * Draft light off * 10 * NLQ light on * 11 * NLQ light off 12, 1B, 44 * Draft superscript on 13, 1B, 55 * Draft superscript off 14, 1B, 44 * NLQ superscript on 15, 1B, 55 * NLQ superscript off 16, 1B, 55 * Draft subscript on 17, 1B, 44 * Draft subscript off 18, 1B, 55 * NLQ subscript on 19, 1B, 44 * NLQ subscript off * 1A * Draft underline on * 1B * Draft underline off * 1C * NLQ underline on * 1D * NLQ underline off 1E, C * Formfeed 1F, 1B, 1F, 81, 1B, 35, D * Horizontal initialisation: set * HMI (n-1), forward print, return 20, 1B, 1E, 81 * Vertical initialisation: set VMI (n-1) 21, D, 1B, 1A, 49 * Tidy up: printer reset (CHANGED FROM QUME) 0 * * Translation Table * ================= * * This table provides translation from single Atari input bytes into * multiple Epson printer codes, and is useful for printing extraneous * characters such as accented characters etc. All characters are * subjected to translation, but if there is no entry in the table for * a particular code, then the original code is sent to the printer. * * The entries must be arranged in ascending order of Atari input * code. The table is NULL terminated. * 0 * NULL: print a space 1, 7C, 8, 5E * Up arrow: | backspace ^ 2, 7C, 8, 76 * Down arrow: | backspace v 3, 2D, 8, 3E * Right arrow: - backspace > 4, 3C, 8, 2D * Left arrow: - backspace < 5 * No close box 6 * No size box 7 * No full box 8 * No tick 9 * No clock A * No Bell B * No musical note E * No Atari left hand symbol F * No Atari right hand symbol 10, 30 * LCD 0 11, 31 * LCD 1 12, 32 * LCD 2 13, 33 * LCD 3 14, 34 * LCD 4 15, 35 * LCD 5 16, 36 * LCD 6 17, 37 * LCD 7 18, 38 * LCD 8 19, 39 * LCD 9 23, 1B, 2F * HASH: phantom rubout 7F * No triangle 80, 43, 8, 2C * Capital C cedilla: C backspace , 81, 75, 8, 22 * lower case u umlaut 82, 65, 8, 27 * Lower case e acute: e backspace quote 83, 61, 8, 5E * Lower case a circumflex: a backspace ^ 84, 61, 8, 22 * lower case a umlaut 85, 61, 8, 60 * Lower case a grave: a backspace ` 86, 61 * No lower case a boll 87, 63, 8, 2C * Lower case c cedilla: c backspace , 88, 65, 8, 5E * Lower case e circumflex: e backspace ^ 89, 65, 8, 22 * lower case e umlaut 8A, 65, 8, 60 * Lower case e grave: e backspace ` 8B, 69, 8, 22 * lower case i umlaut/diaresis 8C, 69, 8, 5E * Lower case i circumflex: i backspace ^ 8D, 69, 8, 60 * Lower case i grave: i backspace ` 8E, 41 * No capital A umlaut 8F, 41 * No capital A boll 90, 45 * No capital E acute 91 * No lower case ae dipthong 92 * No capital AE dipthong 93, 6F, 8, 5E * Lower case o circumflex: o backspace ^ 94, 6F, 8, 22 * lower case o umlaut 95, 6F, 8, 60 * Lower case o grave: o backspace ` 96, 75, 8, 5E * Lower case u circumflex: u backspace ^ 97, 75, 8, 60 * Lower case u grave: u backspace ` 98, 79, 8, 22 * lower case y umlaut 99, 4F * No capital O umlaut 9A, 55 * No capital U umlaut 9B, 63, 8, 7C * c cent: c backspace | 9C, 23 * Pound Sterling 9D, 59, 8, 2D * Yen: Y backspace - 9E * No esszet 9F, 66 * Lower case swash f: print f A0, 61, 8, 27 * Lower case a acute: a backspace quote A1, 69, 8, 27 * Lower case i acute: i backspace quote A2, 6F, 8, 27 * Lower case o acute: o backspace quote A3, 75, 8, 27 * Lower case u acute: u backspace quote A4, 6E, 8, 7E * Lower case n tilde: n backspace ~ A5, 4E * No capital N tilde A6, 61, 8, 5F * Lower case a underline: a backspace _ A7, 6F, 8, 5F * Lower case o underline: o backspace _ A8 * No inverted ? A9 * No top left corner AA * No top right corner AB, 1B, 20 * 1/2 fraction: phantom space AC * No 1/4 fraction AD * No inverted ! AE * No << AF * No >> B0, 61, 8, 7E * Lower case a tilde: a backspace ~ B1, 6F, 8, 7E * Lower case o tilde: o backspace ~ B2, 4F, 8, 2F * Capital crossed O: O backspace / B3, 6F, 8, 2F * Lower case crossed o: o backspace / B4 * No lower case oe dipthong B5 * No capital OE dipthong B6, 41 * No capital A grave: print A B7, 41 * No capital A tilde: print A B8, 4F * No capital O tilde: print O B9, 22 * No umlaut: use double quote BA, 27 * Acute: quote BB * No dagger BC * No paragraph symbol BD * No copyright symbol BE * No Registered symbol BF * No Trademark symbol C0, 79 * ij ligature: print y C1, 59 * Capital IJ ligature: print Y C2 * No Hebrew... C3 C4 C5 C6 C7 C8 C9 CA CB CC CD CE CF D0 D1 D2 D3 D4 D5 D6 D7 D8 D9 DA DB DC DD * No section mark DE * No dropped circumflex DF * No infinity E0 * No alpha E1 * No esszet E2 * No Greek... E3 E4 E5 E6 E7 E8 E9 EA EB EC ED EE EF F0 * No equivalence F1, 2B, 8, 5F * +-: + backspace _ F2, 3E, 8, 5F * >=: > backspace _ F3, 3C, 8, 5F * <=: < backspace _ F4 * No integral top piece F5 * No integral bottom piece F6, 3A, 8, 2D * Division sign: : backspace - F7 * No twiddly = symbol F8 * No degree symbol F9 * No superior bullet FA * No inferior bullet FB * No square root sign FC * No superior n FD * No superior 2 FE * No superior 3 FF * No macron 0 **************************************************************** * * Atari SMM804 Matrix Printer Driver Configuration Table * * This file contains tables defining the code sequences * to be sent to the printer to perform various functions * and to access the characters from codes in the Atari * character set. * **************************************************************** * * Name of printer * =============== * Atari SMM 804 * * Miscellaneous configurable variables * ==================================== * * 1: printer type, 0=dot matrix, 1=daisy wheel * Note if printer type is 0 the following 4 variables are never used. * 2: unit width of one character * 3: unit height of one line * 4: Approximate middle of carriage after formfeed * 5: Carriage shift for bold overstrike * 6: 1 to pause between pages * 0, 0, 0, 0, 0, 0 * * Printer characteristics * ======================= * * This table specifies the printer command sequences. * If the top bit of a code is set, then this indicates the position * of a parameter passed to the printer. The code whose top bit is set * in this table is added to the parameter passed before being sent to the * printer. It is not used in all command sequences, only in those where * the printer requires a variable value such as the length of a vertical * tab. * * 0 * Character width 1, D, A * Linefeed WITH return * 2 * Forward print * 3 * Reverse print * 5 * Absolute horizontal tab 6, 1B, 45 * Draft bold on 7, 1B, 46 * Draft bold off 8, 1B, 45 * Near Letter Quality (NLQ) bold on 9, 1B, 46 * NLQ bold off A, 1B, 34 * Draft italic on B, 1B, 35 * Draft italic off C, 1B, 34 * NLQ italic on D, 1B, 35 * NLQ italic off * E * Draft light on * F * Draft light off * 10 * NLQ light on * 11 * NLQ light off 12, 1B, 53, 0 * Draft superscript on 13, 1B, 54 * Draft superscript off 14, 1B, 53, 0 * NLQ superscript on 15, 1B, 54 * NLQ superscript off 16, 1B, 53, 1 * Draft subscript on 17, 1B, 54 * Draft subscript off 18, 1B, 53, 1 * NLQ subscript on 19, 1B, 54 * NLQ subscript off 1A, 1B, 2D, 1 * Draft underline on 1B, 1B, 2D, 0 * Draft underline off 1C, 1B, 2D, 1 * NLQ underline on 1D, 1B, 2D, 0 * NLQ underline off 1E, C * Formfeed 1F, 12 * Horizontal initialisation * 20 * Vertical initialisation 21, 1B, 40 * Termination: printer reset 0 * NULL termination byte * * Translation Table * ================= * * This table provides translation from single Atari input bytes into * multiple printer codes, or to disable output of some characters. * * The entries must be arranged in ascending order of Atari input * code. The table is NULL terminated. * 0 * NULL: print a space 1 * CONTROL CODES: not printed 2 3 4 5 6 7 8 9 A B C D E F 10 11 12 13 14 15 16 17 18 19 7F * DELETE IS NOT PRINTABLE 0 * end of table! **************************************************************** * * Teletype Printer Driver Configuration Table * * This file contains tables defining the code sequences * to be sent to the printer to perform various functions * and to access the characters from codes in the Atari * character set. * **************************************************************** * * Name of printer * =============== * Teletype * * Miscellaneous configurable variables * ==================================== * * 1: printer type, 0=dot matrix, 1=daisy wheel * Note, if the printer type is 0, the following 4 variables are never used. * 2: unit width of one character * 3: unit height of one line * 4: Approximate middle of carriage after formfeed * 5: Carriage shift for bold overstrike * 6: 1 if pause between pages * 0, 0, 0, 0, 0, 0 * * Printer characteristics * ======================= * * This table specifies the printer command sequences. * * 0 * Character width 1, D, A * Linefeed WITH return * 2 * Forward print * 3 * Reverse print * 4 * Vertical tab to line * 5 * Absolute horizontal tab * 6 * Draft bold on * 7 * Draft bold off * 8 * Near Letter Quality (NLQ) bold on * 9 * NLQ bold off * A * Draft italic on * B * Draft italic off * C * NLQ italic on * D * NLQ italic off * E * Draft light on * F * Draft light off * 10 * NLQ light on * 11 * NLQ light off * 12 * Draft superscript on * 13 * Draft superscript off * 14 * NLQ superscript on * 15 * NLQ superscript off * 16 * Draft subscript on * 17 * Draft subscript off * 18 * NLQ subscript on * 19 * NLQ subscript off * 1A * Draft underline on * 1B * Draft underline off * 1C * NLQ underline on * 1D * NLQ underline off * 1E * Formfeed 1F, D * Horizontal initialisation * 20 * Vertical initialisation * 21 * Termination: printer reset 0 * NULL termination byte * * Translation Table * ================= * * This table provides translation from single Atari input bytes into * multiple printer codes, and is useful for printing extraneous * characters such as accented characters etc. All characters are * subjected to translation, but if there is no entry in the table for * a particular code, then the original code is sent to the printer. * * The entries must be arranged in ascending order of Atari input * code. The table is NULL terminated. * * If the table entry contains just the character code, it means * that the character in not printable. 0 * NULL: print a space 1, 7C, 8, 5E * Up arrow: | backspace ^ 2, 7C, 8, 76 * Down arrow: | backspace v 3, 2D, 8, 3E * Right arrow: - backspace > 4, 3C, 8, 2D * Left arrow: - backspace < 5 * No close box 6 * No size box 7 * No full box 8 * No tick 9 * No clock A * No bell B * No musical note E * No LH Atari symbol F * No RH Atari symbol 10, 30 * LCD 0 11, 31 * LCD 1 12, 32 * LCD 2 13, 33 * LCD 3 14, 34 * LCD 4 15, 35 * LCD 5 16, 36 * LCD 6 17, 37 * LCD 7 18, 38 * LCD 8 19, 39 * LCD 9 7F * No triangle 80, 43, 8, 2C * Capital C cedilla: C backspace , 81, 75 * No lower case u umlaut 82, 65 * No lower case e acute 83, 61, 8, 5E * Lower case a circumflex: a backspace ^ 84, 61 * No lower case a umlaut 85, 61, 8, 60 * Lower case a grave: a backspace ` 86, 61 * No lower case a boll 87, 63, 8, 2C * Lower case c cedilla: c backspace , 88, 65, 8, 5E * Lower case e circumflex: e backspace ^ 89, 65 * No lower case e umlaut 8A, 65, 8, 60 * Lower case e grave: e backspace ` 8B, 69 * No lower case i umlaut 8C, 69, 8, 5E * Lower case i circumflex: i backspace ^ 8D, 69, 8, 60 * Lower case i grave: i backspace ` 8E, 41 * No capital A umlaut 8F, 41 * No capital A boll 90, 45 * No capital E acute 91 * No lower case ae dipthong 92 * No capital AE dipthong 93, 6F, 8, 5E * Lower case o circumflex: o backspace ^ 94, 6F * No lower case o umlaut 95, 6F, 8, 60 * Lower case o grave: o backspace ` 96, 75, 8, 5E * Lower case u circumflex: u backspace ^ 97, 75, 8, 60 * Lower case u grave: u backspace ` 98, 79 * No lower case y umlaut 99, 4F * No capital O umlaut 9A, 55 * No capital U umlaut 9B, 63, 8, 7C * c cent: c backspace | 9C * No pound sterling 9D, 59, 8, 2D * Yen: Y backspace - 9E * No esszet 9F, 66 * No lower case swash A0, 61 * No lower case a acute A1, 69 * No lower case i acute A2, 6F * No lower case o acute A3, 75 * No lower case y acute A4, 6E, 8, 7E * Lower case n tilde: n backspace ~ A5, 4E * No capital N tilde A6, 61, 8, 5F * Lower case a underline: a backspace _ A7, 6F, 8, 5F * Lower case o underline: o backspace _ A8 * No inverted ? A9 * No top left corner AA * No top right corner AB * No 1/2 fraction AC * No 1/4 fraction AD * No inverted ! AE * No << AF * No >> B0, 61, 8, 7E * Lower case a tilde: a backspace ~ B1, 6F, 8, 7E * Lower case o tilde: o backspace ~ B2, 4F, 8, 2F * Capital crossed O: O backspace / B3, 6F, 8, 2F * Lower case crossed o: o backspace / B4 * No lower case oe dipthong B5 * No capital OE dipthong B6, 41 * No capital A grave: print A B7, 41 * No capital A tilde: print A B8, 4F * No capital O tilde: print O B9 * No umlaut BA * No acute BB * No dagger BC * No paragraph symbol BD * No copyright symbol BE * No Registered symbol BF * No Trademark symbol C0, 79 * ij ligature: print y C1, 59 * Capital IJ ligature: print Y C2 * No Hebrew... C3 C4 C5 C6 C7 C8 C9 CA CB CC CD CE CF D0 D1 D2 D3 D4 D5 D6 D7 D8 D9 DA DB DC DD * No section mark DE * No dropped circumflex DF * No infinity E0 * No alpha E1 * No esszet E2 * No Greek... E3 E4 E5 E6 E7 E8 E9 EA EB EC ED EE EF F0 * no equivalence sign F1, 2B, 8, 5F * +-: + backspace _ F2, 3E, 8, 5F * >=: > backspace _ F3, 3C, 8, 5F * <=: < backspace _ F4 * No integral top piece F5 * No integral bottom piece F6, 3A, 8, 2D * Division sign: : backspace - F7 * No twiddly = symbol F8 * No degree symbol F9 * No superior bullet FA * No inferior bullet FB * No square root sign FC * No superior n FD * No superior 2 FE * No superior 3 FF * No macron 0