NNNNNNp NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNN&O`  @`#@%`')+-1 35`79;=?/C@E`GIKMOQ S@U`WY[]a c@e`gikmoq s@u`wy{} @` @ ` @ ` @ ` @ ` ǀ ɠ @ ` ׀  @` @`!Ao  !A!!#A%a')+-3A5a79;=?ACAEaGIKMOQ!SAUaWYO`  @`#@%`')+-1 35`79;=?/C@E`GIKMOQ S@U`WY[]a c@e`gikmoq s@u`wy{} @` @ ` @ ` @ ` @ ` ǀ ɠ @ ` ׀  @` @`!Ao  !A!!#A%a')+-3A5a79;=?ACAEaGIKMOQ!SAUaWYKERMIT NEWs t KERMIT OLD t README DOC t GEMTERM ) t QT F t WTERM  t 1.  s t..  s tASTKER DOC t t  ASTOBJ DEFx t  ASTUUD PRG{ t FKERMIT OPT t !>KERMIT RSC t "P.0FILES TXT t .yASTODE UUD t 0]ASTTTY UUD t 4.ASTUUD ANN t @ASTUUD ASM t A ASTUUD C t JASTOBE UUD t NBASTKER UUD t _ASTOBJ UUD t EKERMIT PRG t ASTKER MAI t "1. GEM ATARI/ST Kermit Author: Bernhard Nebel, Technische Universitaet Berlin Contributions by: Bill Catchings, Bob Cattani, Chris Maio (Columbia Univ.), who wrote the 'minimal' C-Kermit and Glean Seaton, Robert A. Larson, who modified from UNIX Kermit to OS9 Kermit Language: DRI C Documentation: Bernhard Nebel Version: 1.02 Date: June 1986 GEM Kermit capabilities at a glance: Local operation: Yes Remote operation: No Transfer text files: Yes Transfer binary files: Yes Wildcard send: Yes ^X/^Y interruption: Only simple abort Filename collision avoidance: Yes Can time out: Yes 8th-bit prefixing: Yes Repeat count prefixing: No Alternate block checks: No Terminal emulation: Provided by accessory Communication settings: Yes (RS232 par. by accessory) Transmit BREAK: If accessory can Handshaking (for IBM): Yes Transaction logging: Yes Session logging: Yes Raw transmit: Yes Act as server: No Talk to server: Yes Advanced server functions: No Advanced commands for server: No Local file management: Yes Handle attribute packets: No Command/init files: Yes (only for non-RS232 par.) Command macros: No GEM Kermit is a program that implements the KERMIT file transfer protocol for ATARI/ST micros running GEM. It is written in DRI C. The implementation is based on OS9 Kermit, Version 1.5, a modified 'minimal' implementation of Kermit in C. The main advantage of GEM Kermit compared with DRI's Kermit is that it is able to talk with IBMs and that it uses the GEM user interface. 2. Program operation GEM Kermit can be evoked as any other GEM application just by clicking on the icon twice. A resource file 'KERMIT.RSC' has to be present in the same directory as Kermit resides for proper opertation. Otherwise the program will abort with an error message. If a file 'KERMIT.INI' exists it is used to setup the communication parameters (except for RS232 parameters). After the program is started the familiar desktop and a menu bar should appear on the screen. Now you can start to transfer everything back and forth between your ATARI/ST and other machines. If it does not work, you probably forgot to connect both with the appropriate wires (use the RS232/modem plug!), or some communication parameters are wrong, or you are really stupid (or there is a bug in the program). In any case it might be helpful to study the next few chapters. 3. Commands Kermit commands are evoked by selecting a drop down menu item. These items will be discussed briefly in the following. 3.1 DESK menu That is the familiar DESK menu. The first item (KERMIT-Info) tells you something about the program itself and how I can be reached by e-mail. The other items should give you the capabilty to configure the RS232 interface and to open a virtual terminal connection to the other computer. You need both of these accessories because GEM-Kermit cannot set the RS232 parameters by its own and it does not supply a virtual terminal! By the way, for users of IBMs I included an IBM terminal accessory which works in line mode. The messages of this program are still in German, therefore you either have to change and recompile it, or you have to learn German. 3.2 FILE menu This menu gives you the ability to DELETE, RENAME and TYPE files. Files are selected by the standard file selection dialog box. Be aware that wilcards in a delete command do not have the expected effect, but they will select the first file matching the specification. Additionally, you can get information about free space on a disk. And of course, the QUIT command is also present in this menu. 3.3 TRANSFER menu All transfer commands (SEND, RECEIVE, GET, PUT, LOGOUT server, QUIT server) can be found in this menu. Files and directories for these commands are again selected by the standard file selection dialog box. SEND and PUT handle wildcards in the right way. RECEIVE and GET will use a file specification as a name for the first file to receive, all other files will be stored under names sent by the remote host. If you do not input a file name also the first file transferred will be stored under the name provided by the remote host. In any case the files are stored in the selected directory. 3.4 OPTION menu In this menu commands for changing switches (e.g. BINARY TRANSFER, IBM MODE), starting and stopping logs (DEBUG and SESSION LOG), saving and restoring parameters (SAVE and RESTORE STATE) as well as for evoking a parameter changing dialog are found. The details of these commands are not provided here, the interested user will find information about these in other Kermit publications or will learn how to use them by trial and error, hopefully. The only thing I will mention is that the RS232 communication parameters (e.g. baud rate, byte format) are not included. They must be changed using the appropriate accessory. 4. How to install GEM Kermit If you got the program and the resource file (for German or English) as a binary excutable file, perhaps as a uudecoded file, everything should work out fine. Otherwise all the files with the AST prefix have to be compiled and linked (using ASTKER.INP). The resource file must be renamed to KERMIT.RSC and you are ready. Currently, the following files are necessary: ASTKER.C main program ASTFIO.C file I/O on the ATARI ASTGEM.C GEM interface ASTGMO.C GEM interface for changing options ASTGMT.C GEM interface for transfer ASTGCM.C QUIT/LOGOUT server ASTGET.C GET from server ASTSEN.C SEND protocol ASTREC.C RECEIVE protocol ASTUTL.C utility functions for Kermit protocol ASTINC.H common include file for all Kermit modules ASTOBJ.H object definitions for GEM Kermit ASTKER.INP input file for link batch file ASTKER.BAT link batch file ASTODE.UUE (uuencoded) for RCS (if you want to change the resource) results in ASTOBJ.DEF ASTOBJ.UUE (uuencoded) the German resource file or results in ASTOBJ.RSC ASTOBE.UUE (uuencoded) the English resource file results in ASTOBE.RSC one of them must be renamed to KERMIT.RSC ASTKER.UUE (uuencoded) binary executable results in KERMIT.PRG The following files of the DRI C kit have to be modified: GEMSTART.S enlarge stack to 2k bytes and assemble DEFINE.H introduce the definition of NULL as 0L and change NIL to 0L The above mentioned IBM terminal accessory consists of the following files: ASTTTY.C source file ASTTTY.UUE (uuencoded) binary results in IBMTTY.ACC 5. Problems - When communicating with the TU Berlin IBM you better select 8-bit mode, because otherwise the '{' will be eaten. This is not an bug in Kermit or GEMDOS but the IBM sends '{' without setting the sign bit. - If you move the mouse during a transfer, it can happen that key clicks appear. I don't know why. 6. Wish list I spent a lot of time to adopt OS9 Kermit to GEM. As a matter of fact, I wrote more code than I used from the original program. Finally, I discovered that it would have been worth the effort to use the more recent C-Kermit. However, it's done now. If there is anybody out there, s/he is invited to adopt C-Kermit to GEM using my first hack. Besides that, there are a lot of other wishful improvements I probably will not work on: - GEM Kermit seems to be rather slow on fast connections, i.e. 100-150 bytes/secs on a 9600 baud connection. - It would be nice to get the logs on a scroll window. - The RS232 parameters should also be saved and restored by the STATE SAVE and RESTORE commands. However, I was not able to figure out how this could be done. KERMENUMDESKMFILEMTRANSMOPTIONTSENDTRECEIVETGETTFINISHTBYE"OBINTRAN#OTRANLOGKERPARAM ABOUTKER(OFILWARN*OHANDSHA)OPADDING+OPARCHAN&OPARSAVEKPSPCKLKPRPCKLKPSTIMO KPRTIMO KPSEOLKPREOLKPSPADCKPSPCKSTKPRPCKSTKPRTURNKPSQUOTEKPRQUOTEKPEXITOKKPABORTKERDISPLKDSENDKDRECEIVKDFILNAMKDCNVFIL KDFCNTKDBCNTKDPNUM KDBPSKDNAKCNTKDTIMCNTFDELETEFRENAMEFQUIT KPMAXTRYKRABORTKRABOKKRABMESS%ODEBUGSKPPADLSKRINIERRKRABOUTKRABOUOKKRFILEXKRFILNEX,OPARGETKRDABORTFTYPETPUTKERNYIKRMDOTYPKRMDODELKRMDORENKRMDORE2 KRMESSS MSMORE MSEOFKRDELDONKRRENDON KRODOSAV KRODOGETKRDELERRKRRENERR KRTDOSND KRTDORECKRTDOPUTKRTDOGETKRTRAERRKRODODEBKRODOTF KRDBCLSD KRTFCLSD KERRFOPN KRSAVDONKRGETDONKRDEBDONKRTFDONKDPCNT MSGSNDBG MSGFILNX MSGSNDRD MSGSNDFD MSGERRPK MSGTLNPS MSGDATPS MSGTLNPR MSGDATPR MSGCHKER MSGUSRAB MSGTIMOU MSGDSTAT MSGTRAER MSGSTATE MSGFOPN MSGERRFO MSGSFASF MSGTREOF MSGFNEXT MSGNEWFI KRCONFAB KDSENDSKDRECEISKRAVMMSKRAVDAT MSGWOPER MSGERSNA MSGPROER MSGRECRD MSGFATFE MSGFRASFKRPROERRKRWOPERRKRFATFER !MSGRECBG "MSGRECFDFDFREEKRDFREEKRDFIDKRDFBYKRDFOK MEGHNDFA"KRDRDYOK!KRDRFCTI MSGCHSND MSGCHFLU #MSGCHRD $MSGCHPAD %MSGCHWHC &MSGHNDOK-OTIMOUTKRTASKGKRTGFILNKRTASKOKKRTASKAB#KDFINISH$KDBYE 'MSGGETBG (MSGGETRD *MSGGETFD )MSGSRVFI /MSGFINRD -MSGFINFD .MSGSRVBY 0MSGBYERD 1MSGBYEFDKSVFERRKSVBERR`E &o#=AB(HSB$H  g  g  f RSBj` g =g %gJ`Rpr A9nA0m/ПЁRSBk`Jg n <#@`zRpr A9nA0m/ПЁRSBkT`JgN n <#?x`8C=x`C=XrRSBk$  g  g  gQp`JBkQB"+ҫ @$9?xf $` n$<&ւֹ@// Bg?<JNAJg0<`< .A@#=#=#=N/ KP,MNpN$??<LNA` /`NV, o$Hy= n /(a^P#@X S` #A4@ g Hy=HyAdN Pp/N (X/9@pP/Hn,N4O Jf Hy=HyAdN Pp/N (Xp/Hy=Hn,NHyAdN Pp/N (XN^NuNV/.pP/HnN4O JfHy>HyAdN P`F.HH ?-@Jo*A-HJo/./. /.aO XW`N^NuNV nHH ?(HH ?/A聀"/(HH ?/B䂂$/(HH ?-@-A-B m. n "(S!AJk "PRHH`/. /.NP m2 n (S!@Jk"PR .HH`/. /.NP m2 n (S!@Jk"PR .HH`/. /.NPN^NuNVB .lL n (S!@Jk "PRp` /.NX-@Rf .N^Nu n .R` .N^NuNV/. /.N P-@Jf/.Hy>aP` .N^NuN^NuNV/9=Hy>/HyAdN O /. /.HyAdN O p/N (XN^NuNVB@p#@ @l nHHR"@?gR` nJgZ 9@R@ @@  nHHJgR"@?fR` nrR@JfpNqHyA4Hy>4Hy=XN O 9=x-@ >g"HyALHy>6Hy=xN O -@` HyALHy>8Hy=yN O -@HyAdHy>;Hy>:N O -@Jf p/N4XJf/.Hy>=N FPp/N (X/9?NX//.N P n(@Jf/.Hy>TN FPp/N (XHy@/9@NPBN (XN^NuNVB 9A8S#A8Jkp yA4RA4`HyA4NX-@ g, f nRB` nR .`JfpN^Nu nB .N^NuNVB . S".lL n (S!@Jk "PRp` /.NX-@Rg nR . fNq . nBJfpN^Nu .N^NuNV nHHR-@Jg:"9ATS#ATJk yALRALHH`HyAL/.NP` 9ATS#ATJk yALRALp HH`HyALp /NPN^NuNVB nHHR-@Jg4 n "(S!AJk "PRHH`/. /.NP-@` .N^NuNVH A-H n JgHHR-@-H %f %f gJfV n@`\.gp`p nHH`8.gp`p` nHH` nBp#?|pN^Nup n@ nJf n|B .N^NuB . lFr NlR//.N= PJf .r Nl"nPR`.g /.N X.gp` . //.NP n!@J=g@ . JgB/.NP n!@J=gJp#?| nBpN^Nu .  f$ n/(N Xp#?| nBpN^Nu .N^NuNV . ". ///.azO N^NuNVJjp#?|pN^Nu/.aX-@JfpN^Nu n(HH dN``` ``/./. n/(N O -@J=g JfpN^Nu ng .N^Nup-@-@ .lZ n R@HH g f$ .Sr///.aO .N^Nu n R`JfJfB .N^NupN^NuNVJjp#?|pN^Nu/.aX-@JfpN^Nu n(HH drN``` ``P ngp/B/.aLO ng0/./. /(N!6O -@J=gpN^Nu .N^NuB.p-@-@-@ .l n R@ f . g | S nC .R.-@A m/HyC n/(N!6O -@갮gpN^NuJ=gpN^NuB`hJg:/.HyC n/(N!6O -@갮gpN^NuJ=gpN^Nu .N^Nu .N^Nup#?|pN^NuNV/.aX-@JfpN^Nu n(JgpN^Nu/./. n/(N!|O -@J=gp#?|pN^Nu f`JgZ nfN .S-@Jk4B/./.afO Jgp/Hn/.a\O JfS` .RN^Nu .N^NuNV/.aJX-@JfpN^NuB n/(N XJ=gp-@ nB .N^NuNV/.N XJ=gpN^NupN^NuNV/.aXN^NuNV/. /.NPN^NuNV .=opN^Nu y= .ѹ== N^NuNV/.aX-@JgN^Nu | N^NuNV 9==ѹ=#==#?#?#?#? N^NuNVaL /./9?`-@aP n-@Jfp-@ . dN```8`R``J f`A"n#H`4  fDA"n#H`  f(A,"n#H`A"n#H`  fA"n#H`A2"n#H`  f. .r/@B///r/r/N;O #=J=WDHHLN^NuNV .r/@///r/rA/N;O#=JWDHH N^NuNVJfB/./. /.aON^Nu"n iB/./. / NON^NuNVJfp//./. /.adON^Nu"n ip//./. / NON^NuNVH Jf pLN^NuAL$n"jg pLN^Nup". /. n/(/. /p/pB/N;OLN^NuNVJgp@`p?r$.". v/A////./ n/(v//-@N;O-@Jj #=pN^Nu .N^NuNVBp/N;P n pN^NuNVB .l& n HH/r/r/N;O R` .N^NuNVB .l& n HH/r/r/N;O R` .N^NuNVv . lS`p}@A r//r/r /N;Op /p/p/N;O .HHr-Ax-@| .|T".xl>6@w f| w .wf .xUDN^Nu .xU n wRx` .| }l n  .|RN^NuNVB .lP n @HH fp /p/p/N;O .HH/r/r/N;O R` .N^NuNVJg .`pN^NuNVB . n*r NHHR @-H?f %f n  %f: yDHHRD-@ n?f %g .N^Nu n  *g -nX`BR B/.HnHz/. N'O-@Jg-@ fJgRJo .N^NupN^NuJgSDJfD .N^Nu yDHH-@RD n?f .g .N^NuR` .N^NuNV yDHHRD-@JfpN^NuNVp nHHR A?-@-@gB .r N 9n8i 3F <)i/gRi`a:<) ҆Bц` .f Jif`Ri` eg efNa +g -f ia 0m. 9n(:)iFi im?)_ f $hB`4)?)_gDBi/gT3|?Jk Si`Jig ktia\adSi`aRi`t4)?)_gN:$h$$$h$p0)L~NYNXNu,(g !|NuH$hN<L?3FS fiNu?)_g|Nu-"gHAHIANu/JgLQA/gRA/fJjR`SAgAo Al&I?HA_HABA$Nu/<N;B`/<N; <JjO`9$fprt`"HBHBB/t Q$Nu//gdB Jf BB /g$RB/fJjRd R`SBgBo Bl(J?BBHB_HB&Nu/<N;p`/<N;0<HBBH@B@Or`NV#DN^NuNVH*OB=pn@N?.*?.&?."?.?.?.?.?. NA.ML?N^NuH<*g2jD(g(jDBv㒴eRQ"jDjD`BBL@ .  "   d    Pb::$  :":V:l&$@j$&:P(J.z   H $ , Xd`$  J $0 4" & 0  D &B 4 T<@HD(n,$ TD 6 (.>&2f( 0$ X&2`:D@.x.*5E 5E 0 F A A 0 0 1 0 1 1 1 0 D D 23 23 11 444$.E.P Desk File Transfer Options KERMIT-Info-------------------- Desk Accessory 1 Desk Accessory 2 Desk Accessory 3 Desk Accessory 4 Desk Accessory 5 Desk Accessory 6 Delete... Rename... Quit------------------ Type... Free Space... Send... Receive... Put(Server)...------------------- Get(Server)... Quit(Server) Logout(Server)------------------- Binary Transfer Session Log...---------------------- Debug Log... Save State...---------------------- File Name Warning Padding IBM Mode Change Parameters... Load State... TimeoutDelete ...Rename ...New Name ...KERMIT Communication ParametersSendReceivePacket Length____99____99Timeout(sec.)____99____99Retries(count)____99EOL(hexcode)____NN____NNPadding(hexcode)____NNPadding(length)____99Packet Start(hexcode)____NN____NNHandshake(hexcode)____NNQuote(character)__X__XOKABORTSendReceive____________________________________________XXXXXXXXXXXXXXXXXXXXXXFile:____________________________________________XXXXXXXXXXXXXXXXXXXXXXLog. name:______________XXXXXXXFiles transferred:__________XXXXXBytes/sec.:__________XXXXXErrors:__________XXXXXTimeouts:______________XXXXXXXBytes transferred:____XXPacket id:ABORT______________XXXXXXXPackets transferred:Get(Server)Put(Server)TIMEOUTREADYQuit(Server)Logout(Server)OKNEBEL@DB0TUI11.BITNETBernhard Nebel GEM-KERMITxxxxVersion__.__9999xxxxxx__-__-__999999This program is public domainsoftware and is distributed freely.The KERMIT protocol was developedat Columbia University, New York.The remote host stopped transferringand sent the following message:________________________________________________________________________________XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXOKType ...--- MORE ------ EOF ---Start sending. Path='%s',File='%s'Sending successfully completed.***No such File.***Error message from remote host: %s.Sending aborted.SPACK: type=%c, len=%2d, num=%02xSPACK: data=|%s|***Checksum error: rec.=%02x exp.=%02x***User aborted.Timeout while receiving.SWITCH: state=%c num=%02x***Remote host does not respond.***Fatal state error.File '%s' opened for sending.***File cannot be opened.File '%s' will be sent as '%s'.File '%s' completely transferred.RPACK: type=%c, len=%2d, num=%02xRPACK: data=|%s|Looking for next file ...Next file will be '%s'.***Fatal protocol error.***File '%s' cannot be created.File '%s' exsists. New name: '%s'.Receiving successfully completed.***Fatal file I/O error.File '%s' will be received as '%s'. -> sent: <0x%02x> |%c|No handshake character received. -> flushed: <0x%02x> |%c|Start receiving. Path='%s', File='%s'.Receiving aborted. -> after %d sec. recv.: <0x%02x> |%c| -> padding: %d * <0x%02x> -> waiting for handshake <0x%02x> |%c| -> Handshake character received. File %s requested (Path=%s, File=%s).Getting successfully completed.Quitting(Server) requested.Getting aborted.STRINGQuitting(Server) aborted.Logout(Server) requested.Quitting(Server) successfully completed.Logout(Server) successfully completed.Logout(Server) aborted.Save state ...Load state ...Send ...Receive ...Put ...Get ...Open debug log ...Open session log ...AFree disk space on _:F________________ Bytes99999999OKGet from remote host________________________________________________________________________________XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGet following file from remote host:OKABORT[3][Error on writing|to state file.][ABORT][3][This file already exists.][ABORT][3][This file does not exist.][ABORT][3][Not yet implemented.][SORRY][0][File renamed.][OK][0][File deleted.][OK][3][Error while deleting file.][ABORT][3][Error while renaming.][ABORT][3][Remote host does not respond.][ABORT][0][Debug log closed.][OK][0][Session log closed.][OK][3][Error while opening file.][ABORT][0][State saved.][OK][2][Really abort transfer?][CONTINUE|ABORT][0][State loaded.][OK][0][Debug log started.|Level of logging:][Packets|Characters][0][Session log started.][OK][3][Fatal error in protocol.][ABORT][3][File cannot be created.][ABORT][3][Fatal error while|doing file I/O.][ABORT][3][Quitting of Server aborted |because of transmission errors.][ABORT][3][Logout of Server aborted |because of transmission errors.][ABORT]|,Cj*Vm@   ()*-03@A BEHKNQTefgjmp   #:QWXYp   "(23 4<DLabcfilwx    %&'56p7<I NU^ e$""%:; <=>?h)) | ~     #))Lqr%PP $ + 2  = !P  G U j $! 4>K\p "- #$%&' ()%*9+C,N -e ! u         . 4Pl "   "   0" L  h"  " ", "Hd  "  "!% $&   ( D `  |           $@ \x    y     <! X" # $ t  !    !!   8     T  p     2 $   ('  +N  ""3&Z k!   &       * @ ^ x ! !  ) ) ) 8% X%" {)! ) )# )   ) ! ) " 0#&# W) $ j# '% )& "(' )"( #&) !%* A)+ ]&,1N- n. u/ 0 (1 &+     /  8   D L T g 4P' 1  l ($s %v @p!X$& &&+++, ,P,,,--pbegin 777 ASTOBJ.DEF M * )+15)-14Y5 P$ 341%4TL 0! $U&24Q% M % 0!-5%)!3E, !@$ 34]05$E/3@ !D! %13 M14Y$ : 0!44D5#14E610 '0$ 5$=%5 !X! M %1&24Y)4T@ ? 0!40EE% (@$ 3T))3E1204X M ",! $]44D%.3$]' $ -+15)005)!30 "0$ 04)/551+15( M "@! $]&24Q705). J 0!/2$%.1%-(00 *0$ 3U!!1$1) M3D< "L! $]005)#2$%. F 0!/4$%24T%610 $!0$ 2U!3 M4$-+3 ! 8! $M04E!#2TP 0( 0!+4%-424U/ $"0$ M2U!25$E-3P ! T! $M04T5/3 0. 0!+4%)%3TP $ M$ $ 2U!34$%$0P !!0! $M04U!#2U-4 05 0!+4%)00TM35 M $%P$ 2U!25%523@ !!D! $M04U%53U1% 0: 0!+4%)154]4 M10 $&P$ 2U!%6$E43TL !!P! $M004)/4E0 % -+15)$ M25-03 % 0$ 2T1314Y$ !0(! $M$4D5#14E6 4$ 0!+ M1$9)3$Y!30 %!P$ 2T1#3E9&24P !0H! $M$1D-.5 46 M 0!+1$)#3E0 %&0$ 2T103E5- !0T! $M$0E!3 M 40 0!+1$Y!2T-.5 %$P$ 2T1424U#3E0 !(! $9$14Q%5$4 M 3 0!&4D5.04U% % $ 1E%5250 ! L! $M034%8 M5%)9 ' -+4D%"3U)4 '!0$ 2U)!0D]+ !P0! $M2 M04)-15-3 E 0!/1$5"54< 4P $$@$ 2U!0041, %, M!$M224Y)15)2 & %+4D%"3U54 & @$ 2U)!0D]53TL M $ !$M21DE,15@ " 1+4D9)3$Y%6 + $ 3U!!4D=%5 M !1L! $M21$%"3U)4 6 0!&5%E010 &P$ 5%!55 M , !$M%4DY920 ( %+4DU$3U194 0 !2U)- M1$]$14P ( 4M2341/4D5. # %+4DU$3U)%,@ "0 # M2U)-15-34P "0$! $U334]210 D" 0!-4T5/1@ M!0 $2U)$14Q$3TX 0 !$M24D5.1$]. * %+4D]$3U-!5@ M "P !2U)/1$]'150 8 !$M21$5,15)2 ' 1+4E)%3D52 M4@ # !2U)41$]33D0 T 4M25$1/4D5# . %+4E1$ M3U!55 #P !2U)41$]'150 @ !$M25%)!15)2 0 %+ M4D]$3T1%0@ $0 !2U)/1$]41@ D !$M21$)#3%-$ * M 1+4E1&0TQ31 "P $2T524D9/4$X P !$M24T%61$]. M . 1+4D=%5$1/3@ #P $2U)$14)$3TX ! !$M25$9$3TX M 4= 0!+1%!#3E0 ) P$ 35-'4TY$0D< "04! $U31T9) M3$Y8 D$ 0!-4T=33D121 )!P$ 35-'4TY$1D0 "08! $U3 M1T524E!+ D( 0!-4T=43$Y04P )"0$ 35-'1$%44%, "10! M $U31U1,3E!2 D5 0!-4T=$05104@ )"@$ 35-'0TA+15( M"0L! $U31U534D%" D, 0!-4T=424U/50 )#0$ 35-'1%-4050 M "0X! $U31U120452 D/ 0!-4T=35$%410 )$ $ 35-'1D]0 M3@ "1$! $U31T524D9/ D2 0!-4T=31D%31@ )$P$ 35-' M5%)%3T8 "18! $U31T9.15A4 D7 0!-4T=.15=&20 #0 $ M2U)#3TY&04( !2 ! $M$4T5.1%, 4? 0!+1%)%0T5)4P & M!P$ 2U)!5DU- %, !@@! $M2059$050 D9 0!-4T=73U!%4@ M )&@$ 35-'15)33D$ "1@! $U31U!23T52 D; 0!-4T=214-2 M1 )' $ 35-'1D%41D4 "1T! $U31T9205-& 1 1+4E!2 M3T524@ $@ $2U)73U!%4E( !, !$M21D%41D52 DA 0!- M4T=214-"1P )(@$ 35-'4D5#1D0 !"B\\ G?"\\ GZB\\ HADZY M 30M_\ ##/ HB#U\ '__F 4,&[__M'(T?P ">>,+P 5)N__X, M;@ *__YMY#/\ ( ">R+KP "?L+SP "B(+SP ">>3KD \84(\NO M*&(O/ *(PO/ *, O/ *+X_/ $0F=.N0 %'#?_ !!.7DYU3E;_ M_$*7/SP! $ZY 3A%2/80 P$I 9@9"0& +(^N0 *&(_.0 *(P_.0 M*, _.0 *+Y"9TZY 3R%"/,\ "B*/KD "AB/SD "B,/SD "C /SD M "B^/SD !X*/SD "=\/SD "C /SD "B^3KD !*>W_P ./KD "AB M/SD "B,/SD "C /SD "B^/SD "B*3KD !0"4(\^N0 *(A.N0 #K0^ MN0 *(A.N0 #50^N0 *(A.N0 #H)P 4Y>3G5.5O_\+KP "?L0F<_.0 M*(A.N0 $"18CS Y G[%) ,\ !SJ,_D "C <[# Y 3G5.5O_\/KD "B(3KD M [F85@^N0 *(I.N0 %#P^N0 *(I.N0 %%8^N0 *&(_.0 *(P_.0 M*, _.0 *+X_.0 '@H_.0 )WP_.0 *, _.0 *+Y.N0 $O#?_ Y. M7DYU3E;__"Z\ E:"\\ 3G5.5O_\/JX "#\\ 9.N0 %/Q4CTY>3G5. M5O_\+JX "#\Y HB$ZY -ZE2//KP #6',/KP "F'&3EY.=4Y6__P^N0 M*(A.N0 #50^N0 *(A.N0 #H(NO %N1AMBZ\ 6^V&N+KP !<28:8N MO %REAGBZ\ 7*F&6+KP !=888XNO %XAAABZ\ 7JV$ _WXNO M%\UA /]T+KP !?W80#_:BZ\ 8*6$ _V NO &%YA /]6+KP !B+80#_ M3"Z\ 8M&$ _T).7DYU3E;__& */KP TZY 4_#Z\ !).N0 %/Q*@&;H M3EY.=4Y6__P^O #_/SP !DZY 4_%2/2H!F[$Y>3G5.5O_X(&X "$(0/KP M_S\\ 9.N0 %/Q4CRU __QG(" N__S O /\B;@ ,$H @+O_\/KD "B(3KD Y0 M/J[_^C\N__P_.0 *(A.N0 $/18CTY>3G5.5O_\/KD "B(3KD VX3EY. M=4Y6__@NCEF7+PY5ES\Y HB$ZY /F%R/,"[__+!N AM##ZY HB$ZY M -ADY>3G5.5O_Z/6X "O_^8!P@;@ ,,F[__M')(FX ##1N__[3RA%1 %3 M;O_^,"[__K!N ALVDY>3G5.5O_Z/6X "/_^8!P@;@ ,,F[__M')(FX ##1N M__[3RA"I %2;O_^,"[__K!N IOVDY>3G5.5O_Z0F[__F :(&X ##)N__[1 MR2)N @T;O_^T\H0D5)N__X,;@!0__YMWDY>3G5.5O_\(&X "%-0; H@;@ ( MEB/(&X "# 0(FX "%)14F[_ M_CZN__PP+O_^T5=A /W$8 RA N__A(@& *@^O -80#ZV' !8 #!$IN M__YF!F$ _21@0#ZN__PP+O_^T5=A /VB+JX #"!N A34# 0/P!3;O_^/R[_ M_F$ _?)8CRZN P@;@ (/Q!35S\N__YA /ST6(]@8B!N @P$+!N__YF!F$ M_-!@+BZN P@;@ (4U P$#\ /R[__F$ _;!8CRZN P@;@ (/Q!35S\N__YA M /RR6(]@(&$ _)I@&F 8L'P "&< _V*P? -9P#_3+!\ ']GH&#@8 "3! N M__9(@& BQ"0& D!*;O_^9@9A /Q@8!(^KO_^,"[__-%780#\WE-N__Y@ M (:(&X "# 0L&[__F8&80#\.& 2/J[__C N__S15V$ _*)2;O_^8 !\B\N M @O/ 'R1A /UP6(\P0-'((GP "B.,#"8 "!?,( ]0/_^+JX ## Y ? M),'\ %#0O 'R8O &$ _0Y8CSZN__P_+O_Z/SD "B(3KD !#T6(\NK@ , M(&X "#\04U="9V$ ^\98CSZN__PP+O_^T5<_+O_Z/SD "B(3KD !#T6(]@ M %F+RX ""\\ ?)&$ _018CS! T<@B? *(XP,)@ (%\P@#U __XNK@ , M,#D !\DP?P 4-"\ ?)B\ 80#\@EB//J[__#\N__H_.0 *(A.N0 $/18 MCRZN P@;@ (/Q!35T)G80#[.EB//J[__# N__[15S\N__H_.0 *(A.N0 M$/18CV -IA /CF+HY9ER\.79<_.0 *(A.N0 #]Y#Z\ '=A /=P80#WJF$ ^$1A /AB8 >BZ.!I?___^P+PX&E____ZYA /M, M6(]*0&=@+HX&E____[ _+O^N80#_;%2/2F[_KF<\,'D "=^T3G5.5O_H8$PNC@:7____[$ZY 20 QN "C_[&8V,"[_]+!Y 3G5.5O_\,_P 90 *&9">0 *&A">0 M*&PS[@ ( H3G5.5O_\,_P !0 *&9">0 *&A">0 *&PS M_ ( H<#/N @ "AR3KD !%,3EY.=4Y6__PS_ % H9D)Y H:$)Y M H;#/\ < "AP,^X " *').N0 $4Q.7DYU3E;__#/\ 4 "AF0GD M "AH0GD "AL,_P !@ *' S[@ ( H3G5.5O_X+7P !T* M__P@;@ *$!!(@")N__PR@%*N I4KO_\2D!FYC/\ 4 "AF0GD "AH("[_ M_)"\ ="H'\ )(P%- ,\ "AL,_P # *' S[@ ( H M3G5.5O_\,_P !0 *&9">0 *&A">0 *&PS_ * H<#/N @ "AR3KD M !%,3EY.=4Y6__PS_ % H9D)Y H:$)Y H;#/\ D "AP,^X " M*').N0 $4Q.7DYU3E;__#/\ 4 "AF0GD "AH0GD "AL,_P P *' S M[@ ( H3G5.5O_\,_P !0 *&9">0 *&A">0 *&PS_ " M H<#/N @ "AR3KD !%,3EY.=4Y6__PC[@ ( #DY>3G5.5O_\(_P !T* # '-@C_ )GP !S<3EY. M=4Y6__PS[@ * ="BZN !!.N0 $3@NK@ 43KD !%"(^X # '-0S_ !M M H9C/\ 0 "AH,_P 0 *&PS[@ ( H3G4C[P $ H=$YU(^\ ! *'A. M=2/\ H9@ ',PB/ ',QPT,H!2 MKO_Z4F[__@QN 3__FW:+KD "A>3KD 40D P.0 )]Q.7DYU3E;_^B/\ M GM 'PPC_ )X !\0(_P ">\ ?%"/\ GW 'Q@C_ *'X M !\<(_P "BZ ?("/\ ?# *%X^O *80#_1C/Y GW *&1P 4Y> M3G5.5O_\/KP $V$ _RIP 4Y>3G5.5O_\(^X " *'X^O 73KD !%B3EY. M=4Y6__PS[@ ( GO#/N H ">^/KP &$ZY 18DY>3G5.5O_\,^X " M)[PC[@ * H?CZ\ #1.N0 $6).7DYU3E;__#/N @ ">\,^X "@ )[XS M[@ , GP#/N X "?",^X $ )\0S[@ 2 GQC/N !0 "?(,^X %@ M)\H^O !)3KD !%B3EY.=4Y6__PS[@ ( GO#/N H ">^,^X # )\ S M[@ . GPC/N ! "?$,^X $@ )\8S[@ 4 GR#/N !8 "?*/KP 2DZY M 18DY>3G5.5O_\/KP 34ZY 18B!N @PN0 )]X@;@ ,,+D "?@(&X M$#"Y GXB!N !0PN0 )^1"0# Y GW$Y>3G5.5O_\,^X " )[PC[@ * M H?CZ\ $Y.N0 $6).7DYU3E;__#/N @ ">\(^X "@ *'X^O C3KD M !%B3EY.=4Y6__PS[@ ( GO#/N H ">^,^X # )\ S[@ . GPC/N M ! "?$/KP 9$ZY 18DY>3G5.5O_\,^X " )[PS[@ * GOC/N P M "? ,^X #@ )\(S[@ 0 GQ#Z\ &5.N0 $6).7DYU3E;__#/N @ ">\ M/KP 9DZY 18DY>3G5.5O_\,^X " )[P^O !G3KD !%B3EY.=4Y6__PS M[@ ( GO#/N H ">^/KP :$ZY 18B!N PPN0 )]X@;@ 0,+D "?@ M(&X %#"Y GXB!N !@PN0 )^1"0# Y GW$Y>3G5.5O_\,^X " )[P^ MO !K3KD !%B3EY.=2/? B!V;W)H86YD96Y=6T%B;W)T70 J*BHJ*BHJ M*BHJ*BHJ*BHJ*BHJ*BHJ "H@24)-($)L;V-K(%1EG5R@6-K('IU;2!$ M97-K=&]P @($E"32!497)M:6YA; !?8W)YA?;6]V95]R::( &4E]M;W9E7VQEH@ 9F7W-H:69T7W*B M!II?I?=E]E96]L *( . M4%]V7V5E;W, H@ Z"7W9?96YT97*B #K1?=E]E>&ET7Z( .YE]V M7V]P;G9WH@ \87W9Q7V-H8V6B #YA?=G%?8W5R8:( /WE]V<5]E M>'1NH@ ! D7W9R;U]C<'FB $)A?=G-?8W5R8:( 0]%]I7W!T<@ MH@ !$X7VE?<'1R,@"B $4)?9W-X,0 *( 13%]G*( 2+E]E=FYT7VUEH@ !) 7V5V;G1? M=&FB $EI?9F]R;5]A;*( 2?%]G7V=R869?0 "A '/I?:6YT:6X *$ M ="E]G;%]H8F]XH0 !X*7VEN=&]U= "A '@Q?8P *$ ? M#%]L87-T7V5NH0 !\D7W)I;F=?8G6A 'R9?875X7W)E8Z$ E9E]S M8W)N7VUFH0 "5H7W!T'1?96ZA )WY?9VQO8F%L *$ G@%]W;W)K7VEN MH0 ">>7V-O;G1R;VRA )[1?:6YT7VEN *$ GO%]I;G1?;W5TH0 M "?<7V=L7VAC:&&A )^I?=V]R:U]O=:$ G[%]A9%]C H0 "A> M7VAD97-K "A *&)?9VQ?87!I9*$ H9%]C;VYT8@@*"A8*!! & M!@@8$@P@$!8&!@@&$ 8&" @&$ 8&" @&$ 8&" @&#B0&"@X(" 80!@8(" 80 M!@8(" 80!@8(" 80!@8(" 80"! (!@@*!@H&! 8$!@0&!! &!@@(!@H*$ 8& M" @&"@H.! 8$"! (" 8(" 8&! 8$$ H*" @(" @&!@00" @&" @(!@P*" 0& M$A0@& 8(#@0&! 8$!@0&! 8$!@0.!"0*$ @*$ @*$ @(" @(" @*$ @(" @( M" @*$@H*"@H($ @*$ @*$ @(" @*$ @(" @*$ H0"A ("@H*"@H($ H*" @( -" @!C 0$! 0$! 0$ @* end Date: Sun, 03 Aug 86 22:35:31 EST From: MOEWS%UCONNVM.BITNET@WISCVM.ARPA Subject: Re: Uuencoded Files and Trailing Blanks Keywords: Uuencoded Files If you use KERMIT under VM/CMS, it is hard to use uuencoded files such as the uuencoded version of ST Kermit, since VM/CMS Kermit removes all trailing blanks when downloading files. Here is a solution to this problem; it is a version of UUDECODE that supplies trailing blanks as necessary, written to run on the Atari ST. It is written in 68000 assembly language, and can be assembled using the public domain assembler, AS68. David Moews MOEWS@UCONNVM.BITNET * This is a UUDECODE program for the ATARI ST. * It can be assembled using the public domain assembler, AS68; * since this assembler does NOT assemble register shifts and rotates, * all such shifts and rotates have been pre-assembled by hand. * Disassemble a file.... * ... print an explanatory message ... pfile pea openm move.w #pline, -(a7) trap #1 addq.l #6, a7 * ... get the line ... lea buffer, a1 move.l #blen, d2 bsr getln * Open file! clr.w -(a7) Open for reading pea buffer move.w #fopen, -(a7) trap #1 addq.l #8, a7 * Check for error... tst.w d0 bmi error move.w d0, d1 Save handle number * Skip over first 10 characters ('begin xxx ') clr.w -(a7) move.w d1, -(a7) move.l #10, -(a7) move.w #lseek, -(a7) trap #1 add.l #10, a7 tst.l d0 bmi erroro * Initialize I/O pointers bsr init * Get filename (terminated with CR/LF) lea buf2, a1 gfloop bsr getch cmp.b #$0d, d7 beq gfdone move.b d7, (a1)+ bra gfloop gfdone clr.b (a1) bsr getch Discard $0a * * Open file! * clr.w -(a7) R/W file will be created pea buf2 move.w #fcreat, -(a7) trap #1 addq.l #8, a7 * Check for error... tst.w d0 bmi erroro move.w d0, d2 Save handle number * ... now the fun begins ... * GEM uses a0; input buffer pointers a2-a3; output ptrs a4-a5; stack ptr a7 * GEM uses d0; d3=byte count in this line; d4=byte count in this 4-character * group -or- char count while reading; * d5=group of 4 characters -or- 3 bytes. * Scratch in d7. * * LINE LOOP * * Get count. If 0, we are done. loop bsr getnn sub.b #$20, d7 Subtract space beq done * Otherwise, get that many characters. clr.w d3 High byte 0 for "dbf" move.b d7, d3 subq.w #1, d3 Correct for "dbf" bsr init3 Reset counters loop3 bsr getch3 bsr prtch dbf d3, loop3 bsr skipnl Skip over junk + $0d/$0a bra loop * * Initialize state of 3-characters. * init3 clr.w d4 rts * * Get another character from a group of 3. * getch3 tst.w d4 bne get32 * Read in another group of 4 into d3; reset count to 3. move.w #3, d4 clr.l d5 *et3l lsl.l #6, d5 get3l dc.w $ed8d bsr getnn sub.b #$20, d7 or.b d7, d5 dbf d4, get3l move.w #3, d4 Set byte count swap d5 Pattern from [0123] to [2301] * Get a character out of d3, decrement count in d2, & return! get32 move.b d5, d7 * rol.l #8, d5 dc.w $e19d subq.w #1, d4 rts * Read until we come to a newline; then skip over $0d/$0a. skipnl bsr getch cmp.b #$0d, d7 bne skipnl bra getch * * Buffered I/O subroutines. Input buffer pointer a2, end ptr in a3; * output buffer pointer a4, end prt a5. * * Sets up. init lea inpend, a2 lea inpend, a3 lea outbuf, a4 lea outend, a5 rts * Get a character in d7.b, EXCEPT that if we are at a newline, get a blank * instead. getnn cmp.l a3, a2 bcc getrn cmp.b #$0d, (a2) beq getsn move.b (a2)+, d7 rts getsn move.b #$20, d7 rts getrn bsr getrec bra getnn * Gets a character in d7.b. getch cmp.l a3, a2 bcc getr move.b (a2)+, d7 rts getr bsr getrec bra getch * * Get a new record into the buffer. getrec pea inpbuf move.l #inplen, -(a7) move.w d1, -(a7) move.w #fread, -(a7) trap #1 add.l #12, a7 tst.l d0 bmi error2 beq done No bytes read, file over, done. * Actual number of bytes read in d0! lea inpbuf, a2 lea 0(a2, d0.l), a3 rts * * Prints byte in d7.b. prtch cmp.l a5, a4 bcc putr move.b d7, (a4)+ rts putr bsr putrec bra prtch * * Dump buffer out. * Compute number of bytes to put out. putrec lea outbuf, a5 move.l a5, -(a7) sub.l a5, a4 move.l a4, -(a7) move.w d2, -(a7) move.w #fwrite, -(a7) trap #1 add.l #12, a7 tst.l d0 bmi error2 lea outbuf, a4 lea outend, a5 rts * * * We come here in case of error. error bsr pmsg bra xit * Here for error after opening 1 file. erroro bsr pmsg bsr close1 bra xit * Here for error after opening 2 files. error2 bsr pmsg bsr close1 bsr close2 bra xit * Here for normal end. Notice that we flush output buffer. done bsr putrec bsr close1 bsr close2 xit clr.w -(a7) trap #1 * pmsg pea msg move.w #pline,-(a7) trap #1 addq.l #6,a7 rts * close1 move.w d1, -(a7) move.w #fclose, -(a7) trap #1 addq.l #4, a7 rts * close2 move.w d2, -(a7) move.w #fclose, -(a7) trap #1 addq.l #4, a7 rts * * * * This subroutine reads a line of input into the buffer at a1. * Maximum buffer length should be passed in d2. Actual count is * returned in d1. The buffer should have one more byte than d2 * (to allow for a zero at the end.) getln movem.l d0/a0, -(a7) * Clear char count clr.l d1 glloop move.w #conine,-(a7) trap #1 addq.l #2, a7 * A BS? cmp.b #$08, d0 beq bs * A CR? cmp.b #$0d, d0 beq crret * Just a plain character ... are we at EOL? cmp.l d1, d2 * Yes, ignore it. beq glloop * Otherwise, store it... move.b d0, 0(a1, d1.l) addq.l #1, d1 * ... and echo. bsr echo bra glloop * A BS --- are we at start of line? bs tst.l d1 * If so, ignore keystroke. beq glloop * Otherwise, decrement counter... subq.l #1, d1 * ... print BS, space, BS to wipe out char move.b #$08, d0 bsr echo move.b #$20, d0 bsr echo move.b #$08, d0 bsr echo bra glloop * A CR --- echo & return. crret bsr echo move.b #$0a, d0 bsr echo clr.b 0(a1, d1.l) movem.l (a7)+, d0/a0 rts * * * Echo --- echoes a character in d0 to the screen. Destroys d0 & a0. echo move.w d0, -(a7) move.w #conout, -(a7) trap #1 addq.l #4, a7 rts * * * openm dc.b 'Enter filename to read: ' dc.b 0 msg dc.b 'TOS error occurred!', 13, 10 dc.b 0 buffer ds.b 51 buf2 ds.b 51 blen equ 50 * Buffer for reading from file inpbuf ds.b $400 inpend ds.b 0 inplen equ $400 * ... and for writing ... outbuf ds.b $400 outend ds.b 0 outlen equ $400 * Codes for GEMDOS conout equ $02 rawcon equ $06 conine equ $07 pline equ $09 fcreat equ $3c fopen equ $3d fclose equ $3e fread equ $3f fwrite equ $40 lseek equ $42 end /* * Uudecode -- decode a uuencoded file back to binary form. * * Slightly modified from a version posted to net.sources once; * suitable for compilation on an IBM PC. * * modified for Lattice C on the ST - 11.05.86 by MSD * */ #include #include char *Progname = "UUDECODE"; #define USAGE "Usage: UUDECODE [file]\n" /* single character decode */ #define DEC(c) (((c) - ' ') & 077) FILE *in, *out, *efopen(), *fopen(); main(argc, argv) int argc; char *argv[]; { int mode; char dest[128]; char buf[80]; /* optional input arg */ if (argc > 1) { in = efopen(argv[1], "r"); argv++; argc--; } else in = stdin; if (argc != 1) { fprintf(stderr, USAGE); exit(2); } /* search for header line */ for (;;) { if (fgets(buf, sizeof buf, in) == NULL) { fprintf(stderr, "No begin line\n"); exit(3); } if (strncmp(buf, "begin ", 6) == 0) break; } sscanf(buf, "begin %o %s", &mode, dest); out = efopen(dest, "wb"); /* create output file - binary output !!! */ decode(in, out); fclose(out); if (fgets(buf, sizeof buf, in) == NULL || strcmp(buf, "end\n")) { fprintf(stderr, "No end line\n"); exit(5); } } /* * copy from in to out, decoding as you go along. */ decode(in, out) FILE *in, *out; { char buf[80]; char *bp; int n; for (;;) { if (fgets(buf, sizeof buf, in) == NULL) { fprintf(stderr, "Short file\n"); break; } n = DEC(buf[0]); if (n <= 0) break; bp = &buf[1]; while (n > 0) { outdec(bp, out, n); bp += 4; n -= 3; } } } /* * output a group of 3 bytes (4 input characters). * the input chars are pointed to by p, they are to * be output to file f. n is used to tell us not to * output all of them at the end of the file. */ outdec(p, f, n) char *p; FILE *f; int n; { int c1, c2, c3; c1 = DEC(*p) << 2 | DEC(p[1]) >> 4; c2 = DEC(p[1]) << 4 | DEC(p[2]) >> 2; c3 = DEC(p[2]) << 6 | DEC(p[3]); if (n >= 1) putc(c1, f); if (n >= 2) putc(c2, f); if (n >= 3) putc(c3, f); } /* fr: like read but stdio */ int fr(fd, buf, cnt) FILE *fd; char *buf; int cnt; { int c, i; for (i = 0; i < cnt; i++) { c = getc(fd); if (c == EOF) return(i); buf[i] = c; } return (cnt); } /* If your library already has this function, use it and nuke the code below */ /* Open a file, aborting on failure */ /* Written by Bernie Roehl, June 1985 */ FILE * efopen(fn, mode) char *fn, *mode; { FILE *unit; if ((unit = fopen(fn, mode)) == NULL) error("Cannot open file %s", fn); else return unit; } extern char *Progname; error(s1, s2) char *s1, *s2; { fprintf(stderr, "%s: ", Progname); fprintf(stderr, s1, s2); exit(1); } begin 777 KERMIT.RSC M 9P!(T$C02-!'< "01VP +@ V 4 $4 !8 "Y0($1E7!E+BXN " @1G)E92!3<&%C92XN+@ @(%-E;F0N M+BX ("!296-E:79E+BXN " @4'5T*%-E2!4'@ 5F5R'AX>'AX M %]?+5]?+5]? #DY.3DY.0!4:&ES('!R;V=R86T@:7,@<'5B;&EC(&1O;6%I M;@ '-O9G1W87)E(&%N9"!I2P@3F5W(%EO7!E/25C+"!L96X])3)D+"!N=6T])3 R> !34$%#2SH@9&%T83U\)7-\ M "HJ*D-H96-K2!T#X@?"5C? !3=&%R="!R96-E:79I;F $ MJ0 !*H P & 1@ __\ "P ! $JP !+, 2[ , !@ !$8 /__ M @ " !,, 38 $V0 # 8 !& #__P 5 $ 3: $X !.8 M P & $1@ __\ !@ & $[ !/@ 3Y , !@ $8 /__ P 0 M!/H 4 %!@ # 8 1& #__P & 8 4, %% !14 P & 1 M@ __\ " ! %%@ !1P 4B , !@ !$8 /__ 8 !@ !2@ 4R M %,P # 8 !& #__P * $ 4T %/ !40 P & $1@ __\ M" ( %3 !6$ 5B , !@ $8 /__ !4 0 !6, 5F %:0 # M 8 !& #__P # , 5L %=P !7@ P & 1@ __\ "P ! % M?P !8< 6/ , !@ !$8 /__ @ " !9< 6L %K0 # 8 !& M #__P 5 $ 6N %N@ !;L P & (1@ __X # ! %O !<@ M 7) , !@ "$8 /_^ P 0 !=@ 7E %Y@ # 8 A& #__@ - M $ 7G %]@ !?< P & (1@ __X #P ! %^ !?D 7Z , M!@ $8 /__ $ 0 !?X 84 &%0 % 8 A& #__P 6 $ 86 M &)0 !B8 !0 & (1@ __\ #P ! &)P !C4 8V , !@ "$' M /__ X 0 !C< 8\ &20 # 8 A& #__P % T 9. &50 M!EX P & (1@ __\ !P ) &90 !H, :$ 4 !@ $8 /__ !X M 0 !H4 :I &J@ % 8 !& #__P D $ :K &S0 !LX !0 & M 1@ __\ (@ ! &SP !O$ ;R 4 !@ $8 /__ "( 0 !O, M <8 '&0 # 8 !& #__P E $ <: '.@ !SL P & 1@ M__\ ( ! '/ !ST <^ , !@ $8 /__ $ 0 !S\ =H ' MD0 # 8 1& #__P I "D U\ -?@ #90 P & 1@ __\ @ 6 M -E@ #9\ VN , !@ !$8 /__ D #P #;H W/ -T # 8 M A& #__@ 5 $ W1 -^@ #B, P & 1@ __\ *0 I .3 M#G$ YR , !@ "$8 /__ "4 ?__ $ !P 9 % M&0 ' ( @ 4 $0 % " 0 ! , !@ 9 @ M !\# 0 $_____P @ "0 8# 0 %_____P @ "L M!@ 8# 0 &_____P @ #( # H# 0 "_____P @ M #T %@ D# 0 @ (0 9 ,! % $P 1 D $ 4 M #_$0 @ !0 " *_____P < $< !0 0 +_____P < M " %4 ! !0 0 ,_____P < &H " !0 0 -____ M_P < '\ # !0 0 ._____P < )0 $ !0 0 / M_____P < *D % !0 0 0_____P < +X & !0 M 0 (_____P < -, ' !0 0 8 !( %P 4 #_$0 " M !( !@ 3_____P < .@ !( 0 4_____P < /0 M ! !( 0 5_____P < 0 % !( 0 6_____P < " M 0< $ !( 0 7_____P < 1H " !( 0 1_____P < M 20 # !( 0 A !D ( 4 #_$0 #@ !, " :_____P < M 30 !, 0 ;_____P < 3X ! !, 0 <____ M_P < 4L # !, 0 =_____P < " 5P " !, 0 > M_____P < 7 $ !, 0 ?_____P < 8$ & !, M 0 @_____P < 9 ' !, 0 8_____P < " :$ % M !, 0 ' "( +0 4 #_$0 & !8 # C_____P < ;4 M !8 0 D_____P < << & !8 0 E_____P < " M =@ ( !8 0 F_____P < >\ ' !8 0 G_____P < M ?X * !8 0 H_____P < " @X % !8 0 I_____P < M B4 ! !8 0 J_____P < CD # !8 0 K____ M_P < D, " !8 0 L_____P < DX ) !8 0 M M_____P < F4 + !8 0 A_____P < " G4 $ !8 M ?__ $ 0 4 $ "$0 !PH% 0 _____P < " G\$ , M H ?__ $ 0 4 $ "$0 @L' 0 _____P < " HH# M 4 H ?__ $ 0 4 $ "$0 ! T' 0 _____P < " M I4% 0 P ?__ $ ' 4 $ "$0 "X $0 "_____P 6 M( $C0 !P ! !\ 0 #_____P 6 $E & # < 0 $_____P 6 M $FP 'P # D 0 ' 4 !@ 6 $H@ !@ $ "( 0 &____ M_P > @ $J0 %P ( 0 $_____P > @ $L ( ( 0 * M @ "0 6 $MP !@ % "( 0 )_____P > @ $O@ %P ( M 0 '_____P > @ $Q0 ( ( 0 , L "P 6 $S !@ & M "( 0 *_____P > @ $TP ( ( 0 / T #@ 6 $V@ M!@ ' "( 0 ._____P > @ $X0 %P ( 0 ,_____P > @ M$Z ( ( 0 1 ! $ 6 $[P !@ ( "( 0 /_____P > @ M $]@ %P ( 0 3 !( $@ 6 $_0 !@ ) "( 0 1_____P > M @ %! %P ( 0 6 !0 %0 6 %"P !@ * "( 0 5____ M_P > @ %$@ %P ( 0 3_____P > @ %&0 ( ( 0 8 M !< %P 6 %( !@ + "( 0 6_____P > @ %)P ( ( M 0 ; !D &@ 6 %+@ !@ , "( 0 :_____P > @ %-0 & M $ 0 8_____P > @ %/ (0 $ 0 <_____P : < _( M!@ . @ 0 _____P : "4 _4 ( . @ ?__ $ ) 4 $ " M$0 "8 $@ "_____P 6 ( ( %0P !P ! !< 0 #_____P 6 ( M( %2@ !P ! !< 0 & 0 !0 4 #_$0 P # " 0 %_____P = M @ %40 "@ !8 0 #_____P 5 %6 4 0 ) < M" 4 #_$0 P $ " 0 (_____P = @ %7P "@ !8 0 & M_____P 5 %9@ H 0 , H "P 4 #_$0 P & " M 0 +_____P = @ %;0 &0 < 0 )_____P 5 %= M !0 0 / T #@ 4 #_$0 P * " 0 ._____P = @ %>P M&P 4 0 ,_____P 5 %@@ L 0 2 ! $0 4 #_ M$0 P + " 0 1_____P = @ %B0 &P 4 0 /_____P 5 M %D < 0 5 !, % 4 #_$0 P , " 0 4_____P = M @ %EP &P 4 0 2_____P 5 %G@ D 0 8 !8 M%P 4 #_$0 P ( " 0 7_____P = @ %I0 &0 < 0 5 M_____P 5 %K !0 0 ; !D &@ 4 #_$0 P - " M 0 :_____P = @ %LP '@ ( 0 8_____P 5 %N@ M H 0 <_____P : $ !7D &@ / D 0 ? !T '@ 4 #_$0 M P ' " 0 >_____P = @ %P0 &0 < 0 <_____P 5 M%R !0 0 @_____P 6 ( ( %SP !P ! !< 0 A_____P 6 ( M( %U@ !P ! !< 0 B_____P : $ ! @ &1@ !0 % "@ 0 _____P : "< ![H % ( M @ ?__ $ 0 4 $ "$0 @D' 0 _____P < " ![T% M 0 @ ?__ $ *P 4 "$0 $X %0 "_____P < M!\8 P 0 #_____P < !], ! L 0 $_____P < M !]\ " "( 0 %_____P < " ( $ !\ 0 &_____P < M ""( # ! 0 '_____P < "#, & "8 0 (____ M_P < "%H % ! 0 )_____P < "&L ' "$ 0 * M_____P < "(T ( ! 0 +_____P < ")X + "8 M 0 ,_____P < ",4 , ! 0 -_____P < "-8 - M !@ 0 ._____P < ".\ . !D 0 /_____P < "0D M / " 0 0_____P < "2H 0 !4 0 1_____P < M"4 1 !T 0 2_____P < "5X 2 !D 0 3_____P < M "7@ 3 !\ 0 4_____P < "9@ 4 "$ 0 5_____P < M ";H ) "$ 0 6_____P < "=P * ! 0 7____ M_P < ">T *0 $ !D 0 8_____P < "@< *0 # !< 0 9 M_____P < "A\ *0 " !@ 0 :_____P < "C@ )0 !\ M 0 ;_____P < "E@ )0 ! "( 0 <_____P < "GL *0 % M "$ 0 =_____P < "IT *0 & !@ 0 >_____P < "K8 M*0 ' ", 0 ?_____P < "MH *0 + !@ 0 @_____P < M"O, *0 * " 0 A_____P < "Q0 *0 , !L 0 B_____P < M "S (P ( "8 0 C_____P < "U< *0 ) !( 0 D_____P < M "VH (P - "< 0 E_____P < "Y( *0 . !L 0 F____ M_P < "ZX (@ / "@ 0 G_____P < "]< *0 0 "( 0 H M_____P < "_H (P 1 "8 0 I_____P < #"$ )0 2 !\ M 0 J_____P < #$$ *0 4 !L 0 K_____P < #%T )@ 3 M ! 0 "P ,0 4 #_$0 $X %0 M_____P < #&X M % 8 0 N_____P < #'4 ! !D 0 O_____P < M#(\ " !D 0 P_____P < #*D "@ 0 Q_____P < M #-( # "8 0 K_____P < " #/D $ !< ?__ $ 0 4 M $ "$0 !P\& 0 _____P < " #1$% , X ?__ $ M 0 4 $ "$0 !P\& 0 _____P < " #2 0, X ?__ M $ 0 4 $ "$0 H& 0 _____P < " #2\" 0, @ M ?__ $ 0 4 $ "$0 ! P& 0 _____P < " #3@& ( M L ?__ $ 0 4 $ "$0 ! D' 0 _____P < " #40" M 0, < ?__ $ 0 4 $ "$0 !0@' 0 _____P < " M#4P& , < ?__ $ 0 4 $ "$0 !Q,( 0 _____P < " M #50' , !( ?__ $ 0 4 $ "$0 !14' 0 _____P < M " #6<' 0 !0 ?__ $ P 4 $ "$0 !L "0 "____ M_P = @ &30 P ! !4 0 #_____P = &5 !@ # X 0 M_____P : "< #;< "0 & @ ?__ $ !0 4 $ "$0 #$ M# "_____P 6 ( &6P #0 ! !8 0 #_____P = @ &8@ ! & M "@ 0 $_____P 5 &:0 !@ $ "0 0 %_____P : < #G, M!P ) @ 0 _____P : "4 #G8 ( ) @ 0 &< !X0 >0 M'G !Z@ A6 )- "8@ FL )N "N0 KP *_ "P@ L 54 +( "RP LX +1 "UP end begin 777 KERMIT.PRG M8!H (G* )^ *ZP "I/*FT !"/- "3PB M S0 MK0 4T*T '-"\ @ "( THW"O/____XN02\ +PU"9S\\ $I.0=_\ #"!Y M "3PB)H !C3Z <(\D )/&1>@ @! : H #_/P O"IW.3KD %/\3OD M "Z(B\ !# \ ,A.0DYU(&\ !" (0>@! +_(9 1P_TYU(\ )/&0H!.=4Y6 M P+P ((B\ "DY"O_D )/&9!0P/ )0?D (LF(@A.0C \ !.0DY>3G4@ M;P $,B\ "# O I(P%. ;P80P5'(__Q"@$YU(&\ !# O A*$&8$0H!.=; 8 M9O0@"%. 3G5.5O_\3KD $>2D!G$DZY /!$ZY "5$ZY ".DY>3G5. M5O_X3KD $L\,\ )I0+KP )9B+SP )E(+SP )J<+SP )M 3KD $ZD MW_P ,,\ )M@+KP )L4+SP +]>+SP +]J+SP +]H/SP !$)G3KD M %&0W_P 00F[__F 4,&[__M'(T?P )M(,+P 5)N__X,;@ *__YMY#/\ M ( )M<+KP )MH+SP )M@+SP )M(3KD $E*4(\NO BV).N0 4)I* M0&8./KP DZY !-:$) 8%(NO FV1"9T)G3KD %"T6(]*0&86+KP (MM M/SP 4ZY !-1E2/0D!@)BZ\ ";9$)G0F=.N0 4+18CSZ\ $O.0 FV1. MN0 3PA8CW !3EY.=4Y6__P^N0 FV!.N0 2"9.N0 2YY.7DYU3E;_^$ZY M 45"Z\ "6A$ZY XPBZ\ "5$DZY XPD*70F=.N0 3N94CV 0 FI0@: #,+5#__"Z\ M "+ER\N__Q.N0 9]Y8CRZ\ ":E#\\ ,_//__/SS__S\\ 9A &04(\^ MO/__+SD )J43KD $S*6(\^O #/SS__S\\__\_/ &80 "]ER/0E<_/ " M+SD )J480 !&ER/8 N# Y "7+F!:+KP ):$3KD #D<2GD )JF9PPN MN0 ES9.N0 9*9*>0 FI!G#"ZY "$!DZY !DID)73KD %'B8 E&$ M!ZQ@+&$ _A@)F$ "$!@(&$ ">I@&F 8D'P $K!\ 5B#N5 ,$#1_ BTH@ M4$[08#H^N0 ERY.N0 %\1@+#ZY "7+DZY 0VF >8!RP? #9P#^FK!\ M 1G /]8L'P !6?,L'P !F?4/KP 3\Y "7+"\Y ";9$ZY !/5%R/0E=. MN0 4>)@ /XV3EY.=4Y6__@NCEF7/RX "C\\ 5.N0 4+18CRZN__P_+@ ( M3KD $U&5(\]0 (,"X "$Y>3G5.5O_\0E<_+@ ./SD )L4/SD +]>/SD M +]J/SD +]H0F<_+@ ,+RX "$ZY !00-_\ $DY>3G5.5O_T+JX $#\N M A"9TZY !0M%B/+HY1ER\.790 OVI@ M!# N P]0 ,2FX #&T&,"X #& $,"[_^#U __@P+O_Z5D B;O_\,T $# N M__A60")N__PS0 2#&[__P .9BP^KO_T/R[_]C\N__@_+O_Z0F="9T)G0F<_ M/ #3KD $SLW_P 08 DDIN YM "*/J[_]#\N__8_+O_X/R[_^C\Y M "68C Y "92.5 /P!"9R!Y ";9#(N [#_ 8/S 8$#\\ ).N0 3.S? M_ ! ^KO_T/R[_]C\N__@_+O_Z/SD )9B,#D )E(Y4 _ $)G('D )MD M,BX #L/\ !@_,!@0/SP TZY !,[-_\ $$Y>3G5.5O_R+KP )J4/SP M!$)G/SS__S\\ AA /SL4(\NO FY0 FSP(* $ -F "H$"[__$B /H _/ &3KD %(<5(\,+@ *__QF "& M/KP #3\\ 9.N0 4AQ4CU)N__XP+O_^L'P %F]F0F[__B!Y ":E"UH "3_ M]F :(&[_]A 02( ^@#\\ 9.N0 4AQ4CU*N__8@;O_V2A!FWCZ\ =.N0 M4AP=0/_Z#"X __Z9R ^O -/SP !DZY !2'%2//KD )M@3KD $B"8 #_ M+ PN /_^F=:/KP #3\\ 9.N0 4AQ4CSZ\ H_/ &3KD %(<5(\@>0 MFI0M: \__9@&B!N__80$$B /H _/ &3KD %(<5(]2KO_V(&[_]DH09MX^ MO '3KD %(<+KD )L\3KD &2F80 SDY>3G5.5O_\0I<_/ $ 3KD $[F M5(\^N0 FQ0_.0 OUX_.0 OVH_.0 OVA"9TZY !0Z%"/,\ )MB/KD M )L4/SD +]>/SD +]J/SD +]H/SD )9B,#D )E(Y4 _ $)G('D )MD M/R@ <$ZY !. -_\ #CZY ";%#\Y "_7C\Y "_:C\Y "_:#\Y "; M8DZY !1(E"//KD )M@3KD $CF/KD )M@3KD $A0/KD )M@3KD $BT M3EY.=4Y6__P^N0 FV!.N0 2% ^N0 FV!.N0 2+0^N0 FV!.N0 21@^ MO !+SD )MD3KD $\(6(\^N0 FV).N0 45P^N0 FV).N0 478^N0 MFQ0_.0 OUX_.0 OVH_.0 OV@_.0 EF(_.0 F4A"9R!Y ";9#\H '!. MN0 3E+?_ Y"ES\\ 0%.N0 3N94CTY>3G5.5O_X+HY9ES\\ 1"9S\\ M__\_/ !80#Y0%"/+KP )G,+SP )423KD #G"6(]*0&=4/KP !"\\ "9 MS$ZY !2+%B/2D!G$#Z\ (_/ !80#XE%2/8"XNO F;Q8CSZ\ 1"9S\\__\_/ "80#YHER/+HX& ME____UH_/ $0F<_//__/SP V$ ]_A0CSU\ /_6BZ\ "9S"\\ "5$DZY M YPEB/2D!G "P/KP B\\ "9S$ZY !2+%B/2D!F$CZ\ $_/ !80#W M1%2/8 B"Z\ "5$B\.!I?___]@3KD 'HN6(\NO F7(].7DYU3E;_X"Z.69<_ M/ 20F=.N0 4+18CR!N__P@: \+5#_^"!N__P@: D+5#_]"!N__A"$"\N M__0_/ 93KD %(<5(_0? !!(%\0@"Z.69<_/ $/SS__S\\__\_/ 280#V MIE"//KP 2\N__Q.N0 3,I8CT)7/SP R\N__QA /9*7(\@;O_T$!!(@#Z M!E?_P"\.!I?____D/SP -DZY !2'%R/2H!G%"Z\ "+H"\N__A.N0 >BY8 MCV R+R[_\"\N_^PO+O_D3KD $G@4(\O $ZY !)X%"/+H O/ BZDO+O_X M3KD &?>4(\NCEF7/SS__C\\__\_//__/SP $F$ ]@!0CSZ\__\O+O_\3KD M $S*6(]"5S\\ ,O+O_\80#UI%R//KP !#\\__\_//__/SP $F$ ]UA M3G5.5O_Z+KP (T*80 K$I 9D9";O_^8"PP+O_^P?P #B! (GP (NN('"8 M #(N__[#_ .TKP (NN(D$PJ0 &4F[__C N__[!_ .T+P (NN($!*D&; M0F[__F!","[__L'\ X@0")\ "+KDIPF 1F*# N__[!_ .($ B? BZX@ M<)@ ,B[__L/\ [2O BZXB03"I 92;O_^,"[__L'\ [0O BZX@0$J0 M9JI.7DYU3E;_]BZ\ "-%2\N A.N0 4[)8CRU __Q*KO_\9@1"0&!F0F[_ M^F! ,"[_^L'\ X@0")\ "+KDIPF 1G)C N__K!_ .($ B? BZXNL)@ M+SP (T7+R[__$ZY !55%"/4F[_^C N__K!_ .T+P (NN($!*D&:L+J[_ M_$ZY !DIG !3EY.=4Y6__8NO C1HO+@ (3KD %.R6(\M0/_\2J[__&8$ M0D!@:$)N__I@0C N__K!_ .($ B? BZY*<)@$9R@P+O_ZP?P #B! (GP M (NN('"8 #Z0+SP (T<+R[__$ZY !4ME"/4F[_^C N__K!_ .T+P (NN M($!*D&:J+J[__$ZY !DIG !3EY.=4Y6_Z8P+@ (8 "TBZ.!I?___^L/SP M!D)G/SS__S\\ I.N0 !,90CRZ.!I?___^P+SP (T@+SP ):$3KD #E0 M4(]*0&/SP !4)G/SS__S\\ Q.N0 !,90CRZ\ M "9S"\\ "5$DZY YPEB//4#__"Z\ "9S"\.!I?____N3KD 'HN6(\^ MO %0F<_//__/SP #$ZY &5%R/2F[__&< !1A"5V$ !E(NO FPP_/ % M/SS__S\\__\_/ %3KD 3&4(\NO FT5(]@-$*Y ";/$ZY M D5#U __YG$CZ\ 0_//__3KD $>T5(]@$#Z\ <_//__3KD $>T5(]@ M .2+KP )J>/SP $T)G3KD %"T6(]"5S\\ 4O.0 FIY.N0 !(I/SP !3\\__\_//__/SP $TZY $ MQE"//KP B\Y ":GDZY !,REB//4#__#Z\ 4_//__/SS__S\\ !-.N0 M!E10 FIX@: \+I O/ EM1.N0 >BY8CRZ\ "6 MU$ZY !Z4$I 9P #P"!Y ";# )H_W\ ."Z\ ":GC\\ 5"9S\\__\_/ / M3KD 3&4(\NO FTW_P ,0KD )L\3KD #=6/4#__F<2/KP *#\\__].N0 M1[14CV 0/KP *C\\__].N0 1[14CV >8@>0 FPP":/]_ #@NO FIX_ M/ %0F<_//__/SP #4ZY $QE"/+KP )G,+SP )423KD #G"6(\]0/_\ M+KP )G,+PX&E____^Y.N0 >BY8CSZ\ 5"9S\\__\_/ -3KD 947(]* M;O_\9P "7D)780 #F"Z\ ";##\\ 4_//__/SS__S\\ 5.N0 !,90CRZ\ M "9S"\\ "5$C\\ "$_//__3KD $>T4(]"N0 FSQ.N0 +10]0/_^9Q(^ MO ;/SS__TZY !'M%2/8! ^O B/SS__TZY !'M%2/8 ^B!Y ";# )H M_W\#4"Z\ ";##\\ 4_//__/SS__S\\ 5.N0 !,90CSZ\ "D_//__3KD M $>T5(\^O !&3KD #>6/4#__F<2/KP +S\\__].N0 1[14CV 0/KP +3\\ M !1.N0 1[14CV (H@>0 FPP":/]_ V@NO FPP_/ %/SS__S\\__\_ M/ %3KD 3&4(\^O N/SS__TZY !'M%2//KP 3$ZY WECU __YG$CZ\ M # _//__3KD $>T5(]@$#Z\ #$_/ 53KD $>T5(]@&F 8D'P &;!\ 9B M#N5 ,$#1_ C6(@4$[02F[__F<8/KP "#\\ !LO.0 FPQ.N0 !(I0 FPP : " M " @>0 FPP : " P@@>0 FPP : " #@@>0 FPP : " O @>0 FPP M: " U @>0 FPP : " VA"5V$*0E=A #J3EY.=4Y6_^(@>0 FPP@: !L M+5#__#Z\ !4O/ F>90CT(N__LNC@:7____YB\\ "-@R\N__Q.N0 9]Y0CSZY "6 M@"\\ "-AB!Y ";#"!H /PO$$ZY !GWE"/2FX "&0 FPP@: +$+Q!.N0 9]Y0CRZY ":'B\\ "-C"!Y ";#"!H M APO$$ZY !GWE"//KD )<\+SP (V0('D )L,(&@"9"\03KD &?>4(\^ MN0 FIHO/ C94@>0 FPP@: %$+Q!.N0 9]Y0CSZY ":4B\\ "-F"!Y M ";#"!H 8PO$$ZY !GWE"//KD )L2+SP (V;('D )L,(&@!U"\03KD M &?>4(]*;@ (9P C"Z\ "_;"\\ "91C\\ !UA !\7(\@.0 FAZPN0 MF#YG#$*70J<_/ 686!3G5.5O_T2JX "F<@2JX #F<:(&X "C 0(FX M#C(1L$%G:B!N XB;@ *,)$P+@ (P?P &-"Y ";#"U __@NCEF7+PY5ES\N M @O.0 FPQ.N0 4 +?_ H@;O_X/J@ %B!N__@_* 4/R[__#\N__X_ M/ (0F3G5.5O_V,#D )A" ML'D )9^0,!2>0 F$)$P&\6/KP #C\\ A.N0 1[14CW!!8 !)#/\ $ M )EL+KP )EN3KD $/*3KD $54+KP )EN/SP !S\Y "7/#\\ %-.N0 M.H)0 FE(0.0 E Q(@& *(P.0 ESRP;O_^ M9Q)2>0 FE(0.0 E Q(@& (12>0 F48NO FJQ.N0 1#Y">0 F$(P M.0 ESQ20$C @?P 0$A ,\ )<\<$9@4"Z\ ":K$ZY !(!'!%8$!2>0 MFE(0.0 E Q(@& P<$%@+#Z\ !@_/ 13KD $>T5(]P06 88!9(P"!\ "- MYG(%L)A7R?_\(&@ %$[03EY.=4Y6__ P.0 F$*P>0 EGY P%)Y "80D3 M;Q8^O ./SP "$ZY !'M%2/<$%@ 'J2KD )L\9@ @$(Y "6U#Z\ %. MN0 'R NO F0 FI)G'"Z\ ".W"\\ "9S$ZY M !3XEB/(\ )L\8!HNO CMXO/ FE ]0/_\+J[_^#\N__P_.0 ESP_ M/ !&3KD #J"7(\NO FJPO#E67+PY9ETZY \+%"/8 YE-N__YL!' _ M8 0P+O_^/4#__C Y "7/+!N__YG$E)Y ":4A Y "4#$B 8 S# Y "7 M/+!N__YG$E)Y ":4A Y "4#$B 8 KBZN__@O/ FT5(]P06 3XNO F6X_.0 FDX_.0 ESP_ M/ !$3KD #J"7(\NO FJPO#E67+PY9ETZY \+%"/8 \%-N__YL!' _ M8 0P+O_^/4#__C Y "7/+!N__YG$E)Y ":4A Y "4#$B 8 UC Y "7 M/+!N__YG$E)Y ":4A Y "4#$B 8 N%)Y "91D)Y "80C Y "7/%) M2,"!_ ! 2$ SP ESPNO F6Y.N0 04@SP FDZP?/__9@9P6F '@@ M>0 FSP(* $ -G%#Z\ !P_/ 33KD $>T5(]P06!4<$1@4"Z\ ":K$ZY M !(!'!%8$!2>0 FE(0.0 E Q(@& P<$%@+#Z\ !@_/ 13KD $>T5(]P M06 88!9(P"!\ ".1G(%L)A7R?_\(&@ %$[03EY.=4Y6__@P.0 F$*P>0 MEGY P%)Y "80D3 ;Q8^O ./SP "$ZY !'M%2/<$%@ %2+KP )EN0F<_ M.0 ESP_/ !:3KD #J"7(\NO FJPO#E67+PY9ETZY \+%"/8 !"%-N M__YL!' _8 0P+O_^/4#__C Y "7/+!N__YG$E)Y ":4A Y "4#$B 8 M[C Y "7/+!N__YG$E)Y ":4A Y "4#$B 8 T%)Y "91E)Y "6@$)Y M "80C Y "7/%) 2,"!_ ! 2$ SP ESPNO F0 FE(0 M.0 E Q(@& P<$%@+#Z\ !@_/ 13KD $>T5(]P06 88!9(P"!\ ".=G(% ML)A7R?_\(&@ %$[03EY.=4Y6__@P.0 F$*P>0 EGY P%)Y "80D3 ;Q8^ MO ./SP "$ZY !'M%2/<$%@ #Z+KP )EN0F<_.0 ESP_/ !"3KD #J" M7(\NO FJPO#E67+PY9ETZY \+%"/8 L%-N__YL!' _8 0P+O_^/4#_ M_C Y "7/+!N__YG$E)Y ":4A Y "4#$B 8 EC Y "7/+!N__YG$E)Y M ":4A Y "4#$B 8 >%)Y "91D)Y "80C Y "7/%) 2,"!_ ! 2$ S MP ESQP0V!0+KP )JL3KD $@$<$5@0%)Y ":4A Y "4#$B 8#!P06 L M/KP &#\\ !%.N0 1[14CW!!8!A@%DC ('P (ZF<@6PF%?)__P@: 43M!. M7DYU3E;__"Z\ ";.$ZY _CA/\ %( )0,0GD )<\0GD )A"/KD )<\ M$#D )0,2( _ #\\ U.N0 1O)8CRZY ";.$ZY _K$I 9R NN0 FSA. MN0 /ZQ(P"\ +SD )H>3KD $HT4(]@ D* ,\ )J:/KP 4ZY @!! Y M "4#$B 8%QA !Z$\ )0,8&AA 'R$\ )0,8%QA :2$\ )0,8%!P M 6!0+KP (_8/SP !3\Y "7/#\\ $5.N0 .H)T5(]P06 M 5 S_ ! "9;"Z\ "9;B\.79T5(]P06 88!9( MP"!\ "/*'(&L)A7R?_\(&@ &$[03EY.=4Y6_^XP.0 F$*P>0 EGY P%)Y M "80D3 ;Q8^O ./SP "$ZY !'M%2/<$%@ 1X+KP )EN+PY5ER\.69=. MN0 /"Q0CV !$A2>0 FE(P.0 OURP>0 EGY P%)Y "_7$3 ;Q8^O . M/SP "$ZY !'M%2/<$%@ 0J2GD )<\9@1P/V (,#D )<\4T"P;O_^9Q8^ MO 8/SP $4ZY !'M%2/<$%@ /Z+KP )EN3KD $/*+KP )EN/SP !S\N M__X_/ !93KD #J"7(]">0 F$(0.0 E Q(@& \)2>0 FE(P.0 OURP M>0 EGY P%)Y "_7$3 ;Q8^O ./SP "$ZY !'M%2/<$%@ ..2GD )<\ M9@1P/V (,#D )<\4T"P;O_^9Q8^O 8/SP $4ZY !'M%2/<$%@ ->0I=" M9S\N__X_/ !93KD #J"7(]">0 F$(0.0 E Q(@& S@P+O_^L'D )<\ M9Q8^O 8/SP $4ZY !'M%2/<$%@ ,6+KP )EN+SP );43KD 'HN6(]" M;O_X/7S____V2CD )G,9@ !=D)N__I@ "R('P );4,F[_^M')'5#_\@PN M &'_\FT.#"X >O_R;@8*+@ @__(,+@ @__)F!AU\ "[_\@PN "[_\FPF%?)__P@: < M3M!.7DYU3E;_^# Y "80K!Y "6?D# 4GD )A"1,!O%CZ\ X_/ (3KD M $>T5(]P06 M8NO F6XO#E67+PY9ETZY \+%"/8 "IC N__ZP>0 MESQG ",2GD )<\9@1P/V (,#D )<\4T"P;O_^9Q8^O 8/SP $4ZY !' MM%2/<$%@ )^,#D +]0 OUQ$P&\6/KP #C\\ A.N0 M1[14CW!!8 "4$*70F<_+O_^/SP 64ZY Z@ER/4GD )I20GD )A"$#D M )0,2(!@ (D0I="9S\Y "7/#\\ %E.N0 .H)0 F$(P.0 ESQ20$C @?P 0$A ,\ )<\4GD M )E&('D )L\""@ ! #9Q8^O 0 OUQ$P&\6/KP #C\\ A.N0 1[14CW!! M8 !2$*70F<_+O_^/SP 64ZY Z@ER/4GD )I20GD )A"$#D )0,2(!@ M $<,"[__K!Y "7/&<6/KP &#\\ !%.N0 1[14CW!!8 ^B!Y ";/ @H M 0 V<6/KP '#\\ !-.N0 1[14CW!!8 UD*70F<_.0 ESP_/ !93KD M #J"7(\NN0 FSQ.N0 9*8P.0 ESQ20$C @?P 0$A ,\ )<\+KP )G, M/SP $S\\__].N0 1[18CU)Y "91E)Y "6@#Z\ %.N0 'R!".0 F0 MFE(0.0 E Q(@& P<$%@+#Z\ !@_/ 13KD $>T5(]P06 88!9(P"!\ "/ MH'(&L)A7R?_\(&@ &$[03EY.=4Y6__I.N0 150NO EM0O/ EM1.N0 M>E!8CS\ 0F<_/ !23KD #J"7(].N0 +10]0/_^,"[__DY>3G5.5O_V0F[_ M^F )83[@ ) "9;BZ\ "9;C\\ %"9S\\ $=.N0 .H)0 FE)@&& 62, @? C^AR!;"85\G__"!H M !1.T#Z\ %.N0 ( 12;O_Z#&X "O_Z;0#_9$) 3EY.=4Y6__@^O !<+RX M"$ZY !5#%B/+4#__$JN__QG#" N A4@+"N__QF%"!N @1? !< (@;@ ( M0B@ V &(&[__$(03EY.=4Y6__P@;@ (2B@ V<2+KP ) 8+RX "$ZY !Y MO%B/+JX #"\N A.N0 >;Q8CTY>3G5.5O_\0E;Q8CTY>3G5.5O_\(&X "! 02( ^@ 97_[\_/ . M3KD %(<5(\NK@ (5)<_/ [3KD %(<5(].7DYU3E;_["ZN @O+@ 03KD M 'HN6(\NO D!PO+@ 080#_'EB/+JX #"\.!I?____P3KD 'HN6(\NCE67 M+PX&E_____ O+@ 03KD $W,4(\NK@ 080#^H"Z.!I?____P+RX $&$ _MA8 MCS N__Y.7DYU3E;_^BZ\ "0("\N AA /Z\6(\NCE67+RX #"\N A.N0 M30 OUIG!&$ "W8,+@!9 M EG# PN $X "6<$80 *K# N S ? !_/4 # QN %X #&\&/7P 6@ ,/JX M"C\N P0+@ )2( _ #\\ AA P87(]*K@ .9PP@;@ .,FX #-')0A!*K@ . M9PXNK@ ./SP "6$ "_)4CTON_YA*>0 FT)G*CU\ '__F 6/KD )L*/SP M!$ZY !2'%2/4F[__C N__ZP>0 EH)OWDIY ":IF<@#'D 0 FJ9O%CZY M ";"C\Y "6@C\\ "1A N46(\P.0 E1 :P# N S0? C&L P+@ ,T'P M(QU __PP+@ *T'P (!K ,"X "M!\ " 2+O_\T@ =0?_\&NX "1 N E(@-$N M__Q";O_^8"@@;@ .,F[__M')&M P;O_^(FX #A PF !(@!(N__S2 !U!__Q2 M;O_^,"[__K!N QMSA N__Q(@,!\ ,#L0!(N__Q(@=!!P'P /QU __P0+O_\ M2(#0? @&L P.0 F6@:P$(5+HX&E____YAA F,< %*GTS?( !.7DYU3E;_ MZ"Z\ ":5F$ U8NC@:7____]F$ !+)*0&<(,"[_]F N(NC@:7____]B\. M!I?____R80 #G%B/2D!G"# N__9@ + $"[_\DB P'P ?[!Y "5#F;,0F[_ M^& > NC@:7____]B\.!I?____R80 #8%B/2D!G"# N__9@ *$ BX ?__R M$"[_\DB L'D )4.9P !J!UN__+_[A N__)(@-!\_]TB;@ (,H NC@:7____ M]B\.!I?____R80 #$EB/2D!G"# N__9@ (V BX ?__R$"[_\DB L'D )4. M9P !6A N_^Y(@!(N__)(@=!!'4#_[A N__)(@-!\_^ B;@ ,,H NC@:7____ M]B\.!I?____R80 "N%B/2D!G"# N__9@ '< BX ?__R$"[_\DB L'D )4. M9P ! ! N_^Y(@!(N__)(@=!!'4#_[AUN__+_\$)N__1";O_^8 ="Z.!I?_ M___V+PX&E_____)A )<6(]*0&<(,"[_]F 8!*>0 FI)G"$IY "9;&<& M BX ?__R$"[_\DB L'D )4.9@@]? !__1@,! N_^Y(@!(N__)(@=!!'4#_ M[B!N ! R;O_^T3G5.5O_\/KP +$ZY !2'#Z 898O "!N @@GTY>3G5.5O_X/KP M+$ZY !2'#Z 80#_>"U __P@+O_\L*X "&P2("[__-"\ &$()"N A@'F < M("[__)"N BPO %O"B N__R0K@ (8 )P 4Y>3G5.5O_\8 A#Z\ #). MN0 (KP_ "!N PPGR!N P,4 !!9@X^O +80 &R' !8 P@PY %< )0, M9@HNO FE9A /]*(&X # Q0 %1G(DIY ":I&E)Y ";$B!N Q"4' !8&@^O 23KD %(< M2H!G /]P+RX "#\\ -.N0 4AQ4CR!?$(!*>0 FJ9G.@QY $ )M$;S @ M;@ ($!!(@#Z E< ?R!N @0$$B /P O.0 FE9A /[,6(\_ #\\ "-A 8& M7(]"0$Y>3G5.5O_\0E=.N0 (KP_ "!N @PGR!N @,4 !!9@P^O +80 % MV' !8"0@;@ (#% 5&88/KP #&$ !<)2>0 FQ(@;@ (0E!P 6 "0D!.7DYU M3E;_\D)N__Y@ %X+KD )L\3KD %ON/4#__%*Y ":'B!Y ";/ @H 4 M V8 58P+O_\'4#_^# N__S ? !_'4#_^C N__S ? " '4#_]DIY "9;&0 E IG&A N__I(@+!Y "9;&8 ))*>0 F6QG "( M#&X "O_\9BQ*>0 FI)F)# Y "4"C)N__[3[@ ($H!2;O_^,&[__M'N @0 MO !-4F[__C Y "4"C)N__[3[@ ($H!2;O_^$"[_^DB L'D )0*9S 0+O_Z M2("P>0 F6QF"$IY "9;&8:,"[__') LT ]0/_\$"[_^DB 0 FI)G'$IY "9;&84,"[__#)N__[3[@ ($H!2;O_^8! P;O_^T>X "!"N M__I2;O_^,#D )H<44"P;O_^;@8P+O_^8!)@ /Z(2F[__F8$0 MFI)G*! N__Q(@,!\ '^P>0 F6QF%CU\ '_^E)N__XP;O_^T>X "!U0__P0 M+O_\2("P>0 OV1F2E)N__XP;O_^T>X "!U0__P0+O_\2(# ? !_L'D +]D M9R@0+O_\2(# ? !_L'D )EL9@A*>0 F6QF#A N__Q(@') LT =0/_\2F[_ M^F<& "X @/_\+KD )L\$"[__$B /P!.N0 ;>Q4CU*Y ":'E)N__XP+O_^ ML&X #&T _RA.7DYU3E;__# Y "9:M!\ " B;@ ($H P.0 FJ+0? @(FX M"!- $@;@ ($7P ( "(&X "!%\ $ S Y "91-!\ " B;@ ($T !# Y M "4"B)N @30 %2GD )J29P1P66 "<$XB;@ ($T !DY>3G5.5O_\(&X M"$H09Q(@;@ ($!!(@-!\_^ SP FAP@;@ (2B@ 6<4(&X "! H %(@-!\ M_^ SP FJ0@;@ (2B@ F<<(&X "! H )(@-!\_^ SP EH(SP FT)@ M#D) ,\ ):",\ )M"(&X "! H -(@') LT SP FPH@;@ (2B@ !&<6 M(&X "! H 1(@-!\_^ SP F6A@"#/\ T )EH(&X "$HH 5G$B!N @0 M* %2( SP OV1@"#/\ ", +]D2GD )J29R(@;@ (2B@ !F<8(&X " PH M $X !F<,(&X " PH %D !F8(0GD )EL8! @;@ ($"@ !DB ,\ )EL3EY. M=4Y6__I@/CZ\ -.N0 4AP=0/_^2GD )JF9R@,>0 ! ";1&\>$"[__DB M/H "5P!_$"[__DB /P _/ @80 !7EB//KP $DZY !2'$J 9K1.7DYU3E;_ M_&!.2GD )JF9RP,>0 ! ";1&\B(&X "! 02( ^@ )7 '\@;@ ($!!(@#\ M/SP 'F$ 1)8CR!N @0$$B /H _/ $3KD %(<5(]2K@ ((&X "$H09JI. M7DYU3E;_\D)N__XNC@:7____]F$ ^7)@ #"+J[_]F$ ^82P? $; M@QN M K__FT0/KP $DZY !2'$J 9P GCZ\ !).N0 4AQ*@&=20F[__F ^/KP M TZY !2',"\ ?QU __Q*>0 FJ9G(@QY $ )M$;Q@0+O_\2( ^@! N M__Q(@#\ /SP )6%86(\^O 23KD %(<2H!FM$)7/SP 9$ZY !+RE2/$"[_ M_$B L'D )J89A@^O 23KD %(<2H!F"CZ\ "9A&$) 8!!2;O_^8 #_/CZ\ M !]A!D) 3EY.=4Y6__Q*>0 FJ9G1BZN !HO+@ 6+RX $B\N XO+@ */RX M"$ZY =Y%2/+P O.0 ES9.N0 5+;?_ !@NN0 ES8_/ *3KD &WL M5(].7DYU3E;__$IY ":D&=&+JX '"\N !@O+@ 4+RX $"\N P_+@ *3KD M !WD5(\O "\Y "$!DZY !4MM_\ &"ZY "$!C\\ I.N0 ;>Q4CTIN M AM$#ZN @_/ !3KD 165(].7DYU3E;__#ZN !0_+@ 2/RX $#\N X_ M+@ ,/RX "F$ _R#?_ H^K@ 4/RX $C\N ! _+@ ./RX ##\N H_+@ ( M80#_4-_\ #$Y>3G5.5O_\+JX "#\\ 8_//__89Y8CRZN A.N0 (>Q. M7DYU3E;__#/\ &4 )L80GD )L:0GD )L>,^X " FR1.N0 2,_P " FR(S[@ ( ";)$ZY !) MRDY>3G5.5O_\,_P !0 FQA">0 FQI">0 FQXS_ * ";(C/N @ )LD M3KD $G*3EY.=4Y6__PS_ % ";&$)Y ";&D)Y ";'C/\ D )LB,^X M" FR1.N0 2,_P P MFR(S[@ ( ";)$ZY !)RDY>3G5.5O_\,_P !0 FQA">0 FQI">0 FQXS M_ " ";(C/N @ )LD3KD $G*3EY.=4Y6__PC[@ ( "3T"/N ! )/8 M("X $-"\ 6B/ "3W#/\ &0 )L80GD )L:,_P "P FQX@;@ ,,] M )LD3KD $G*(&X ##"Y ";)"/\ "4#@ D] C_ E6( )/8(_P )A$ M "3W"/\ "7/@ D]1.7DYU(_P )L8 "3S"(\ "3S'!S3D).=4Y6__Q" M0DJN AL!D2N A20DJN QL!D2N Q20C N K [@ .+4#__# N C [@ . M,BX #,+N K00=!N__P]0/_\("[__ @" !G D2 3EY.=4Y6__Y(YS\ 0D-" MA2XN @L+@ ,9A@C_( )/@(#R @?P & &AL!$2&4D-*AVP$ M1(=20[R';CAF!GH!0H=@,+Z\ $ &P*CL8Z!TA'2,=@'G@!OH9E!N.&XX1@ M]DJ$9PZ^AF4$BH2>AN*,XHY@[K9\ %F#D2'(\< )/@( 5$@& ((\< )/@ M( 5*GTS? /A.7DYU3E;_]C/N @ )I:,"X "-!\__;!_ #2,#0O B3G5.5O_\,^X " MFF(S[@ * ":9#Z\ !A.N0 2M).7DYU3E;__#/N @ )IB,^X "@ FF0S M[@ , ":9C/N X )IH,^X $ FFHS[@ 2 ":;#/N !0 )IN,^X %@ MFG S[@ 8 ": ":>#/N " )IZ,^X M(@ FGPC[@ D ";,#/N "@ )I^,^X *@ FH ^O 93KD $K2(&X +#"Y M ":A"!N # PN0 FH8@;@ T,+D )J((&X .#"Y ":BB!N #PPN0 FHP@ M;@! ,+D )J.0D P.0 FH).7DYU3E;__"/N @ )LP,^X # FF(^O R M3KD $K23EY.=4Y6__PS[@ ( ":8C/N H )ID,^X # FF8S[@ . ": M:#/N ! )IJ,^X $@ FFPS[@ 4 ":;C/N !8 )IP,^X & FG(^O S M3KD $K23EY.=4Y6__PS[@ ( ":8B/N H )LP/KP -$ZY !*TDY>3G5. M5O_\,^X " FF(^O U3KD $K23EY.=4Y6__PC[@ ( ";,#Z\ #9.N0 M2M(@;@ ,,+D )J$(&X $#"Y ":AB!N !0PN0 FH@@;@ 8,+D )J*0D P M.0 FH).7DYU3E;__"/N @ )LP(^X # FS0^O !:3KD $K2(&X $#"Y M ":A$) ,#D )J"3EY.=4Y6__PS[@ ( ":8C/N H )ID,^X # FF8S M[@ . "::#/N ! )IJ,^X $@ FFPS[@ 4 ":;C/N !8 )IP/KP 24ZY M !*TDY>3G5.5O_\,^X " FF(S[@ * ":9#/N P )IF,^X #@ FF@S M[@ 0 "::C/N !( )IL,^X % FFXS[@ 6 ":<#Z\ $I.N0 2M).7DYU M3E;__#Z\ $U.N0 2M(@;@ (,+D )J$(&X ##"Y ":AB!N ! PN0 FH@@ M;@ 4,+D )J*0D P.0 FH).7DYU3E;__#/N @ )IB(^X "@ FS ^O !. M3KD $K23EY.=4Y6__PC[@ ( ";,#/N P )IB/KP 'DZY !*TDY>3G5. M5O_\(^X " FS S[@ , ":8C/N X )ID/KP 'TZY !*TDY>3G5.5O_\ M(^X " FS S[@ , ":8C/N X )ID/KP (4ZY !*TDY>3G5.5O_\(^X M" FS S[@ , ":8C/N X )ID,^X $ FF8S[@ 2 "::#/N !0 )IJ M,^X %@ FFP^O J3KD $K23EY.=4Y6__PC[@ ( ";,#/N P )IB,^X M#@ FF0S[@ 0 ":9C/N !( )IH/KP *TZY !*TDY>3G5.5O_\(^X " MFS S[@ , ":8CZ\ "Q.N0 2M(@;@ .,+D )J$(&X $C"Y ":AD) ,#D M )J"3EY.=4Y6__PC[@ ( ";,#/N P )IB,^X #@ FF0S[@ 0 ":9C/N M !( )IH,^X % FFHS[@ 6 ":;#/N !@ )IN,^X &@ FG ^O O3KD M $K23EY.=4Y6__PC[@ ( ";,#Z\ &Y.N0 2M).7DYU3E;__#/N @ )IB M,^X "@ FF0^O !P3KD $K2(&X #""Y "_8$) ,#D )J"3EY.=4Y6__PS M[@ ( ":8C/N H )ID,^X # FF8S[@ . "::#/N ! )IJ/KP 9$ZY M !*TDY>3G5.5O_\,^X " FF(S[@ * ":9#/N P )IF,^X #@ FF@S M[@ 0 "::CZ\ &5.N0 2M).7DYU3E;__#/N @ )IB/KP 9DZY !*TDY> M3G5.5O_\,^X " FF(^O !G3KD $K23EY.=4Y6__PS[@ ( ":8C/N H M )ID/KP :$ZY !*TB!N PPN0 FH0@;@ 0,+D )J&(&X %#"Y ":B"!N M !@PN0 FHI"0# Y ":@DY>3G5.5O_\,^X " FF(^O !K3KD $K23EY. M=2/? "3Y$Y.+SD )/D3G4CWP D^1.32\Y "3Y$YU(]\ )/D3D$O.0 MD^1.=4Y6 !(YP, 0E M3G5.5O_\0E3G5.5@ 2.<''"IN @H;@ ,0D=@"+Y\ !!L M&E)', ?!_ .)D#7_ D/XP*P "P'P V;@OGP $&T&0H!@ #4#!0 =V<& M#!0 5V88/JX $#\\ $O#4ZY !C7%R// !@ !P#!0 86<&#!0 068^/JX M$#\\ $O#4ZY !F*%R// !L%CZN ! _/ !+PU.N0 8UQ3G5.5O_\+HX&EP M PO+@ (+SP )$,3KD &@V4(].7DYU3E;__"Z.!I< 0+RX #"\N A. MN0 :#90CTY>3G5.5@ 2.<##"IN @>+@ -*$U@ E*,2A1F^F *N3G5.5@ 2.<#!"IN @>+@ -$ =(@#Z +PUA ML%B/2I],WR" 3EY.=4Y6__PNC@:7 #"\N @O/ D/Y.N0 5=Q0CTY> M3G5.5O_\+HX&EP ! O+@ ,+RX "$ZY !5W%"/3EY.=4Y6_?)(YP$$2^[_ M\CJ\__\[? "! (NK@ (3KD 'I04D [0 ,+JX ""\.!I?___WR3KD 'HN M6(]![OWR*T@ "" (*T !"Z.!I< 0+RX #"\-3KD %7<4(]*GTS?( !. M7DYU3E;]8$CG#P0J;@ (0F[_\& !:(0!TB 2,#0O DNP@0 @0 5G5"!N M P>$%*N P0!TB 2,#0O DNP@0 @0 5FXBZ-3KD %ON/ "\?/__9@9P M_V !7(P1M'\ "2[ @0 5FW"Z-/P9.N0 7S14CTH'9P %3KX\ "5G."Z- M3KD %ON/ "\?/__9@9P_V !380!TB O$!G%"Z-/P9.N0 7S14CS N__!@ M 4:8 $_F *(&X #!X04JX #$)N__Z^/ J9@Y2;O_^(&X #!X04JX ##H\ M?_]@)+I\?_]F D)%$ =(@#(%P_P "M!!.@#:?/_0(&X #!X04JX #+X\ #!M M!KX\ #EOT$)N__A";O_VOCP ;&804F[_^"!N P>$%*N Q@%+X\ &AF#E)N M__8@;@ ,'A!2K@ ,$ =(@& !%0]? *__)@#CU\ C_\F &/7P $/_R$ =( M@$C T+P )+L($ ($ #9P12;O_X+HU.N0 6^X\ +Q\__]F!G#_8 $/C!& MT?P )+L"! !6;<2F[__F<*0>[_Z"U(_>1@#"!N ! M4/WD6*X $$)N__R\ M? K9P:\? M9B*\? M9@12;O_\4T4NC4ZY !;[CP O'S__V8&,$;1_ DNP($ $9P@P!M!\_^!@ C &/ ]1O_T#&X M,/_T;0 @ QN $;_]&X '8,;@ Y__1O" QN $'_]&UD!&X ,/_T#&X "?_T M;PHP+O_T7T ]0/_T,"[_]+!N__)L0E)N__HO+O_L,&[_\B\(3KD $G@4(\R M+O_T2,'0@2U _^PNC4ZY !;[CP O'S__V8&0@KO_L8!Q*;O_V9PP@+O_L(F[]Y#* 8 H@+O_L(F[]Y#* 2F[__F8$ M4F[_\& K0NC4ZY !;[CP O'S__V8&0,!2K@ ,1,!F$#U\ '__"!N P>$%*N Q![OUD+4C]8& 4 M(&[]8!"'4J[]8"!N P>$%*N Q*!V<&OCP 76;B(&[]8$(00>[]9"U(_6!* M;O_^9PI![OWH+4C]Y& ,(&X $"U0_>18K@ 08"(P!B)N_>02@%*N_>0NC4ZY M !;[CP O'S__V8&1"$$IN__YF!%)N__!@ %:$ =(@$C MT+P )+L($ ($ #9P12;O_X+HU.N0 6^X\ +Q\__]F!G#_8 !1#!&T?P M )+L"! !6;<2F[__F<*0>[_Z"U(_>1@#"!N ! M4/WD6*X $$'N_60M2/U@ M8$PP!B)N_6 2@%*N_6"\? P;0:\? Y;QZ\? N9QB\? !E9Q*\? !%9PR\ M? M9P:\? K9AXNC4ZY !;[CP O'S__V8&O!8CR!?((!*;O_^9@12;O_P8$@NC4ZY M !;[CP O'S__V8$3G5.5@ 2.3G5.5@ 2.[S?_ X]0/_Z0F[_^& 4($R3 MR3)N__C1R0P0 !IG$%)N__A"0# N__BP;O_Z9>!*;O_Z9Q @3)/),F[_^-') M#! &F8*/6[_^/_Z %4 (#ZN__HO#&%06(\]0/_X0H P+O_ZT:T !D* ,"[_ M^-G 0H P+O_XGH!*AV\*""T !0 !9P#_8)^N__P@+0 &L*T #F\&*VT !@ . M("[__$J?3-\P@$Y>3G5.5O_X2.3G5.5O_^2.<##"IN M @H;@ ,+BX $#Z\ $@!S\ +PPO+0 &+PT&EP !).N0 >[S?_ X] M0/_^2F[__F8$ %4 ($* ,"[__M&M 8@+0 &L*T #F\&*VT !@ .0D P+O_^ M2I],WS" 3EY.=4Y6 !(YP,$/BX ""IN J^?/__9@1P_V N""T #9R1* MK0 $9QX@+0 (L*T !&,44ZT "# '(FT "!* 4FT ## '8 )P_TJ?3-\@@$Y> M3G5.5@ 2.<' $ZY !UECX ; 1P_V F/H=.N0 =AX^O 3+RX "#\'3KD M 'AX7(\\ #Z'3KD '7@, 9*GTS? ,!.7DYU3E;_WDCG!PQ"5TZY !TKB/ M "3^B/ "3_D)Y "3^"Z\ "+-6$ Q8J;@ (8 "3F "4HU*%6<4$!5( M@$C T+P )+L($ ($ %9N9*%6< C(,%0 B9P8,%0 G9D8<%1 &2( ^@"\- M4I=.N0 .!8CRA ( QF#BZ\ "0HB\-80 "5EB/( Q(P)"-/@ @33)'T'A$ 9(@#\ +R[__&$ 5I3KD 'I0/H!25TZY ![ BA M+HX&E____]XO#$ZY !Z+EB/+HQA #\/KP $B\-/SP TZY !X>%R/' "\ M/ #_9IQ@!BZ-80 VF 4L'P /&< _G:P? ^9P#^G& _Q+:QTH59@#]L$*7 M80 ME-Y "3^"ZY "3_DZY >K!\__]F$"Z\ "0^2\\ "0ZF$J6(]" MER\Y "3^C\Y "3^$ZY ^ER//H!.N0 9%Q*GTS?,,!.7DYU3E;_?"ZN M @O#@:7____@$ZY !Z+EB/+JX #"\.!I?___^ 3KD 'F\6(\NO D/HO M#@:7____@$ZY !YO%B/+HX&E____X _/ )3KD "65(\^O/__3KD &1< M3EY.=4Y6 !(YP$$*FX ""!Y "3_B"-6+D )/^4GD )/X2I],WR 3EY. M=4Y6 !(YP,<*FX "!XN TH;@ .1^T 5AC;9OQ*GTS?.(!.7DYU3E8 $CG M P1.N0 =98^ +Y\__]F!G#_8 DCZ'3KD '8>, ?!_ (X*D#;_ F]I* M;@ .9@0 50 0+KP (L_+RX "$ZY !Z?EB/2D!F"@!5 ,P!V!28!XNO MBT0O+@ (3KD 'I^6(]*0&8( %4 !3 '8#(^O 6+RX "#\'3KD 'AX7(]* M0&<6,_P (P DN@S^0 D\H )+J3G5.5O_\ M0E<_+@ ,+RX "&$ _SI3G5.5O_\0E<_+@ ,+RX "&$ _R)3G5. M5O_\/KP 3\N PO+@ (80#_"%R/3EY.=4Y6__Q.N0 9'0^K@ (3KD "Z M3EY.=4Y6 !(YP, 0D=@%C 'P?P #M"\ "0_BZ 3KD &2F4D>^? 0;>1* MGTS? (!.7DYU3E8 $CG 00J;@ (,"T L!\ -G*BZ-3KD &6.""T @ # M9PHNK0 $3KD '&*0D!(P"M @K0 $0FT # )M_X CZ53KD &3^2I], MWR 3EY.=4Y6 !(YP\$/BX "#Z'3KD ':,*D @#686,_P "0 DN@S^0 MD\H )+J3G5.5O_\3EY.=4Y6 !(YP<$*FX "# M + ? *L'P F8L("T M")"M 0\ &\@/H8O+0 $/Q5.N0 =1A3G5.5@ 2.<#!$ZY M !UECX OGS__V8&GY8CTI 9@@ 50 %, =@9#Z\ \O M+@ (/P=.N0 >'A7(].7DYU3E;__#Z\ $_+@ ,+RX "&$ _L13G5. M5@ 2.3G5.5O_R2.<#!$ON__([?'__ P@+@ ( M*T !"M @[? "" (ZO/__+HX&EP ! O+@ ,+PU.N0 :#90CSX +HU" M9TZY !M[%2/, =*GTS?((!.7DYU3E;]Y$CG#P0J;@ 00F[][$JN QG 1H M8 $8$)%+6X #/_R8 92KO_R4D4@;O_R2A!G"B!N__(,$ E9NA*16\<+JX M"#\%+RX #$ZY !M?%R/+6[_\@ ,VV[]["!N P,$ E0,!2K@ ,1,!F 0. M0F[]ZB!N P0$$B '@"P? M0,!2K@ ,1,!F#B!N P>$%*N Q2;OWJ'7P M(/_VOCP ,&8.'4?_]B!N P>$%*N P]?/___?"^/ J9AHM3?_X(&[_^#U0 M_?!4C2!N P>$%*N Q@.& J2F[]\&P$0F[]\! '2( R+OWPP_P "M!!T'S_ MT#U _? @;@ ,'A!2K@ ,OCP ,&T&OCP .6_*?/^^/ N9@Q"1B!N P>$%*N M R^/ J9A@M3?_X(&[_^#P05(T@;@ ,'A!2K@ ,8"I@'! '2( R!L/\ K0 M03P W'S_T"!N P>$%*N R^/ P;0:^/ Y;]A";OWHOCP ;&<&OCP 3&8. M4F[]Z"!N P>$%*N Q![OWR+4C_\A '2(!@ (,4F[]Z$IN_>AG"" \ !S MBF &(#P '1 (\ )0"+KD )0"/SP 3\\ HO#@:7___]\B\-3KD ',8 MW_P ,2F[]Z&<$< 1@ G "2,#;P& Y*;OWJ9E@,+@ P__9F*B!N__(,$ M M9B!312ZN @@;O_R$!!(@#\ 3KD &WL5(]2KO_R4F[][& 8+JX "! N__9( M@#\ 3KD &WL5(]2;OWL,"[][E-N_>Y*0&[<+JX "#\%+R[_\DZY !M?%R/ MVV[][& 8+JX "! N__9(@#\ 3KD &WL5(]2;OWL,"[][E-N_>Y*0&[<8 #[ MH# N_>Q*GTS?(.!.7DYU3E;_^$IN !!L!' &8 0P+@ 0/4 $"!N @@$"U M__P^K@ 0+RX #"\N__Q.N0 ?$10CTY>3G5.5O_X2FX $&P$< 9@!# N ! ] M0 0(&X "" 0+4#__#ZN ! O+@ ,+R[__$ZY !^0E"/3EY.=4Y6__@^K@ 0 M+RX #"\N AA /]^4(\M0/_\+JX #$ZY !Z4#(N !!>0;!!;Q0^K@ 0+RX M#"\N AAC%"/+4#__" N__Q.7DYU3E8 $CG PPJ;@ (/BX #"AN X(+ # M -G)$)L P^AR\-/Q1.N0 =1AQ4C[!\__]F!'#_8 HP!U-'2D!FWD) 2I],WS" 3EY.=4Y6 M !(YP,$'BX "2IN I3;0 ,;180!TB (FT "!* P'P _U*M A@$F 0+HT0 M!TB /P!.N0 ;C)4CTJ?3-\@@$Y>3G5.5O_^2.@$^A2\M 0_%4ZY !U&%R// !";0 ,8&X(+0 & -G/KX\ M IG$" M 30O @"PK0 (8B(@+0 (D*T !#H /H4O+0 $/Q5.N0 =1A< MCSP *VT ! (0FT #& H("T ")"M 0Z #Z%+RT !#\53KD '487(\\ #M\ M ?\ #"MM 0 "+I&9PH ;0 0 )P_V ($ =(@,!\ /]*GTS?(.!.7DYU3E8 M $CG 00^K@ (3KD ':,*D @#68$0D!@#@@M $ 68$0D!@ G !2I],WR M3EY.=4Y6 !(YP$$/JX "$ZY !VC"I ( UF!$) 8 8P%3G5.5@ 2.3G5.5@ 2.0 DKZ[S&4$N]1E$+G4 M90B[U&,(N\QD!"A48.B[S&4R( U"03(M 3G24A!0D%(0="!(@Q"0C0L 3G M2DA"0D)(0M*"L(%B"B/, "2OD) 8&X@#4)!,BT !.=)2$%"04A!T(&PE&8< M(%0P* $T6T !$) ,"T !$9 .T !B!4*I!@ BJ4( Q"03(L 3G24A!0D%( M0="!N\!F&D) ,"T !-%L 1"0# L 1&0#E 8HE6 "*(TCS DKY"0$J? M3-\P $Y>3G5.5O_\2.<##"IN @NC6$ _O(^+@ ,7D?F3U)'/H=A /V(+4#_ M_&8$0H!@2B!N__PH4%",N\QG,KG-9!!@!AC=4VX #$IN QF]& >0H P+@ , MV3G5.5O_P2.<##"\.!I?____P/RX $C\N ! O#@:7 M #"\N @@;@ 43I#?_ ! J0" .T+S____PN\!F D(=*&X #& 2'B5( MA]Y\ #"^? Y;P)>1QC'( [0O/____"[P&;B0A0@#$J?3-\P@$Y>3G5.5O_\ M2.@A@#" 'P'P M#QK Z(=314J'9P1*16;L8&@,;@ ( !!F)'H+8 P@!\!\ <:P.:'4T5*AV<$ M2D5F[$I%9@8"+0 #__]@/$IN !)G&DJ';!8@;@ ,(% 0O M(FX #%*1( =$ M@"X 8!8NAB\'3KD 'LP6(\N "!N__P:Z #2H=FYB -2I],WR#@3EY.=4Y6 M__Q(YP<$(&X "# 02, M0/_\("[__,"\ #__SX *FX %#PN !!*;@ 29QQ* M1VP80D P!T1 /@ @;@ ,(% 0O M(FX #%*18!)"@# '@,9(0!K 0H P!X#& M/@!*1V;J( U*GTS?(,!.7DYU3E8 $CG PP^+@ (2,?.O __\(!P 9P)2 MARIY "3QBA'V?D )/&+HQ.N0 'JP?/__9A8S_ , "2Z#/Y "3R@ MDNIP_V 2/JX "$)G+PU.N0 ,13G5.5@ 2./6[_ M^O_\8#A2;O_Z/KP 3\\ $O/ DL8O+0 &+PT&EP !).N0 >_C?_ M X]0/_^0H P+O_^T:T !KYN__QB /\T("T !K"M YO!BMM 8 #D) ,"[_ M_$J?3-\P@$Y>3G5.5O_^2._C?_ X]0/_^2F[__F86,_P !0 DN@S^0 D\H )+JFX((&X " 00 " @;@ ($!!(@%*N A* M &;43EY.=4Y6 !(YP$,*FX #"AN A@ E*,2A1F^AC=9OP@+@ (2I],WS M3EY.=4Y6 !(YP$,*FX #"AN A@!%*,4HTP+@ 04VX $$I ;P08E6;L4FX M$& "0APP+@ 04VX $$I 9O(@+@ (2I],WS 3EY.=4Y6 !(YP$,*FX #"AN M @8W6;\("X "$J?3-\P $Y>3G5.5@ 2. ! <2( ^@&$F' "^!F\$< %@$KX&; 1P_V *2A5FV$H49M1"0$J?3-\P MP$Y>3G5.5@ 2.<# #XN B^? !A;0J^? !Z;@3>?/_@, =*GTS? (!.7DYU M3E;__"ZN A.N0 @%9.7DYU(%]"@# ?6H (@ (GD )/&0^D! $/Q" "_ MR6(&3OD "LG\!#[P $( E.T$Y6 !(YQ\ +BX ""PN Q*AF86(_R M "3;" \@ (#\ !@2+R'8PHCQP DVQ"@& ZOH9F!GH!0H=@*'@!OH9E M#B &XX"\@&(&XX;CA&#N0H5*A&<.OH9E!(J$GH;BC.*.8.XCQP DVP@!4J? M3-\ \$Y>3G5*A6<*+KS_____B_P $YU3E;_^B!N @]:/_R__XNK@ 0,&X M%B\(,&X %"\(3KD $G@4(\O #\N__X_/ _3KD 'PT4(].7DYU3E;_^B!N M @]:/_R__XNK@ 0,&X %B\(,&X %"\(3KD $G@4(\O #\N__X_/ ! 3KD M 'PT4(].7DYU(]\ )0&3D$O.0 E 9.=4Y6__A(YQ\ +6X #/_\2FX $&X$ M< %@$@QN !8 $&\$0O/( $(O+O_X3KD (/F4(\O "\N A.N0 @ZA0CRU @O/* M $0O+@ (3KD (/(4(]M"BU\@ 00 (4D=*1VPT(&X #!"\ #!2K@ ,(&X M#!"\ "Y2K@ ,2D1L IY$?/]@#B!N P0O P4JX #%-&O$=N[D)&8&HO+@ ( M3KD (2R6(\Z # %T'P ,")N P2@%*N R\1V8,(&X #!"\ "Y2K@ ,, 5( MP"\ 3KD (0B6(\M0/_X+P O+@ (3KD (5V4(\M0 (+SR@ !$+RX "$ZY M "%.E"/+4 "%)&O$1MDB!N Q"$%*N P@+O_\2I],WP#P3EY.=4Y6__A( MYQ\ +6X #/_\2FX $&X$< %@$@QN !8 $&\$3G5.5O_22.(&X " P0 "UG"B!N @,$ K9@12K@ (8"0@;@ (#! M+F8&4F[_XF 0(&X "!K02F[_XF<$4F[_VE*N @@;@ (2A!G%"!N @,$ !E M9PH@;@ (#! 16; 0A4@;@ (#! 96<*(&X " P0 $5F1%*N @@;@ (#! M+6<$0D!@ G !/4#_X"!N @,$ M9PH@;@ (#! *V8$4JX "& *(&X "!C0 M4JX ""!N A*$&;N0A0NC@:7____[&$ .(M0/_6+HX&E____^A.N0 B5P] M0/_<2F[_X&<,,"[_W$1 D&[_VF (,"[_W)!N_]H]0/_:+R[_UC\N_]IA.E2/ M+P!.N0 A3I0CRU _](NKO_23KD (*L+4#_Y$IN_]YG" "N @/_D("[_ MY$J?3-\P $Y>3G5.5O_X2FX "&PL+7R !!__Q@&B\\H 1"\N__Q.N0 M@^90CRU __Q2;@ (2FX "&W@8"HM?( $'__& :+SR@ !$+R[__$ZY "% M.E"/+4#__%-N A*;@ (;N @+O_\3EY.=4Y6__@M? #__&!$+SR@ !$ M+R[__$ZY "%.E"/+4#__"\N__P@;@ ($!!(@-!\_]!(P"\ 3KD (0B6(\O M $ZY "#J%"/+4#__%*N @@;@ (#! ,&T*(&X " P0 #EOJ" N__Q.7DYU M3E;__$CG#P!"IR\N A.N0 @\A0CV8&0H!@ #60J3G5.5O_\2.3G5. M5O_\2.3G5.5@ 2.<' $JN AL#GP!("X "$2 +4 "& "0D9* MK@ (9@1"@&!>?AA@#" N CB@"U A2AR N C O'\ !FZ& ,("X ".. M+4 "%.'""X !P )9^P@+@ (X8 M0 (WKP ! ( ? O '^!K@ (2D9G M" "N @ (("X "$J?3-\ P$Y>3G5.5@ 2.3G5.5O_\2.3G7./ !_3G5*!V<$"@< @$YU& 9G M4@H$ (!K:AH':VQF#F ^& 9K7F<^&@=K7F!$YUXI=2!&D"9/1^_U,$'@0 / "3G4N!AX$3G5*!TYUNCS_ MZ&_P1 4F!D('ZJ\6/ " WH-ES!X$3G4:!VNF9]9V@+<%F@1G4&L\NCP &&3, M& <> R8&0@/JJYZ#:Z :!$('4P2^O ?_]B!DA'F#P $-Z'6\S__+D%:P8> M!&<"3G5^ $YUNCS_Z&^*1 4F!RX&'CP @&"^&@?+1!X&GH9GX&JZ1(<8!6"V MO@9F KZ&3G5*!TYUCOP $J&9AR.O/___W]*!P \ ).=4A&2$>]!V#J:_I^ M $YU&@9GV"@'9^AV@-I%V$2W!;<$F 5IY$('2$=(1KY&:P94!&G.XI](1QH# MNT3B3"8'AL8Z \;&GH-(1TA&-@9" \;%GH-D""8&0@/>@U-%)@9(0T)'CL-( M16L(.@?:A5,$/@4Z!]J\ @"X%'@1GC$YU2@=G#FH4SCP ?V$. #P DYU M?O].^0 ASA(YWZ 'P<>/ !!+#R !!) =.N0 A;C/0DZY "%IBP"3KD M (:Z9TZ>/ !#1 >^/ ?8P)^ .ZO? J/" !!^0 B+AR%G0!8 ;DI)J$ MW) H!R8%Y*.>@VKP+@18B%("XHM1R?_R?@!.N0 B()G!%(&+@8D!WP '!^< M/ !!9RP2!FH"1 ;@GGI'W(9;S?_\' 7"/ " C $N/+%R&$!.N0 A_PL DZY M "%N$S? 7Y.=1H'9U(8!F=HVD781': MP2W!=H$:5X8 [E%XEU(13H&0@=" M!3@%R,=(1"8'2$/&Q=B#2$8F!L;'V(-"1-D$2$1(1\[&2$9(1=Z$:@S>O M ( >!6<:3G53!6D491)X0-Z$WH=D!.*74@4>!6<"3G5^ $YU:OJ]!XZ\____ M?TH' #P DYU>$)*AF@@L5WT$!6)' @"K$0$ %5@ @ *J $ M50 @ H $ ! @ $ @ $ @ $ @ $ @ M $ @ $ @ $ @;6,V.#,T,R!F;&]A=&EN9R!P;VEN M="!F:7)M=V%R92 H8RD@8V]P>7)I9VAT(#$Y.#$@8GD@;6]T;W)O;&$@:6YC M+@!.5@ 2.<'!"IN A"1T)&8 )2C1 52(!(P-"\ "2["! "! !6;J#!4 M*V8$4HU@"@P5 "UF!%*-4D9@#L_\ H0'4B WD#>?/_0#!4 ,&T&#!4 .6_F M2D9G!C '1$ ^ # '2I],WR# 3EY.=0 ! (! 0(! 0 ! 0(! 0$! 0 M ! ! ,% 4% ! 0(! ! ' 0(! $! 0(! 0(! M 0(! 0$! @$! 0 (! 0$! 08! 00! 0$# 0(! 00" 0@! M 0 $! 0D! 0$! 0$! % 0 M 0# @# 8! @! @! 0! 0,! 0 % M $! 0 % ! 0 ! 0 " @ M 4! 4! $! $! (% 8! (! $! M 8% ! 0 ! (! (! 0$! 0 ! @,! @$! M 0$! 0 ! 0 ! E-T86-K($]V97)F;&]W)$,@ 0 !0!D "6@@ ! M ! 2 &0 )JB $ #P $ D 9 FJ0 0 * 0 " !D "6?@ ! H M! + &0 +]: $ 0 "H > FT( 0 *0 ":5 ! $ M M )JF "4 FI (P ":D@ ! B M ) F40 0 - 0 #@!X "9: ! T ! - '@ +]D $ M(P $ !H 8P E H 0 C 0 &0!C ":F ! !$ ! 7 '@ M $MX !/. 2 $.8 !/. 3S@ $\X !/. 1^ $6Y+ M15)-250N3U!4 '( )7@ =P E> H 2T5234E4+D]05 !+15)-250N3U!4 $M% M4DU)5"Y$14( =P!+15)-250N3$]' '< )6, )3)D "4P,G@ )60 )7@ 8 M5@ &Q !?H <] &60 !O\ <; )7, )7, )60 )60 )6QD "4P M,G@ )60 )60 )60 00 $( !# 1 $4 !& 4P %H M E)@ )18 "4B D_@ )48 "3P DX@ )0H "5* M $$ !% 3@ %D FC )IP "9\ F&@ )BP ":@ M $$ !% 3@ %D HJ@ *+H "B: G\ *" "B^ M $$ !% 3@ %D J' *BP "H, I6 *8@ M "HP $$ !% 3@ %D KH@ *[( "N2 JQ@ M*O8 "NV $$ !% 3@ %D LT +. "S L M3 +'P "SD06)OP "WL M[ +>P "WL M[ +>P "WL M[ +>P "WL M MH !! 10 $X !3 60 "\* O; +O@ "\* M N< +V( "]P $$ !" 10 $8 !3 6@ M #/R T& ,Z #/B Q$@ +^P #"( T' !! 1 M $4 !& 6@ #;\ W(@ -)@ #;L UK@ -C@ # !7* 6C@ %HX !7 M, 6-X % !KP@ :\( &O" M !KP@ :\( &O" !KP@ :H( &O" !KP@ :\( &LF !KP@ :BX M &O" !KP@ :M8 )*V #__P DK8 #0 'DR !Y? >/@ 'D8 M !Y4 >7P 'E\ !XU@ ! 0$! 0$! 0$A(0$A(0$! 0$! 0$! 0$! M 0$! 0$! 2(" @(" @(" @(" @(" @($! 0$! 0$! 0$ @(" @(" @@(" @( M" @(" @(" @(" @(" @(" @(" @( @(" @("$! 0$! 0$! 0$! 0$! 0$! 0 M$! 0$! 0$! " @(" 0 !#4"]-+38X2RAT;2DL(%9E'B8,9B@&#!0$A@<%A(8% HF%@H*%! 0 M"B86# H4$"X0!@8B$A8B$ 8&)!(6% @&#B(0!@8,#@@&"@X2" H4# @&#B(0 M!@8,#@@&"@X2#!0:&!@:'!@>%A@6#A0B&!XB&! *#@H."BHB&B :%A(@$" > M+"0*$@HR&AX0#!0,% @&!@P.%@H,% @&!@P.%A86" 8." 82"@84$@P,#@8. M!@@6# 8<$@P&" 8,#!0(!@8,#A8.%@@&!@X,!A02# P4" 8&# X6%A8(!@X( M!A02# P6$ P4$@P,%A ,%!(:& 82!AX&' 8># 88" @&#@8:(@8&!@8&!@8( M!@8&!@@&!@8&!@X&#@80!@@,# P,#!X2#A0*"!(.% H(!@8,0 8&# @&!@P( M!@8," 8&# @&!@P(!@8,$ 80!A0$!@8.!@X&#@9$%@8J!AX@&"@0$A@<7BH& M&@8>&@8P!AH&' X&)!(&" 8&!@8." 8*!@H&# H&$ X.# P,"@H4#B &"!(0 M!@8&!@H*#AH.# 8,# 8,!@8&!A *!@H&%A # 8,# 80#@P&!@80!@8&"@8*!A80' 8($@X&!@H(#AX, M!@P,!@P&!A &!@82%A &"@86$!P&"!(." H(#AX,!@P,!@P&!@80!@X(!@8* M!@X*# 8*!A80' 8($@X("@@.'@P&# P&# 8&$ H&"@86$!P&" 8&!@8." 8* M!@H&# H&#@P,# H*%!H6!@@2$ 8.%!H&!@8&"@H(! 8&$ 8,!@P&# H*!@8* M"@@*%A 6"@(% @("A 4% P*("0V(@8*!C .""H."A(()!H.""((+$@($B0B$@@B M#@@>$"82#C(>'@8*!A0>"AH*!BH2% H**A0*.$P0%! *)! .#"P@"@8,"A @ M"@8,"A9T$ 8&" 80!@8(" 80!@8(" 80!@8(" 80!@8(" 80!@8(" 80"! ( M!@@*!@H&! 8$!@0&! H$!GIF#!@4(!@&" X$!@0&! 8$!@0&! 8$#@0D"A ( M"A (" @(" @(" @(" @(" @("@H*"@H*"@@0" H0" @(" @(" @*$ @*$ H0 M"@H*"@H($ @*"@@0" @(" @(" H0" @(" @(" H2"@H*"@@0" H0" H0" @* M$ @("A (" @(" @*$ @(" @*$ @*"@H($ @(" @(" @("A *$ @*"@@0" @( M" H0" @(" H0"A *$ @*"@H*"@@0"@H(" @("!8.# 8$7#(D%A0>K @&# 8, M!B L(@8@> 8@)A@D+!X0%A 6(,04%D8B%$I0 M4"8*"@@&'EPF!@0@&D0!')X0$ P'@X&!!P0 M"!(&!$A.)A8.&@H>"AX." 8$'!1J#@8$&FH.8 %>" 8&&"H(!@86*@@&!A8J M" 8&%F F)!P@#D0>(AI6."I2)%I&(%Q *$(T+DHB&AJ&+C@V#$IP 1Z,K @( M#@8$$B D!@0<%B((%@8$(D R&"8&!!00!@2((@8$'A)F& 8$2%(B'!P>' &( M%A(H%CQ $BH2# @\&A(6&!88%!@<#A94,!(67AH2%A@6&!(8' X6'# 2%@&0 M-A!$+#8@"CH6#B(6&!84$% @'AP!.AP@ ;P8" @@*C8( 8@!U 0$! 0$4 X. M#@X.#@X.#@X.#@X.#@X.#@X.' 0$! 0$! 0$!%P$! 0$! 1(! 0$! 0$! 0< M! 0$! 0BXN+@ @(%-E;F1E+BXN " @16UP9F%N9V4N+BX ("!396YD92]3 M97)V97(N+BX +2TM+2TM+2TM+2TM+2TM+2TM+0 @($5M<&9A;F=E+U-E&-O9&4I 7U\ 7U\ 3DX 4&%D9&EN9RA,A&YG M92D !?7P!?7P Y.0!086-K971S=&%R="A(97AC;V1E*0 %]? %]? $Y. M %]? %]? $Y. $AA;F1S:&%K92A(97AC;V1E*0 %]? %]? $Y. %%U;W1E M*%IE:6-H96XI 7P!? %@ 7P!? %@ 3TL 04)"4E5#2 !396YD96X !% M;7!F86YG96X !?7U]?7U]?7U]?7U]?7U]?7U]?7U\ 7U]?7U]?7U]?7U]? M7U]?7U]?7U]? %A86%A86%A86%A86%A86%A86%A86 !$871E:3H !?7U]? M7U]?7U]?7U]?7U]?7U]?7U\ 7U]?7U]?7U]?7U]?7U]?7U]?7U]? %A86%A8 M6%A86%A86%A86%A86%A86 "!8BX@3F%M93H !?7U]?7U]? %]?7U]?7U\ M6%A86%A86 !$871E:65N((%B97)T'AX> !697)S:6]N7U\N7U\ .3DY.0!X>'AX>'@ M7U\M7U\M7U\ .3DY.3DY $1I97-EF5U9W0@ M=V5R9&5N+@!$871E:2 G)7,G(&5X:7-T:65R="X@3F5U97(@3F%M93H@)R5S M)RX 16UP9F%N9V5N(&5R9F]L9W)E:6-H(&)E96YD970N "HJ*D9A=&%L97(@ M1&%T96EF96AL97(N $1A=&5I(""4P,G@^('PE8WP 2V5I;B!(86YD#X@?"5C? !"96=I;FX@9&5S($5M<&9A;F"4P,G@^('PE8WP (" M/B!P861D:6YG.B E9" J(#PP>"4P,G@^ " @ M+3X@:&%N9'-H86ME('=A#X@?"5C? @("T^($AA;F1S M:&%K92!:96EC:&5N(&5M<&9A;F=E;BX ($1A=&5I("5S(&%N9V5F;W)D97)T M("A09F%D/25S+$1A=&5I/25S*0!%;7!F86YG96XH4V5R=F5R*2!EF5I8VAE;G=E M:7-E70!;,%U;5')A;G-A:W1I;VYS(%!R;RU\=&]K;VQL(&)E9V]N;F5N75M/ M2UT 6S-=6T9A=&%L97(@1F5H;&5R?&EM(%!R;W1O:V]L;%U;04)"4E5#2%T M6S-=6T1I92!$871E:2!K86YN(&YI8VAT?&5R>F5U9W0@=V5R9&5N75M!0D)2 M54-(70!;,UU;1F%T86QE 7U %]@ # 8 !& #__P 5 $ 7_ M &!P !@\ P & $1@ __\ " ( &%P !BL 8L , !@ $8 M /__ !0 0 !BT 8^ &/P # 8 A& #__@ 1 $ 9 &3@ M!D\ P & (1@ __X #@ ! &8 !FP 9M , !@ "$8 /_^ P M 0 !FX 9\ &?0 # 8 A& #__@ . $ 9^ &?P !H P & M 1@ __\ 0 ! &A !IH :; 4 !@ "$8 /__ !8 0 !IP M :K &K % 8 A& #__P / $ :M &NP !KP P & (0< M__\ #@ ! &O0 !L( ;/ , !@ "$8 /__ 4 #0 !M0 ;; & MY # 8 A& #__P ' D ;K '#0 !PX !0 & 1@ __\ (@ ! M '#P !S4 '7P % 8 M !& #__P G $ =@ '@P !X0 !0 & 1@ __\ (P ! 'A0 M!ZT >N , !@ $8 /__ "@ 0 !Z\ ?. 'SP # 8 !& #_ M_P ? $ ?0 'T0 !]( P & 1@ __\ 0 ! 'TP !_P @E M , !@ !$8 /__ "D *0 #P, \% /*0 # 8 !& #__P " "0 M \K /- #T, P & $1@ __\ "0 / /3P #V ]A , !@ M$8 /_^ !$ 0 #V( ^+ /M # 8 !& #__P I "D _= 0 M!0 $ 8 P & (1@ __\ * !__\ 0 ' !D 4 9 M < @ " !0 1 4 (! $ P & !D " M)@,! 3_____ " ) "P,! 7_____ " , + M !P,! ;_____ " . 2 "@,! +_____ " M0P < "@,! " A !D P$ 4 3 !$ "0 0 !0 M /\1 " % ( K_____ !P 3@ % ! O_____ !P M ( 7 $ % ! S_____ !P <0 ( % ! W_____ M !P A@ , % ! [_____ !P FP 0 % ! __ M____ !P L 4 % ! !#_____ !P Q0 8 % ! M C_____ !P V@ < % ! !@ $@ 7 !0 /\1 - M$@ & !/_____ !P [P $@ ! !3_____ !P _ M $ $@ ! !7_____ !P !# 4 $@ ! !;_____ !P ( ! M$P 0 $@ ! !?_____ !P !)@ ( $@ ! !'_____ !P M !- , $@ ! "$ &0 @ !0 /\1 4 $P ( !K_____ !P M !1@ $P ! !O_____ !P !40 $ $P ! !S_____ M !P !7P , $P ! !W_____ !P ( !<0 ( $P ! ![_ M____ !P !A0 0 $P ! !______ !P !F0 8 $P ! M "#_____ !P !IP < $P ! !C_____ !P ( !MP 4 M$P ! < (@ M !0 /\1 > &@ , "/_____ !P !RP M &@ ! "3_____ !P !WP 8 &@ ! "7_____ !P ( ! M]@ @ &@ ! ";_____ !P "$0 < &@ ! "?_____ !P M ")@ H &@ ! "C_____ !P ( ".@ 4 &@ ! "G_____ !P M "50 $ &@ ! "K_____ !P ";@ , &@ ! "O_____ M !P "> ( &@ ! "S_____ !P "A D &@ ! "W_ M____ !P "F@ L &@ ! "'_____ !P ( "K0 0 &@ ! M__\ 0 ! !0 0 (1 &%@8! #_____ !P ( "OP$! P M%0 !__\ 0 ! !0 0 (1 & D! #_____ !P ( "U0 ! M! %@ !__\ 0 ! !0 0 (1 '#P@ 7 @ ! !, $@ 2 !8 6E@ & D (@ ! !'_____ !X M" 6L@ 7 @ ! !8 % 5 !8 6S@ & H (@ ! !7_____ M !X " 6Z@ 7 @ ! !/_____ !X " 7!@ @ @ ! !@ M%P 7 !8 7(@ & L (@ ! !;_____ !X " 7/@ @ @ ! M !L &0 : !8 76@ & P (@ ! !K_____ !X " 7=@ 8 M 0 ! !C_____ !X " 7D@ A 0 ! !S_____ !H !P $4 & M X " ! #_____ !H )0 $4P @ X " !__\ 0 D !0 0 (1 M )@ 2 +_____ !8 @ @ 7K@ ' $ %P ! /_____ !8 @ @ M 7R@ ' $ %P ! 8 ! % !0 /\1 # , ( ! 7_____ !T M" 7Y@ + %0 ! /_____ !4 8 @ !@ ! D !P ( M !0 /\1 # 0 ( ! C_____ !T " 8'@ + %0 ! ;_ M____ !4 8.@ "0 ! P "@ + !0 /\1 # 8 ( ! M O_____ !T " 85@ 9 !P ! G_____ !4 8<@ M$P ! \ #0 . !0 /\1 # H ( ! [_____ !T " 8C@ ; M !0 ! S_____ !4 8J@ "P ! !( $ 1 !0 /\1 M # L ( ! !'_____ !T " 8Q@ ; !0 ! ______ !4 M 8X@ $P ! !4 $P 4 !0 /\1 # P ( ! !3_____ !T M" 8_@ ; !0 ! !+_____ !4 9&@ %0 ! !@ %@ 7 M !0 /\1 # @ ( ! !?_____ !T " 9-@ 9 !P ! !7_ M____ !4 94@ $P ! !L &0 : !0 /\1 # T ( ! M !K_____ !T " 9;@ > @ ! !C_____ !4 9B@ M% ! !S_____ !H 0 %]P : \ "0 ! !\ '0 > !0 /\1 # M < ( ! ![_____ !T " 9I@ 9 !P ! !S_____ !4 9 MP@ $P ! "#_____ !8 @ @ 9W@ ' $ %P ! "'_____ !8 @ @ M 9^@ ' $ %P ! "+_____ !H 0 &4 / \ "0 ! "/_____ !H M!P ( &60 # \ "0 ! "3_____ !8 @ @ :%@ ' $ %P ! #_____ M !8 H @ :,@ ' $ %P !__\ 0 - !0 0 (1 $(0L. +_ M____ !T " :3@ * , "P ! /_____ !H !P &@00,"PP " ! M 3_____ !4 ::@ @ (0 ! 7_____ !4 :A@ < M(0 ! < !@ & !0 0 ,1\0 ' $ $P " 7_____ !4 :H@ # M" #0 ! C_____ !T :O@( !@0$( (! G_____ !T : MV@, "04#( (! K_____ !D 0 (1 0$# ,!& 8% O_____ !4 M :]@$$"@D&& 8 S_____ !4 ;$@$$! H&&P8 W_____ !4 M ;+@$$#0H$' 8 #_____ !4 ( ;2@$$!@L$&08 __\ 0 % M !0 0 (1 ,@ * +_____ !4 ;9@ % $ )P ! /_ M____ !4 ;@@ * ( '@ ! 3_____ !T " ;G@ * , "P ! M 7_____ !X " ;N@ % 4 * ! #_____ !H )P (3@ 4 @ M" !__\ 0 ! !0 0 (1 & 0(! M P '0 !__\ 0 ! !0 0 (1 $(08! #_____ !P ( . MEP8 P ( !__\ 0 ! !0 0 (1 &(@NMhB@`R.dBgBgNPXJ@f.m?<NMFTB@`&.dBgBgNPX>/9dNOXpN^NuNV>`NH&NKN^NuNVNT.N8.N8BBgNNT`.&NK>NQ y &f09,`b y .f.?<BgNPX y h-P>?</</.Ng y h-P./.NgX.?<?/9NLX>?.N`,>.N``|g|gX|g̰|g>?9,/9dNOT\BWNQ`6N^NuNV.Y?. ?<NPX.?.NMFT=@0.N^NuNVBW?.?9?9^?9j?9hBg?. /.NP@N^NuNV.?.BgNPX.Q/]/Y/U n/NMJn m0. `0.=@Jn f09bHyj`0. =@ Jn m0. `0.=@0.V@"n"Q3@0.V@"n"Q3@ nf*>?.?.?.BgBgBgBgBgNL`Jnm>?.?.?.?9b09H@?Bg yd2.?0BgNL>?.?.?.?9b09H@?Bg yd2.?0?<NL>?.?.?.?<Bg n/NO~N^NuNV.Y?.BgNPX.//Q/]/.NMJn m0. `0.=@Jn f09bHyj`0. =@ Jn m0. `0.=@0.V@"n3@0.V@"n3@ nf,>?.?.?.BgBgBgBg?<NL`Jnm>?.?.?.?9b09H@?Bg yd2.?0?<NL>?.?.?.?9b09H@?Bg yd2.?0?<NLN^NuNV.?<Bg?Bg??<aT>Bg?Bg??</9dNOT\a.?< BgNPX` >NR> NRJ@fBn`.?<NRT . f> ?<NRTRn0.|ofBn y-h$` nH>?<NRTR nJf>NR@ .g > ?<NRT>`NH`, .gZ> ?<NRT> ?<NRT y-h<` nH>?<NRTR nJf>NR.?9^?9j?9hBgNPP3b>?9^?9j?9h?9b09H@?Bg yd?(pNN>?9^?9j?9h?9bNQ"P>`NH>`NHP>`NHN^NuNV>`NHP>`NH>`NI>/9dNOX>bNQ\>bNQv>?9^?9j?9h?9b?9HBg yd?(pNNRB?<NNTN^NuNV.Y?<Bg?/<NR,XJ@g>?<aT`..N_J@g>?<atT`>?<adT>Bg?/<NR,XJ@g>?<aT`,./Nz.X./NyX>Bg?/<NR,XJ@f>?<aDT`./`Nz.X./`NyX>Bg??<aT`>?<aTJnZm>Bg?/.NLXBW?</.aJ\ nH>W/?<6NR\Jg./.Nz.X`2/././.NIP/NIP./</.NgP.Y?/.NLXBW?</.a\>?/</.NTPRn0.м @Jf.NdpN^NuNV0.`.?<Bg? ?<NVT>Bg??<NVT`>?<NVT>Bg? ?<NVT`.?<Bg? ?<NVT`>?<NVT3D`3>Bg? ?<NVT`.?<Bg? ?<NVT`>?<NVT`3>Bg?0. @"|?0 /.NO*\Rn0.м @JfN^NuNV.?<BgNPXBn`0.м @ hf n2.Ҽ"A2)  p -P0. @"| p=P0. @"|00 `J>/<P/.NgP`D>/<S/.NgP`,>/<W/.NgP``|cg|dg°|xgRn0.м @Jf =|}Bn`T0.м @ hf80. @"|00 no0.`0. @"|00 =@Rn0.м @JfBW?</.N\BW?</.N\.?<?/.NLX|fBn`0.м @ hf n2.Ҽ"A2)  p -P nJg0. @"|00 `N nH=@=|`L.Q/<\/.NUtP=@`0.Q/<_/.NUtP=@``|cg|dg|xgJno0. @"| p0Rn0.м @Jf >?Bg?Bg??<NGT`4B??/9NLX=@>?Bg?(?*?Bg??"?)?FN7=@g>/?-?<NGT` y hh. ?<?.?LN7=@g>0?1?<NGT``||b@0@b PNJng>?</9 N\`> ?</9 N\BB?<a,\>?<!/9 N\BB?<!a\BW?<"/9 N\BB?<"a\>?<NRT>/9 NLX>?#B<.~/<Nz.XBW?</9 N\BW?<!/9 N\>?<"/9 N\ y h y h y h8 y h y hP y hhBWa BWaN^NuNV y hl-P>/</NyPB../</.NgP y h-P>/</NyPB../</.NgP>/< y h/NgPJng*BB?<a~\BB?<ap\BB?< ab\N^NuNV>F/< y h/NgP./< y h/NgP>/< y hD/NgP>R/< y h/NgP>/< y h/NgPJng.l/<F?<a|\ 9>g BB?<a`\#>./< n?(?.?.?<Bg/9 NO~N^NuNV.Q?<BgNPX n hl-P n hl.NzPS@=@>/./.NyP n2nB.Y?/.NLXBW?</.N\>??.?<?</9 NO |fl>?</9 N\BB?<a\> ?<NVT|gpA`BW?</9 N\BB?<a\B@``>?.?<?<!/9 NO |!fZ>?<!/9 N\BB?<!aZ\BW?<NKTBW?<!/9 N\BB?<!a*\pT``>?<NRTB@N^NuNV.8N?S By<9 H??< NFX.8N?J@g .8N?H//9NJ4P`B3>N 9 H`za `a `ta `faT `Za `Np`N.?<?9NFB@``H |rW h N`N^NuNV09By~@RyBDo>?<NGTpA`$3l.nNCNET.n?<?9ByB09?<NGTpA``H |rW hNN^NuNV09By~@RyBDo>?<NGTpA`JN .?<NFTJyg./<NSX#<`./<NSX#?< NGTpA`b./<Nz.X <-@-@.NzP=@.?.?9N RyFByB09?<NGTpA``H |rW hNN^NuNV09By~@RyBDo>?<NGTpA`>.n?9N?9?<NGTpA`TpD`P.NHpE`@RyR9 H`0pA`,>?<NGTpA``H |FrW hNN^NuNV09By~@RyBDo>?<NGTpA`R.nBg?9NFN:RJ@fpB`f.?<NFTpF`P.NHpE`@RyR9 H`0pA`,>?<NGTpA``H |vrW hNN^NuNV09By~@RyBDo>?<NGTpA`.nBg?9?<NGTpA``H |rW hNN^NuNV.8N?R By<9 H??< NFX.8N?J@g .8N?H//9NJ4P`B3>N 9 H`\az `ha `\a `Pp`P.?<?9NFB@``|A|b@0@ PN`"N^NuNV09By~@RyBDo>?<NGTpA`P3l.n/]/YN<,P`=n` |n2nBRn n m.nND>.nNC.n?<?9?<NGTpA``H |(rW hNN^NuNV09By~@RyBDo>?<NGTpA`x.n/U/YN<,P`HRyR09\y~@Ry\Do>?<NGTpA`*Jy?<NGTpA`.nNC.n?<?.?<YN:\ByB9 H`RyR09\y~@Ry\Do>?<NGTpA`Jy?<NGTpA`^BBg?.?<YN:\ByB9 H`80.y?<NGTpA`.n/<Nz.XBn=|J9fvBn` |2nP .am .zn . . f|. ..g& .Am .Zo .0m .9o| ..fJnm|`=n nmJnm 0.n|l0nRnRn |2nJf@ |2nBJy:gBn`l./<?<NF\Jnl&=n0n.Rn |2nB>/< <2.HЁ/RNgPRn>/<NR,XJ@f n2mvJyg./<NSX#<`./<NSX#N BBg?9?<NGTpA`BBg?9?<NGTpA``H |`rW hNN^NuNV09By~@RyBDo>?<NGTpA`.n/U/YN<,P`0.y?<NGTpA`~09\y~@Ry\Do>?<NGTpA`PBBg?.?<YN:\RyRByB9 H`$BBg?9/<nNBX3B\ByB09?<NGTpA`pD`Jy?<NGTpA`v09\y~@Ry\Do>?<NGTpA`HBBg?.?<YN:\RyRByB9 H`0.y?<NGTpA` y<(g>?<NGTpA`BBg?9N B9pF`f.nNHpE`VBBg?9?<NGTpA``H |rW hNN^NuNVNET./<NzPX?Bg?<RN:\N-=@0.N^NuNVBn` n.n?<Bg?<GN:\.n/Y/UN<,P `2Jnfp`X`N Rn n mdB@N^NuNV>\/.NU X-@Jg .Tf n|\ nB(` nBN^NuNV nJ(g./.NyX. /.NyXN^NuNVBW/.T?<GNR\/.?<NRT|A _ n|: nJ(f./.NyXN^NuNV nH>W?<NRT.T?<;NRTN^NuNV./.Nz.X./.aX. /Nz.X.U//.NMP.a./.aX0.N^NuNV. /.aX.U/. /.NMP.aV.a$Jng."?<NRT0.N^NuNVBW/.?<NNR\JgB@`.@/<Nz.XpN^NuNV>ONRJgB@`.@/<Nz.XpN^NuNVHJyZga v .Y g .N ga 0. |=@ n^ o=|Z > ?. . H??<a \Jg n2n BJg.?< a TKJyBg*=|`> ?<NRTRn0.yoJyg yo> ?9?<$a X090. |#0. |#@0. | 0. | .A . H.Bn`( n2n0n"n0H.ARn0.n m.H|@.HA|?@.H| 09hB.a pJL N^NuNV.VaV.aJ@g0.`./aXJ@g0.`.H|yfBn`./a`XJ@g0.`..Hygn.H|"n2./aXJ@g0.`6..HygZ.H.HA@.H|"n 2./aXJ@g0.`..Hyg.H.HA@nBnBn`t./a\XJ@g0.`JygJylg..Hyf=|`0.H.HA@ n2nRn n0nnJnfV n0PB./aXJ@g0.`..H|@.Hyg=|JngJg n0PB n > n?.H??<aR\Jg.?<a>T.H|@.HA|?@.H.g.H>.H??< aXB@`4Bn` >NRJfBW?<NKTRn ndm.HN^NuNV0.r `|<-@/<<0.@|?HЮ/NIP-@0.|@HЮ-@ .N^NuNV>,NR>a/ n N^NuNV>,NR>ax-@ .l .м `` .o .`pN^NuNV`>2N"? n 0 n PAf> ap` 9W f .VaJ n PTg"Jyg2JyTg*.VaDym> azRy n BPp`h>NRJgp/.?<NRT _Jyg: yDo0 nH>W nH?/9VaX??<#a\B@N^NuNVBWN"? n0 n PAf > ap`$ n PTf> aRy nBPp`B@N^NuNVBn`x.>NR@Jyg( yDo.H>W.H??< a^X>NRJfN^NuNV`NJyg, yDo" nH>W nH??<aX nH>?<NRTR nJfN^NuNVBn.ar`.a|l n m>NRJg>NRJgRBn`>>NR@Jyg" yDo.H>.H??<%aXX>NRJfBW?<dNKT.Hyf>NRJf >&aB@`Rn`>>aB@N^NuNVJygF././././. ?.NT//96NT.6?< NmTN^NuNVJygF././././. ?. NT//9NT.?< NmTJnm>?<NVTN^NuNV>?.?.?.?. ?. a >?.?.?.?. ?. ?.aP N^NuNV.?<?N^Nu#"<psNBNuNVBBJlDRBJ lD RB0. -@0.2. An=@ .gDN^NuNVH?BCB..,. f# <`hlDRCJlDRCn8fzB`0l :HGH`xe`Jge`|fD# D`# JLN^NuNV3Z0.|Hм-@=|` nH2nZ2RRn nm.NnB@09N^NuNV#Zf#Jj#bn#r#0v#`z#f> aF3pN^NuNV>a*pN^NuNV#0>NJN^NuNV3b3 d>NJN^NuNV3b3 d3 f3h3j3l3n3p3r3t3v3x3 z3"|#$03(~3*>NJ n,0 n00 n40 n80 n<0 n@0B@09N^NuNV#03 b>2NJN^NuNV3b3 d3 f3h3j3l3n3p3r>3NJN^NuNV3b# 0>4NJN^NuNV3b>5NJN^NuNV#0>6NJ n 0 n0 n0 n0B@09N^NuNV#0# 4>ZNJ n0B@09N^NuNV3b3 d3 f3h3j3l3n3p>INJN^NuNV3b3 d3 f3h3j3l3n3p>JNJN^NuNV>MNJ n0 n 0 n0 n0B@09N^NuNV3b# 0>NNJN^NuNV#03 b>NJN^NuNV#03 b3d>NJN^NuNV#03 b3d>!NJN^NuNV#03 b3d3f3h3j3l>*NJN^NuNV#03 b3d3f3h>+NJN^NuNV#03 b>,NJ n0 n0B@09N^NuNV#03 b3d3f3h3j3l3n3p>/NJN^NuNV#0>nNJN^NuNV3b3 d>pNJ n `B@09N^NuNV3b3 d3 f3h3j>dNJN^NuNV3b3 d3 f3h3j>eNJN^NuNV3b>fNJN^NuNV3b>gNJN^NuNV3b3 d>hNJ n 0 n0 n0 n0B@09N^NuNV3b>kNJN^Nu#NN/9Nu#NM/9Nu#NA/9NuNVHBW/.Ng"X>m >NdB@`33pJLN^NuNV> /.aXN^NuNVBW/.aXN^NuNVH*n(n BG`|lRG0&@0+|f|mB` wg Wf>?</ Nc\\<`p ag Af>>?</ Nf(\<l>?</ Nc\\<`>B?Ngl\`$ rg Rf>Bg/ Nf(\<`B`@JFlB`8Bk 6B'@'@ rg Rf7|`7|Jnfk JL8N^NuNVBW/. /.aPN^NuNVBW/. /.aPN^NuNV>/. /.aPN^NuNVHNuBW/<?Ng"X>/<?Ng"X>/<?Ng"X n2n B*n`&HHм @g H| `HRJf> /.N_XJL N^NuNV. /./< Nh6PN^NuNV./. /.Nh6PN^NuNVH *n. (M`RJf` fB`Sf JL0N^NuNVH*n. H>/ aXJL N^NuNV. /./<NUPN^NuNV./. /.NUPN^NuNVHK:;|.NzPR@;@ ./Nz.XA+H +@./. / NUPJL N^NuNV`H*nBn`HHм @gT n R HHм @f.N[<|fp`r0Ff.?N_4TJgN<%g8.N[<|fp`6H@g.?N_4T0.``` n R Bn<*fRn n R :<`$|fBEH2 A:| n R <0m<9oBnBn<lfRn n R `<hfRn n R H`T=| `=|`=|HHм @gRn.N[<|fp`>0FfJng A-H` n-PXBn|+g|-f"|-fRnSE.N[<|fp`BBn`0Fg0|`0<=F n0m nFnv n9o nAmdn0 n o 0._@=@0.nlBRn/.0n/NIP2.HЁ-@.N[<|fp`:0SEJ@n\.?N_4TJnf0.`Jng .D-@Jng n `Jng ."n2` ."n2JnfRn`.N[<|fp`<sf<-|``.N[<|fp`BW/.`?a\J@f=|`<cf-|`|fz=|`bBn n H|^@R Df=| n R Ad-H`` n`R` n R Jg<]f n`BAd-H`Jng A-H` n-PX`"0"nR.N[<|fp`0SEJ@o>/.`?a\J@f.?N_4T<cg nBJnfRn`ZHHм @gRn.N[<|fp`D0FfJng A-H` n-PXAd-H``L0"n`R`|0m|9o|.g|eg|Eg |-g|+f.N[<|fp`0SEJ@n.?N_4TS` n`BJng/./dNzX _ `/./dNzX _ JnfRn`H.N[<|fp`LH@g.?N_4T0.`2``H |$rW h8N n HR J@fN0.JL N^NuNVH. H>/. NX>Jng JGgB@`p`0JLN^NuNVH*nSm m mH|R` `.N\&JL N^NuNVH*n-fp`-g m p`Jf&-f>No+@fm`m-g0Hм+@f9g . Ne-g>`>/-?N]\;@ Jm n m fm0`m p`Sm +m mH|RJL N^NuNVH>Nv*@ fp`b-gB@`V-g3 3p`8-gB0../. / N]P``B0../. / N^PJL N^NuNVH *n(n ..-G`> ?/ /-/ N{=@Bn` L2n gRnB@0.neJng L2n f =nU >/ aPX=@B0.ѭB0.B0.Jo -g` -o+m .JL0N^NuNVH *n-M B2. Ё-@(M`  gRe JL0N^NuNVH *n(n ..> ?/ /-/ N{=@JnfU B0.ѭ -o+mB@0.JL0N^NuNVH>.*n |fp`.-g$Jg -cS0"mRm 0`pJL N^NuNVHNu>lp`&>Nv>/.?Nxx\<>Nu0JLN^NuNVH BWNt##By.5a*n`N`RJgHHм @fJg2 "g 'fFH>/ RNX(@ f./ aVX H> M2GBRG.Ra`BG`RG M2GJg5pHHм @gJ5pg M2GBRGH`BWNdBW/ RNg:XJ@g.R/<aX`l>Nd ->f@>/ TNg:X|f>B?<Ngl\|f.R/<a|X`$BW/ RNd*X|g.R/<aVX`>?/ NXJf>*/ NXJg-|.8?<NT>/ ?<Nxx\<f./ aX`^.H?/.aZ\.NzP>RWN{(@./ Nz.X.a>/ ?<Nxx\<f`.a`|g`JfBaSy.Nz|f./<a*XB/9?9N\>Nd\JL0N^NuNV|./Nz.X. /NyX./NyX.?< NT>Nd\N^NuNVH*n y XRyJL N^NuNVH*n. (nGVfJL8N^NuNVHNu>|fp`>Nv08*@JnfU.?/.Nz~XJ@f U0`R`.D/.Nz~XJ@fU0`2>/.?Nxx\J@g3#3p`U0JL N^NuNVBW?. /.a:\N^NuNVBW?. /.a"\N^NuNV>?. /.a\N^NuNVNdt>NN^NuNVHBG`0м.NdRG|mJLN^NuNVH*n0-|g*.Ne-g .NqB@H+@+@Bm m>NdJL N^NuNVH>.>Nv*@ f3 3p`NBF0|f>?<>N|4T<l|>Nv>NuJFf0``33pJL N^NuNVN^NuNVH*n0-| |f, -<o >/-?Nu\>Gg mp`J-gJg-g;| `;| `>0- D@H/?Ngl\Bm +mB@JL N^NuNVHNu>|fp`>Nv08*@Jn fUJnfU.?/.Nz~XJ@fU;n 0``.D/.Nz~XJ@fU0`d>/.?Nxx\J@g>Nu33p`0U>B-H?Ngl\BWB-H?Ngl\0JL N^NuNVBW?. /.a\N^NuNVBW?. /.a\N^NuNV>?. /.a\N^NuNVH>Nv*@ f3 3p`$>?-/. ?<BN|4P+@U -JL N^NuNV>B?.a\N^NuNVHK;| .+@+@;|:./. / Nh6P>.BgNmT0JL N^NuNVH*nBnJ gh``BE-n `RRE nJg n %fJEo.?/. Nm|\-n n n %@R DfBn n H|-@R Df n R Rn| <0fG n R =|<*f-M n=PT n R `8`*JnlBnH2. A|=@ n R <0m<9o|<.f BF n R <*f-M n<T n R `*`H2 A<| n R <0m<9oBn<lg<LfRn n R A-HH` RnJng <s` <t@#.?<?< // Ns Jngp`pH`RnJng <s` <t@#.Bg?< // Ns Jngp`pH`zRnJng <s` <t@#.Bg?<// Ns Jngp`pH`&RnJng <s` <t@#.Bg?<// Ns Jngp`pH`-M n-PX`-M n0|@B.T`H>?// Nl X|`~H>?// Nl X|`XH>?// Nm2 X|`4.H?NmTRn``|C|5b@0@ PN.NzP:ElJFm:0.E=@JnfX .0f* n -f SE. nH?NmTRRn`..H?NmTRn0.SnJ@n.?/.Nm|\n`..H?NmTRn0.SnJ@n`0.JL N^NuNVJnlp`0.=@ n -@>/. /.N|DPN^NuNVJnlp`0.=@ n -@>/. /.N~BPN^NuNV>/. /.a~P-@. NzP2.^AAo>/. /.aP-@ .N^NuNVH *n>. (n,g$Bl >/ ?Nu\Gg lp`*B@`&`.H?NmT|fp` 0SGJ@fB@JL0N^NuNVH. *n Sm mH"m|R``.H?Nn2TJL N^NuNVH. *n BF:-fp`$JfV-fN>No+@+@fm`2m>NoJ@gm@`;| H"mR`-gA+H +@ mR-gz>/-?Nu\<Bm `n-g>< g -мb" -:>/-?Nu\<+mBm `( -:>/-?Nu\<;| +mFg mp`H|JL N^NuNVH>Nv*@ fB@`-fB@`pJL N^NuNVH>Nv*@ fB@`0|JL N^NuNV>aJ@g <?`BN^NuNVH>.^GORG>a*@ fB` >/ aXJL N^NuNVH (y*T`ZB@0-BA2-@F@J@g>NsB`:B@0-ne `*f>a*@ f>NsB`(M*U`JL0N^NuNVH n*PB@0. X@me n `F(MB@0. HH@B@H@B@0-n 9@B@0,F@9@( n ;n B@0-F@;@# PJL0N^NuNVH >.|?GG0@>Nt*@fB`* R*@(M9GB@0,F@9@.Pa 9JL0N^NuNVH *nQB@0-BA2-@F@J@g>Nsp`(yeeecd(T`e2 BA2-IHABAHAЁ" BB4,JHBBBHB҂b #B@`n BA2-IHABAHAЁf T0(mB@0-F@;@ T*`* BA2,IHABAHAЁfB@0-lB@0,F@9@(`(#B@JL0N^NuNVH *n.a>. ^GORG>a-@fB`J n(PPg2d`Sn Jn f`B0. B0. `%Sn Jn f>/.aXJL0N^NuNVN^NuNVN^NuNVH /?.?./ /. nN*@ мfB(n `%H|0|9o^G мfB JL0N^NuNVH-|l*n<.H n. nfz` |SEJgJEf`h nf$z ` |SEJgJEfJEf-`*n<.JngJGlB@0D@> n P-"n R`B0H@B0>JGf JL N^NuNVH >.HμgR*y(G.Nz|f3 3p`>Bg/ N\ JL0N^NuNVH>Nv*@ fp`XJnfB@`N-g3 3p`0-g>/. / NvP``>/. / NwPJL N^NuNVH|BG` f 0`RG|m33pJLN^NuNVp2.`F@HB@N^NuNVHBG`>aRG|mJLN^NuNVH 0.8*@0.@BUB-+| BB> Bg/ N\> ?< / N\JL0N^NuNVH>.|e3 3B`0B@08*@-f3 3B` JL N^NuNVH *n(n >.B@=@=@``Rnnc L2n  fB@0.ncf>?.B@0.W B2.Ё//-/ N{=@B0.ѭJnf33p`^=n`8Rn>?</</-/ N{=@B0.ѭnb4 -o+mB@0.JL0N^NuNVH*n>?./. /-/ N{=@Jnf33p` B0.ѭ -o+mB@0.JL N^NuNVH*n 0.8м-@~.a&M`RJg :fJgc .Am .On*K`K0.`BW/ ?<o n1GBG`BW/ ?<NN|4\JgB@`0<>`d>ON|4JgB@`0<>`J.?<=N|4T>o n1GBG`,.?<AN|4T>``||b@0@ PN0JL8N^NuNV n am n zn n nHRJfN^NuNVH *n (n`RJff .JL0N^NuNVH *n (n`RR0.SnJ@ofRn`B0.SnJ@f .JL0N^NuNVH *n (nf .JL0N^NuNVH *n(M`RJf HJL0N^NuNVN^NuNVH *n(n `$H>a0H>a&op`lp` JfJfB@JL0N^NuNVH>.|am |zn|0JLN^NuNV.NVN^Nu _B0Z"yCCbNC NNVH..,. Jf#l <`Hc #lB`:fzB`(xe 〼b`BJge`#l JLN^NuJg .NuNV n=h.0n/0n/NIP/?.?<?N|4PN^NuNV n=h.0n/0n/NIP/?.?<@N|4PN^Nu#NA/9NuNVH-n Jnnp` nop`0.R@8BGB/.NPl n -R /.NZX-@B/.NPo.`/<D/.N:P-@SG/<A/.NPm`/<D/.NP-@RG/<D/.NPlG|0H/N"X-@`/<D/.NP-@RFDm/<B/.NP//.NP-@/<D/.NPm -|ARGJGl4 n 0R n .R JDlD|` n 0R SFGnBF`j/.NX:0|0"n R Gf n .R 0H/N"X-@//.NvP-@/<D/.N:P-@RFDm n BR .JLN^NuNVH-n Jnnp` nop`0.R@8BGB/.NPl n -R /.NZX-@B/.NPo.`/<D/.N:P-@SG/<A/.NPm`/<D/.NP-@RG/<D/.NPl|0H/N"X-@`/<D/.NP-@RFDm/<B/.NP//.NP-@/<D/.NPm -|ARGBF`j/.NX:0|0"n R JFf n .R 0H/N"X-@//.NvP-@/<D/.N:P-@RFDm n ER JGl0D@> n -R 0H |0"n R 0H H@|0"n R n BR .JLN^NuNVH KIBnBn`R n  g n  g n -gB@`p=@ n -g n +fR`$ n .fRn` nJngRnR nJg n eg n EfB n eg n EfDR n -gB@`p=@ n -g n +fR` nR nJfB.a-@.N\=@Jng 0.D@n`0.ܐn=@/.?.a:T/N:P-@.N-@Jng .JL0N^NuNVJnl,-|A`/<D/.NP-@RnJnm`*-|A`/<D/.N:P-@SnJnn .N^NuNV-|`D/<D/.N:P-@/. nH|H/N"X/NP-@R n 0m n 9o .N^NuNVHB/.NPfB`B/.NPl/.NZX-@z`BEBG`RG/<B/.NP-@/<A/.NPl`SG/<B/.N:P-@/<@/.NPm/<Y/.N:P-@/.NX-@ .-@|@0|HJEg .JLN^NuNVH..,. N LN^NuNVH..,. NLN^NuNVH..,. N LN^NuNVH..N, LN^NuNVHJl| .D-@`BFJfB`^~` .-@R .f` .-@S. g .-@޼@ JFg .JLN^NuNVH .м<JgJFlB`V .:|oJEg <` <`0..μ|`RFJFm`SFJFnJEg D. JLN^NuNVH..,. N LN^NuNVH..N LN^NuNVH..,. N LN^Nu<NuJg NugR kjklf`>k^g>k^g2k8<d,&B<ރeNuRid~S<Nu.NuJNu:ڼ.gNuJgj<a<Nu~N8H~<A,<A$NBN,NgN<CD<c~|*< Art`䤚ܐ(&䣞j.XRQ~NgR.$|<Ag,jDzG܆[<.0JL N^Nu Stack Overflow$C runtimeCON:LST:KERMIT.RSC[3][Resource File Format?][ABORT]%2d%02d190686r????????%ldj^d^dd d d~  dZ*xB)T-%#":(xx xD xh  xd#c #cxnKERMIT.OPTr%xw%x KERMIT.OPTKERMIT.OPTKERMIT.DEBwKERMIT.LOGw%c%2d%02x%d%xVdl%s%s%d%d%ld%02x%d%d%dABCDEFSZ%&%%"$%F$$% %JAENY&&&|&&,&AENY((('( (AENY**,* )X)*0AENY+++**+AENY,,,,L,|,Abortrr------------------AENSY/ /l./ .p/b/pABEFSZ34331/04ADEFZ67"465687&AbortK%02dwwAENY777778\\*.**.*%DEFOX[cdefosx[HW(Z8Z8W0W8XXW(Z8Z8W0XW8[H : unmatched quoteCannot open Cannot append Cannot create : No matchStack Overflow $   k8ikTkzkkkkkkkkj~kkkk&kj*kkjkkkkkkkkkkk8ikTkzkkkkkkkkjkkkk&kj.kkj y2y|xyyPy|y|x!!!!"CP/M-68K(tm), Version 1.2, Copyright (c) 1983, Digital Research XXXX-0000-6543216$ N          $2 * & f(  ($& d(  $J      (f>8V.22  *6 &  & .""$"    "   ""   *"   ,$  2                   "    @      D* (^*0$                                                                  &J $ ". ~  &N>NZPN0X(  $6" 0* $",H$""&2   * * 8L $ ,    t   zf  $                             \2$   ," x &$, F"p"b 64(j $JPP& \& D  ,D( 0 <    >  h 0HN&  jj`^***`&$ D"V8*R$ZF \@(B4.J".86 Jp $""@2&"fHR"(<@* <T0^06D,6 :"P :  *6P\H $ ,LH  LANCASTER UNIVERSITY UK Kermit Newsletter KERMIT DISTRIBUTION SERVICE Number 88 04 September 1986 ================================================================================ In this edition: Kermit on Atari 520ST Uuencoded Files and Trailing Blanks Atari Public Domain Assembler? Problems with Atari ST Kermit Kermit on native media Re: Problems Installing Atari ST Kermit Uuencoded Files and Trailing Blanks -------------------------------------------------------------------------------- From: Mitchell@UK.AC.BRUNEL Subject: Kermit on Atari 520ST. Alan, I have a what appears to be some version of the old VMS/UNIX C-Kermit on the Atari. It comes supplied on the Utility disk that is part of the Independant Software Vendors kit (Developement System), which also includes DR C, 68K assembler, etc. I don't know precisely what version it is, but it doesn't have a command loop and is used in much the same way as the skeleton version in the Protocol manual. I don't think there's anything proprietary about it, so I guess I could pass it on without too much hassle. There is a better version, though. It's built into PC/Intercomm along with other protocols. I guess it's available through dealers. I've had a play with it and it's a lot easier to use as it includes menus for protocol function, file functions, etc. It's not mouse/icon driven, but it's easy to use. It even includes a decent VT100/ANSI terminal emulator... Ralph ---------------- Date: Sun, 03 Aug 86 22:35:31 EST From: MOEWS%UCONNVM.BITNET@WISCVM.ARPA Subject:: Uuencoded Files and Trailing Blanks If you use KERMIT under VM/CMS, it is hard to use uuencoded files such as the uuencoded version of ST Kermit, since VM/CMS Kermit removes all trailing blanks when downloading files. Here is a solution to this problem; it is a version of UUDECODE that supplies trailing blanks as necessary, written to run on the Atari ST. It is written in 68000 assembly language, and can be assembled using the public domain assembler, AS68. David Moews MOEWS@UCONNVM.BITNET [Ed. The file is online at Lancaster as [.AST]ASTUUD.ASM] ---------------- Date: Friday, 22 August 1986 9:52:58 From: MJE2@CAM.PHX (Cambridge Phoenix - CAM.PHX@CAM.ENG-ICF) Subject: Atari Public Domain Assembler? Can you please tell me where I can obtain the public domain software assembler for 68000 as described for assembling a UUE decoder for astuue files? (see the above announcement) Many thanks, Martin Evans. MJE2@camphx [Ed. Does anyone know of a source of supply?] ---------------- Date: 22-August-1986 From: CROSE@UK.AC.Plym.B Subject: Problems with Atari ST Kermit I have an ATARI 1040 ST with an ATARI C development kit. The kit has a version of Kermit based on the old VMS/UNIX Kermit. This works but is not really suitable for the uninitiated ATARI user (ie 1st Year Students). I therefore set out to implement Bernhard Nebels GEM KERMIT 1.02 which you have on you file store. 1) Use VMS kermit to download the UUENCODED HEX files from LANC, get DECODE program in C to decode above file. Compile DECODE program and feed it the UUENCODED HEX files, results in KERMIT.PRG and KERMIT.RSC files now on disk. Execute KERMIT.PRG it doesn't work !!! ATARI turns up its toes and displays usual two bombs, then returns to desktop. 2) OK back to LANC file store, new message in 00BULL.TXT there is a new version of the DECODE program in assembler, to correct missing spaces problem. Right download it, and another copy of UUENCODED HEX file for good mesure. Assemble DECODE program OK, now run it and feed it UUENCODED HEX files, results in KERMIT.PRG etc etc.... execute Kermit ATARI experiences fatal error, usual two bombs displayed, program returns to desktop. 3) OK now I'm really mad, back to LANC filestore. Transfer whole of ATARI C source code (didn't really wan't to do it this way, but!). Write BATCH file to compile all C source modules, link modules, KERMIT.PRG now appears on the disk. Execute KERMIT.PRG ATARI treats us to a wonderfull display of random graphics and dither patterns, stand admireing random graphics for a while before remembering that we are supposed to be running KERMIT. Try to regain control of ATARI, to no avail, even reset leaves the machine with a duff hard disk driver, finally resort to powering down and re-booting. Repeat above three procedures on and off for about a week. finally give up in disgust!!!!! CAN ANYBODY HELP!! A COPY OF ATARI GEM KERMIT ON A 3.5 INCH DISK WOULD HELP A LOT If anyone can help please give me a call on (0752) 221312 ext 5437 or contact me at the above address. Chris Rose Micro-Support Plymouth Polytechnic. ---------------- Date: Monday, 1 September 1986 17:15:36 From: MJE2@CAM.PHX (Cambridge Phoenix - CAM.PHX@CAM.ENG-ICF) Subject: Kermit on native media You may like to know that I have now successfully implemented these various versions of kermit and would be able to supply others with copies of the discs if you get any requests from people near here. BBC BBC Torch CPN Atari ST ( both C kermit under TOS and the generic cp/m under the cpm emulator -- this latter is a bootstrap method which I would reccomend to anyone wanting to get things onto the ST. Torch Unicorn C Kermit under unix. Many thanks for your service. Martin Evans Department of Genetics, Downing St. CAMBRIDGE CB2 3EH. [Ed. Thanks, Martin. I'll update the 00WHO.TXT file] ------------------------------------------------------------------------ Date: 19 Sep 86 09:26:06 EDT (Fri) From: Michael Fischer Subject: Re: Problems Installing Atari ST Kermit Keywords: Atari ST Kermit I had problems installing GEM Kermit, too, but I finally got it to work. Here in a nutshell are what the problems were: 1. The UUDECODE program distributed with Kermit (astuud.c) is written for the Lattice C compiler. To use it with the Alcyon C compiler distributed with the Atari Developer's Kit, it is necessary to open the binary output file with "fopenb" instead of "fopen"; otherwise, the file is opened in text mode (ignoring the "b" mode flag") and every ^J in the output has a gratis ^M inserted after it. 2. Recompiling the sources as Chris Rose did is not sufficient, for the resource files are *only* distributed in binary form. A correct program given a bad resource will crash, just as an incorrect program will. Thus, one has no choice but to get UUDECODE to work. 3. Once I fixed UUDECODE, I successfully decoded both the Kermit program and resource files and they worked without problem. I also rebuilt the program from the sources and it also worked with the decoded resource file. 4. There has been a great deal of activity lately on the INFO-ATARI16 bboard discussing the various problems people have been having with UU-encoded files. There seem to have been two or three independent sets of problems: (a) Bugs in the UUDECODE program to run on the ST as described above. (b) Problems with the encoded file being modified during transmission such as tab expansion, truncation of trailing blanks, or padding of all lines to a given length. (c) For people who tried decoding on a mainframe and then transmitting the binary files to the ST (often using the old Developer's kit Kermit), forgetting to set binary mode on both the transmitting and receiving Kermit. After numerous reports of failures and then people bringing these problems out in the open, success stories such as mine above began pouring in. So UU-encoded files *are* usable, but it can be rather tricky to do it right. I will contact the "New Haven ST's" user group to see if they would be willing to copy GEM Kermit onto disks for people. Mike Fischer [Ed. - See next message for another hint.] ------------------------------ Date: Sat, 13 Sep 1986 12:40 MDT From: WANCHO@SIMTEL20.ARPA Subject: Uuencoded Files and Trailing Blanks Keywords: Uuencoded Files I made a small experimental change to our version of uuencode to solve the truncated trailing blank problem and it turns out to be transparent to uudecode. That change is simply to insert a "M" to each uuencoded line just prior to the insertion of the CRLF. BITNET users accessing our system through our mail file server have voiced no complaints since I made that minor change. --Frank .  t..  tKERMITV PRG t tKERMITV DOC t `QN%z BNPv`FCLEAR68K V02.00, Copyright(c) 1984, Digital Research XXXX-0000-654321 o#c\"h#c`E?/ N0N o AdpNu#c`BNuNV0/"/ NBc`d0< AQ"NB0<NBN^Nu o2/0/ HSoQBNu o0/JfBNuf SNuNVN+N nlaX n -PX UnByd dz#cBydB9e &eBydByc~ByeBye3 e@ByeFB9BydBydr3d|ByeBydvByd~3eJ` nPR |b.HHg. |b.HHg .H| `.HH@.H`~0.SnJ@g. N*X `a`rJ9f C`a`XRyd`N0.SnJ@g n PdX `a^Jydg9dH>/<U^N1X`J9f F`a$`J9f G`a `3e`3d~`0.SnJ@g. N*zX `a`ByeJ`0.SnJ@g" n #eLX .eLNO3eF`a`X0.SnJ@g n PH3dvX |b2ydvg, |b2ydvg 09dv| `09dv3dv09dv`Bydv` `a`|e|b@0@Q2 PN`aJydg>dv/<UsN1X`3c`J9f R`a`zJ9f S`a``Byd|`XJ9f V`av`@J9f X`a^`(3dr`aN`|b|b@0@Qn PN nJf J9fa 9VgB@`p3e.^/<UN1XJydrgJ.U/<UN0X#cfJydg .UN1BydrJydg .UN1Jydg>d/<UN1X9H`Jydg .UN1N+`Jydg .UN1a "J@f .V a` .Va`Jydg .V!N10.SnJ@g n #dX `aBeB# c3catJ@f .V0a&` .V=a`8Jydg .VCN1.VT?<aTJ@f .VVa` .Vea`Jydg .VkN10.SnJ@g n #dX `aD# c3caJ@f .Vya~` .Var`Jydg .VN1a J@f .VaH` .Va<`ZJydg .VN1.V?<a6TJ@f .Va` .Va``|C|b@0@Q PNJydrg .cN:\N+@N^NuNVScBycBydJyeg > N*`Jydg9cH>/<VN1X9cH`TapHc`\abHc`NaHc`@aHc`2aHc`$p`$B@` B@``H |R*rW hN`jN^NuNVJydg>d/<VN1X y d@RydDopA`.dal.d?< ?9c?<Sa\.d/U/Ya P`r9cH`|09cng 9cH`d.d?.aTByd09cR@H@H@3cpF`4.dapA`&9cH`pA``H |RjrW hNN^NuNVH y d@RydDopA`JeBf|Jydg.d/<W N1XJyd~f.W&/9dN0X#eB`.W(/9dN0X#eBJeBf.d/<W*aXpA`.d/NNXA-H -@`<\g<:f-n nHRJ@fJyeJgP-n`@HHмb @g(HHмb @g H|`H"nR nf .=@.d/<W>aX.?.?9c?<Far\.d/U/YaP`Snlp?`0.=@09cng 9cH`|09cng 9cH`dByd09cR@H@H@3c.da3dxpD`4.dapA`&9cH`pA``H |RrW hNJLN^NuNV y d@RydDopA`.d?9dx?9c?<Dar\.d/U/YaP`Snlp?`0.=@09cng 9cH`09cng 9cH`pByd09cR@H@H@3c.da3dx|fpZ`8pD`4.dapA`&9cH`pA``H |RrW hNN^NuNV y d@RydDopA`.BBg?9c?<Zat\.d/U/YaP`Snlp?`0.=@09cng 9cH`09cng 9cH`Byd09cR@H@H@3cJydg.d/<WIN1X.eBN:\BeBJydg .WdN1a (J@fpB`TJydg.d/<W~N1XpF`4.dajpA`&9cH`pA``H |RrW hNN^NuNV y d@RydDopA`BBg?9c?<Ba&\.d/U/YaP`~Snlp?`0.=@09cng 9cH`j09cng 9cH`TByd09cR@H@H@3cpC`4.dapA`&9cH`pA``H |S*rW hNN^NuNVJyeg Fc`RcBycByd`xJydg9cH>/<WN1X9cH`6aPHc`@a(Hc`2a0Hc`$p`"B@`B@``H |SZrW hN`N^NuNV y d@RydDopA`.d/Y/Ua(P`.d?.a T.da >.d?< ?9c?<Yad\3dByd09cR@H@H@3cpF`L.dapA`>BBg?9c?<Na\9cH` pA``J@gذ|Egİ|Sg`|Tg`N^NuNV y d@RydDopA`.d/U/YaDP` y @RyDopA`Jycfp?`09cS@nf6.da 6.d?< ?.?<Ya^\Byd9cH`v`pA`n y @RyDopA`TJycfp?`09cS@nf&BBg?.?<Ya \Byd9cH``pA`0.ycgpA`JyeFo:.eL/NNX.d 29eFHЁ/NNX`.d/NNXJyeJgrA#d`\ ydHHмb @g< ydHHмb @g ydH| ` ydH"ydRd ydJfJyd~f.W/N0X#eB`.W/N0X#eBJeBf./<Wa XpA``.d/<Wa XBBg?9c?<Ya t\3dByd09cR@H@H@3cpD`r0.ycgpA``BBg?9c?<Ya $\pC`H.da pA`:BBg?9c?<Na \9cH`pA``H |SrW hNN^NuNV y d@RydDopA`.d/U/Ya.P`0.ycgf y @RyDopA`Jycfp?`09cS@nf,.d?<?.?<Ya F\Byd9cH`N`pA`F>/<daXBBg?9c?<Ya \3dByd09cR@H@H@3cpD` y @RyDopA`Jycfp?`09cS@nf&BBg?.?<Ya \Byd9cH``pA`0.ycgpA`BBg?9c?<Ya V\.eBN:\09cR@H@H@3cpF`H.da pA`:BBg?9c?<Na \9cH`pA``H |SrW hNN^NuNVIcBycByd`Jydg9cH>/<WN1X9cH`>GaHc`aHc`aHc`aHc`vJydg .WN1aJ@fp`XJydg.d/<WN1XBycBydGc`"B@`"B@``|A|b@0@T PN`N^NuNVIcBycByd`|Jydg9cH>/<XN1X9cH`6>GaHc`>. ?.a:THc`(p`&B@`"B@``|Ag|Cg|Ggʰ|Ig``N^NuNVJydg>d/<XN1X y d@RydDopA`. ?.?9c?<Ga\.d/U/Ya fP`B9cH`N09cng 9cH`8pC`4.dapA`&9cH`pA``H |T&rW hNN^NuNVJydg>d/<X3N1X y d@RydDopA`.da.d?< ?9c?<Ia\.d/U/Ya P`p9cH`z09cng 9cH`b.d?.a2TByd09cR@H@H@3c. H`.. H`&9cH`pA``H |TVrW hNN^NuNV y d@RydDopA`.dNO=@.d?.?9c?<Ra6\Byc.d/Y/UaP`~.d?.afT.da.d?< ?9c?<Ya\3dByd09cR@H@H@3cpF`4.dapA`&9cH`pA``H |TrW hNN^NuNVJydvf . H`. 09dv`. H|`. H|`. . H|. HA|@=@0.|2.A|@=@0.|2.A|@=@. H|2.AA` . H``H |TrW h NN^NuNVa H@.H9c.HN^NuNV09cSycJ@nB@`4`2Jydg yc./<XIN1X yc#dXcpN^NuNV n~Jyef 9Rf n|/` n|* n|  n|@ n|- n|#Jycg n|Y` n|N n|1 n|~ n| N^NuNV n H|3dt n (H|3e@ y<e@n ye@l3 e@ n (H|3d n (Hr@@He n (H|HdzJ9dzf dz n cJ9cf#cByd nm`JycgX n e 9!em 9>eo 9`em 9~en 3d`Yeg&e3dBye n m n  9~f3eN^NuNV.XdN1.XlN1.XN1.XN1.YAN1.YN1.YN1.Z N1.ZQN1.ZSN1.Z^N1.ZN1.ZN1.ZN1.ZN1.[HN1.[N1.[N1.[N1.[N1.[N1.[N1.\9N1.\N1.\N1.\N1.\N1N+@>N:N^NuNV.]!N1>?.?.?.?. /.N1 .]*N1.`N;DN^NuNVJyegZ>?.?.?.?. /./N=.NO=@.?.?9c?<EaD\`">?.?.?.?. /.a0 N^NuNV./<],N1XN^NuNV\ ydodJg n2n B. H>/<]bN1X> /<]uN1X> /<]N1XJg./<]N1XAd-H`=|`9e H>N-Rn0.ydo/.`?<aT _>N-R`/.`?. W#aT _>N-R`0. |#H@/.`?. W aT _>N-R`0. | .A/.`. H?aPT _>N-R`. H.Bn`F/.`0n"n0H?aT _>N-R`0n"n0H.ARn0.n m.H|@.HA|?H@/.`.H?W aT _>N-R`/.`9dzH?aT _>N-R`Jydrgr.]/9cN2X .`"Ҽd=@Bn`< N2n(dH> N2n(dH?/<]/9cN2 Rn0.nmN^NuNV.dNOJ@gpT`Jyd|g >e@N+Jydrg.]/9cN2Xa|fBn`B9ca^@|g.H|"n2a>@|g.H|"n 2a@|gdnBn` n2n/a _|Rn n0nn n0PBa@|g.H|H@=|JngBJyd|gN+, ydohJg n0PB.H>/<]N1X n >/<]N1X n>/<]N1XJg./<]N1X9cH|@9cHA|?Hc9cH.gB@`.HN^NuNVN+vH@Jyd~f.JyeHgByeH>/<dNOXJydrg(.H>.H?/<]/9cN2 Jydvg.H|H@.HN^NuNVBn`Jyeg n g=|`6.eBa=@0.ng0yde"0Ryd` Rn n_mSn nl(`0yde"0RydSn nn`&0n~Rn0.| 2nRn n fjJyd~fb0ncRn0nMRn0ncRn0nJRn09dt|nl 0.``` noJydg0n&Rnn0.|H@ . m .f,0n#Rn0.r@@=@0.r@@H@`8 .#g .&fJydf .~fJyeg0n#RnJydvf0.2nRn`0nRn09dt|nl0.`".eBa=@|fJnfp`0.N^NuNVJydoSyd0yd"|e"00` ` .N2/<]N1X.H`.c?.aTT.da.d?< ?9c?<Ya\3dBydByc`.c?.aT.da^.d?< ?9c?<Ya\3dByd09cR@H@H@3caByc`B#cdBycaބByc`$.c?.a8T`<>N*BBg?.?<Ya\p`B9d.^/<ca@X`|Fg|Lg``dB9d.^G/<da X``.caRn0.HH@=@JnfBBg?9c?<Nar\Byc`ZBBg?9c?<NaV\Byc`>dB9d.^k/<daXByc`H |Tr W h,NJeBg.eBN:\BeB`N^NuNV nf n H`` no n H``B@N^NuNV.^N1a>N:N^NuNV.^N1a>N:N^NuNVJyd gSydJydf3eHByd N^NuNV>a JyeHgN^NuNVByd ByeH09d3d3d N^NuNVByd ByeHN^NuNVN.N^NuNVdByd ByeHN.v3dN^NuNVN-J@fJyeHgJyeHgB@``N-N^NuNVBn 9 dl*9dH|@H^.^/<_"N1X`d^.^/<_JN1XN-J@gNN-|H@Jyd~g( . l . g . g.@>^N-.H>N-N-J@gLN-H@Jng .cg2 .Cg(.H9df9dH>N-` .hg .HfJyegB@`p3e`j .ig .IfJyd~gB@`p3d~`D .?f<._jN1._~N1._N1._N1._N1Bn`j.H9df=|`T.H>N-Jyeg>Jyd~g( . l . g . g.@>^N-.H>N-`PN^Nu3cf`23cf`(3cf`J3cf`l3cf`b3cf`,UB?< NA/@> ?9cf?<NMX?@NA\0NuUB?< NA/@> ?9cf?<NMX?@NA\0NuB?< NA/@> / @??9cf?<NM\NA\NuB?< NA/@> @|Hy.?<?<NM#chPFNA\?<NMT40<"HAAAmR@Nu/9ch?<?<NMPNuN*/9chNuNVBBJlDRBJ lD RB0. -@0.2. An=@ .gDN^NuNVN^NuNV._N1N^NuNV._N1N^NuNV._N1N^NuNV._N1N^NuNVH*n(n BG`|lRG0&@`0+|f|mB` wg Wf>?</ N9\<`p ag Af>>?</ N;\<l>?</ N9\<`>B?N="\`$ rg Rf>Bg/ N;\<`B`@JFlB`8Bk 6B'@'@ rg Rf7|`7|Jnfk JL8N^NuNVBW/. /.aPN^NuNVBW/. /.aPN^NuNV>/. /.aPN^NuNVHNJBW/<Q'N/<Q'N/<Q'N /.N5XJL N^NuNV4.`/8NNX./8NNX.`"/8NNX.8?< NT>NN^NuNV. /./<`N=PN^NuNV./. /.N=PN^NuNVH*nSm m mH|R` `.N2tJL N^NuNVH*n-fp`-g m p`Jf&-f>ND+@fm`m-g0Hмcl+@`f9`g .`N;D-g>`>/-?N3j\;@ Jm n m fm0`m p`Sm +m mH|RJL N^NuNVH>NK*@ fp`b-gB@`V-g3 b3cdbp`8-gB0../. / N3P``B0../. / N5PJL N^NuNVH *n(n ..-G`> ?/ /-/ NP=@Bn` L2n gRnB@0.neJng L2n f =nU >/ aPX=@B0.ѭB0.B0.Jo -g` -o+m .JL0N^NuNVH *n-M B2. Ё-@(M`  gRe JL0N^NuNVH *n(n ..> ?/ /-/ NP=@JnfU B0.ѭ -o+mB@0.JL0N^NuNVH BWNI#c~#cByc|.Qa*n`N`RJgHHмb @fJg2 "g 'fFH>/ RNX(@ f.` M2GBRG.Ra`BG`RG M2GJg5pHHмb @gJ5pg M2GBRGH`BWN:BW/ RNN: ->f@>/ TNB?<N="\|f.R/<`[a|X`$BW/ RN9X|g.R/<`jaVX`>?/ NXJf>*/ NXJg-|k.8?<NT>/ ?<NMt\<f.`y/ aX`^.H?/.aZ\.NO>RWNO(@./ NNX.a>/ ?<NMt\<f`.a`|g`JfBaSyc|.cN|f.`/<`a*XB/9c~?9c|N\>N:JL0N^NuNV|./NNX. /NNX.`/NNX.?< NT>N:N^NuNVH*n yc XcRyc|JL N^NuNVH*n. (nGVfJL8N^NuNVHNJ>|fp`>NK08*@ePJnfU.Q'/.NO2XJ@f U0`R`.Q,/.NO2XJ@fU0`2>/.?NMt\J@g3#b3cdbp`U0JL N^NuNVBW?. /.a:\N^NuNVBW?. /.a"\N^NuNV>?. /.a\N^NuNVN:*>NN^NuNVHBG`0м`.N:\RG|mJLN^NuNVH*n0-|g*.N;D-g .NFB@H+@+@Bm m>N:JL N^NuNVH>.>NK*@ f3 b3cdbp`NBF0|f>?<>NPT<l|>NK>NJJFf0``3b3cdbpJL N^NuNVN^NuNVH*n0-| |f, -<o >/-?NJ\>Gg mp`J-gJg-g;| `;| `>0- D@H/?N="\Bm +mB@JL N^NuNVHNJ>|fp`>NK08*@ePJn fUJnfU.Q'/.NO2XJ@fU;n 0``.Q,/.NO2XJ@fU0`d>/.?NMt\J@g>NJ3b3cdbp`0U>B-H?N="\BWB-H?N="\0JL N^NuNVBW?. /.a\N^NuNVBW?. /.a\N^NuNV>?. /.a\N^NuNVH>NK*@ f3 b3cdbp`$>?-/. ?<BNPP+@U -JL N^NuNV>B?.a\N^NuNVHK;| .+@+@;|:./. / N=P>.BgNBT0JL N^NuNVH*nBnJ gh``BE-n `RRE nJg n %fJEo.?/. NBx\-n n n %@R DfBn n H|-@R Df n R Rn| <0fG n R =|<*f-M n=PT n R `8`*JnlBnH2. A|=@ n R <0m<9o|<.f BF n R <*f-M n<T n R `*`H2 A<| n R <0m<9oBn<lg<LfRn n R A-HH` RnJng <H` <I<#c.c?<?< // NH Jngp`pH`RnJng <H` <I<#c.cBg?< // NH Jngp`pH`zRnJng <H` <I<#c.cBg?<// NH Jngp`pH`&RnJng <H` <I<#c.cBg?<// NH Jngp`pH`-M n-PX`-M n0|@B.T`H>?// N/F X|`~H>?// N/Z X|`XH>?// N/n X|`4.H?NBTRn``|C|5b@0@ax PN.NO:ElJFm:0.E=@JnfX .0f* n -f SE. nH?NBTRRn`..H?NBTRn0.SnJ@n.?/.NBx\n`..H?NBTRn0.SnJ@n`0.JL N^NuNVH *n>. (n,g$Bl >/ ?NJ\Gg lp`*B@`&`.H?NBT|fp` 0SGJ@fB@JL0N^NuNVH. *n Sm mH"m|R``.H?NC.TJL N^NuNVH. *n BF:-fp`$JfV-fN>ND+@+@fm`2m>ND|J@gm@`;| H"mR`-gA+H +@ mR-gz>/-?NJ\<Bm `n-g>< g -мb" -:>/-?NJ\<+mBm `( -:>/-?NJ\<;| +mFg mp`H|JL N^NuNVH>NK*@ fB@`-fB@`pJL N^NuNVH>NK*@ fB@`0|JL N^NuNV>aJ@g <Q'`BN^NuNVH>.^GORG>a*@ fB` >/ aXJL N^NuNVH (ybX*T`ZB@0-BA2-@F@J@g>NH B`:B@0-ne `*bXf>a*@ f>NH B`(M*U`JL0N^NuNVH n*PB@0. X@me n `F(MB@0. HH@B@H@B@0-n 9@B@0,F@9@( n ;n B@0-F@;@#bX PJL0N^NuNVH >.|?GG0@>NI*@fB`* R*@(M9GB@0,F@9@.Pa 9bXJL0N^NuNVH *nQB@0-BA2-@F@J@g>NH p`(ybXeeecd(T`e2 BA2-IHABAHAЁ" BB4,JHBBBHB҂b #bXB@`n BA2-IHABAHAЁf T0(mB@0-F@;@ T*`* BA2,IHABAHAЁfB@0-lB@0,F@9@(`(#bXB@JL0N^NuNVH *n.a>. ^GORG>a-@fB`J n(PPg2d`Sn Jn f`B0. B0. `%Sn Jn f>/.aXJL0N^NuNVN^NuNVN^NuNVH /?.?./ /. nN*@ мfB(n `%H|0|9o^G мfB JL0N^NuNVH-|c*n<.H n. nfz` |SEJgJEf`h nf$z ` |SEJgJEfJEf-`*n<.JngJGlB@0D@> n P-"n R`B0H@B0>JGf JL N^NuNVH >.HμgR*yc`(Gc`.N|f3 b3cdbp`>Bg/ N\ JL0N^NuNVH>NK*@ fp`XJnfB@`N-g3 b3cdbp`0-g>/. / NKP``>/. / NLPJL N^NuNVH|BG` b\f b\0`RG|m3b3cdbpJLN^NuNVp2.`F@Hb\B@N^NuNVHBG`>aRG|mJLN^NuNVH 0.8*@eP0.@BUB-+| BB> Bg/ N\> ?< / N\JL0N^NuNVH>.|e3 b3cdbB`0B@08*@eP-f3 b3cdbB` JL N^NuNVH *n(n >.B@=@=@``Rnnc L2n  fB@0.ncf>?.B@0.W B2.Ё//-/ NP=@B0.ѭJnf3b3cdbp`^=n`8Rn>?</<b`/-/ NP=@B0.ѭnb4 -o+mB@0.JL0N^NuNVH*n>?./. /-/ NP=@Jnf3b3cdbp` B0.ѭ -o+mB@0.JL N^NuNVH*n 0.8мeP-@~.a&M`RJg :fJgc .Am .On*K`K0.`BW/ ?<o n1GBG`BW/ ?<NNP\JgB@`0<>`d>ONPJgB@`0<>`J.?<=NPT>o n1GBG`,.?<ANPT>``||b@0@bb PN0JL8N^NuNV n am n zn n nHRJfN^NuNVH *n (n`RJff .JL0N^NuNVH *n (nf .JL0N^NuNVH *n(M`RJf HJL0N^NuNVN^NuNVH *n(n `$H>a0H>a&op`lp` JfJfB@JL0N^NuNVH>.|am |zn|0JLN^Nu _B0Z"yc`CCbNC N o HXb"X6NVnh^^(j^^^^^^^^^^^^^ABCDFSZ "ENTY    &ENTY Z L Z  dENTY f X f  pENTY  ENTY(PACDFRB>0"FBEFSTZ$R$BDEFTZZ20444ENTY^hENTY0<ENST|EMOSemos\CEGIKNRSTX))d))(0)d)((~))d)Escape char is "%c" Parity is %c %s PACKET.LOGwCannot create PACKET.LOG Logging all packets to PACKET.LOG Debugging level = %d Connect command Receive command Receive failed.Done.Send command Send failed.Done.Finish command FFinish failed.Done.Get command Get failed.Done.Entering server mode. Server Mode Aborted.Done.Exit command LExit failed.Done.sendsw state: %c In sinit retries: %d Opening %s for sending. rrCannot open file %sSending %s Closing input file %s, looking for next file... New file is %s recsw state: %c wwCannot create %sReceiving %s getsw state: %c looking for next file... New file is %s exitsw state: %c In exit_server retries: %d In xinit retries: %d gnxtfl: filelist = "%s" Usage: kermit c [lbiphe line baud par escape-char] to connect kermit s [ddzinlbpt line baud par] file ... to send files kermit r [ddzinlbpto line baud par string] to receive files kermit g [ddzinlbpto line baud par string] file ...to get files kermit v [ddzinlbpto line baud par string] to enter server mode kermit f [ddz] to shut down remote server kermit x [ddz] to shut down remote server and logout remote Commands: c=connect, g=get, f=finish, r=receive, s=send, v=server, x=exit Modifiers: b=baud rate, d=debug, e=escape char, h=half duplex, i=image mode, l=tty line, n=no filename conversion, o=prepend string to output files, p=parity, t=suppress timeouts, z=log packet transactions. When sending, kermit will expand wildcards and handle drives. The line kermit s 0d:*.c sends all files with an extension of c in user 0 of disk d. Since this is a feature of the runtime, when using the get command, filenames containing wildcards must be in double quotes. Both the remote and local kermit must know an image file is being transferred in order for the file to be useable. Kermit: Kermit aborting with this error from remote host: %s spack type: %c num: %d len: %d data: "%s" Spack:%c:%03o| Rpack: rpack type: %c num: %d len: %d data: "%s" %c:%03o| Server - enterning command %c.: command not implemented by CPM Kermit server: not a valid Kermit server command: not a valid Kermit server command^cAtari ST Kermit version 3.0(4) 3/14/85Port selection not implemented in this KERMIT Baud rate selection not implemented in this KERMIT Type Control-%s to exit connect mode. Type %s to exit connect mode. c = exit to micro h = toggle local echo i = toggle image mode ? = this message typing the escape char again generates it _floating pointC RTL - program not linked for Program terminating $: unmatched quoteCannot open Cannot append Cannot create : No matchStack Overflow $   @?A A0ATAxAxAxAxAxAxAx@4AxAxAx@Ax?AxAx@AxAxAxAxAxAxAxAxAxAx@?A A0ATAxAxAxAxAxAxAx@8AxAxAx@Ax?AxAx@bPbP N.NxMNNLNxNxM!!!!"CP/M-68K(tm), Version 1.2, Copyright (c) 1983, Digital Research XXXX-0000-654321__exit__breakc`__start___cpmrvcd__basec\__sovf_brk___BDOS_blkfill_index_strchr___pnameQ___tnameQ'___lnameQ,___xeofQ1_main_usage_recsw_printms<_sendsw|_genswZ_getswR_server'_sinitF_sfile F_sdata _seof _sbreak _spar_spack2_rpack!_rpar_prerrpk_error_bufill$*_gnxtfl_rinith_rfileL_rdatab_bufemp&_xinit_gfile_generic_dopar_cinchr_inchr#_next_ch&l_getcmd*H_sccsid^_set_lin*z_dinit+@_set_bau*_timer_i*_sleep*_set_tim+_clear_t+,_init+N_sgetc+v_connect+_tim_ini.v_tim_din._sputc-_rx1-_auxstat-_cputc-_cgetc-_constat-lmul._nofloat/>___noflo___petoa/F__pftoa/Z__pgtoa/n__atof/__fopen/_fopen0_fopena0_fopenb0__main0__optoff1_printf1_fprintf2_fgetc2<__filbuf2t_read3j__rdasc3__cr_col4__rdbin5___main5__creat9_creat9_creata9_creatb9_exit:__cleanu:*_fclose:\_close:__iob`___fdecl;<_fflush;D__open;_open<_opena<_openb=_lseek="_tell=~_sprintf=__doprt=_fputnBx_fputcB__flsbufC._isattyD|_isdevD_ttynameD__afreebbP__aflistbX_mallocD_freeF_reallocG_malloc_H__errmalH ___prtinH___prtldH___prtshI<_sbrkI_writeJ__chvecb\__alloccJ__freecJ__chinitJ___chiniK__chkcK__wrtascK__wrtbinL___openMt_ucaseN_errnob__errcpmb_strcatN_strcpyN_strlenO___atabb____atabO*__strcmpO2__sallocO_setjmpO_longjmpO_uldivrc_uldivO_sw_Pv__pc_reaP__pc_wriP_trapP_statec_filecouc_filelisc_srvpktc_dpfpc_bin_quoc_nc_cchksumc_quotec_numtryd_num_ticd_ticks_sd_ch_sptrd_padd_tim_setd _rpsizd _escchrd_filnamd_packetd_pktdebdr_spsizdt_parflgdv_sizedx_eoldz_dotimoud|_imaged~_debugd_dobquod_recpktd_envd_lechoe_remotee_dorepte_bquotee_speede_padchare _ch_stace"_timinte@_fpeB_outleneF_tim_alaeH_filnamceJ_outstrieL__fdseP_oldtry_reptc_commandR N&H      (                      " <:*  $*  *  *        4                   :        , FP       (>"   "04:j @""   . " B"&x,*$:*P.      "(   D     * . * ,4*,h.2$   ,  4P& \& DN ,D( 0 <    >  h 0HN&  jj`^***`&$ D"P$ZF \@(B4.J".86 Jp $""@2&"fHR"DP<@* *$$ (4H`  Atari 520ST Kermit ================== Kermit is invoked on the Atari by running KERMITV.PRG with a double click of the mouse as usual. It should be installed as a TOS takes parameters type of execution. You then enter a Kermit subsystem. You will then be prompted for the Kermit commands. The command structure is as detailed below: connect: c [lbiphe line baud par esc] send: s [ddzinlbpt line baud par] file receive: r [ddzinlbpto line baud par string] file get: g [ddzinlbpto line baud par string] file server mode: v [ddzinlbpto line baud par string] finish: f [ddz] exit: x [ddz] where the parameters are: b=baud n=no filename converstion d=debug o=prepend string to output files e=escape character p=parity h=half duplex t=suppress timeouts i=image mode (binary) z=log session l=tty line NB Some of these parameters are not supported and will not work. These include baud (b) and tty line (l). The command character is followed immediately by the parameter code (no space!) then a space followed by the parameter values (separated by spaces), another space and then the filename if necessary. So to send a file to a host as binary, with even parity and logging the session you would need: kermit szip even filename and to connect to a host with odd parity, half-duplex and using 'A' as an escape character you would need to type: kermit cphe odd A This applies when running in the bottom level TOS. When running under GEM, the double click on the icon KERMITV.PRG is equivalent to the word kermit above. ------------------------------------------------------------------ Tony Klapcia Computer Unit University of Bath Claverton Down Bath BA2 7AY or electronically at: cc_ak @ bath.ux63 (00006011000550) Klapcia @ aucc (00006011000098) or via BT Gold at 74:IBL058 ----------------------------------------------------------------- Atari ST Kermit =============== This Atari ST Kermit distribution disk contains two versions of Kermit and is distributed by the Lancaster University Kermit distribution service. There are two versions of Kermit on this disk. Also, these Kermits may be used to extract new versions of Kermit from the Lancaster filestore as they become available. KERMIT.OLD This version was received from Tony Klapcia of the University of Bath. This old version of Kermit is contained in the directory KERMIT.OLD and is referred to in the mail file ASTKER.MAI in the directory KERMIT.NEW. It should be executed using TOS-Takes Parameters. It is a rather crude but very fast Kermit. It contains a VT100 terminal emulator and a Kermit server mode. The binary image mode may not work as I have not yet found the correct terminal settings for this mode. KERMIT.NEW This new version of Kermit is the current one from the Lancaster University KERMIT directory. It runs in normal GEM mode and is very pretty. However, the status box used during file transfer appears to slow the file transfer down to about 10% of the speed expected from the baud rate setting. Binary file transfer appears to work satisfactorily with this Kermit. The problems of UUD file conversions is covered by two files in this directory. There is a program ASTUUD.PRG which will convert correct format UUD files. Also the new ASTUUD.ASM assembler version of UUDECODE is in the directory. Included with this Kermit system was an IBM teletype emulator and this is included in the top directory as a desktop tool. The RS232 settings must be made using another desktop before Kermit is started. It appears that these settings have no effect unless one of the desktop terminal emulators is activated and exited before Kermit is used. Brian Robinson University of Lancaster 06.10.86 .  ) t..  ) tGEMTERM ACC+ t >README TXT/ t 0 TERM RSC3 t `N NK mNf]` m"m -So Q m -SBQ(m)MO*mNNR?<NH?<A?<NAX <B@SfLNuNVBn`0.RnA0 n m9|*Hl.HlHlN N^NuNVB?<NT=@0.`|g`9|9|'`F`|g`9|9|O`&`|g`9|9|O``HlHlHlHl?<BgN9l9l9l0<2,A9@HlHnHnHn?,?,?,?,?< BgNF?,?,?,?,?< N 9@ llHlBgN ^\9|0<`BgBgHl4?<?,N ?,?,?,?,?,N HlHlHlHl?<?,NBg?,N6X?,?,?,?,NP?,?,?,?,NP0,lW@9@BlBl0<`N^NuNVN HlHlHlHlN Hl>NXJ@fHlH?<N d\9|`NHlz?,NN \9@?NBX9@Lg0<`0<N^NuNV?.?<LNXN^NuNV/ A&H`0+ |g/ NBX A"Ҽm?.NT&_N^NuNV0.n l0.`0. N^NuNV0.n o0.`0. N^NuNV n0 nh? n 0 n h?NX=@ n0( nh? n 0( n h?NtX=@ n? n ?NzX=@ n?( n ?(N`X=@ n 0 n 1n0.n n 1@0.n n 1@0.n^Jg 0.n^J|N^NuNV/ &n/ NDXJ@g0<`00+ |g /+NXBk ?+ NTJ@g0<`0<&_N^NuNVH&n0+ |f0<`.0+ |gL0+ |f0<`l0+ |g?<B?+ N^P?/+?+ N@P @f0<`6k -K k o?<B?+ N P n!@&Bk0<LN^NuNV nl <`?.?./. ?<BN -@ m .`?<?.B?<BN` -@?<?.B?<BNF -@ nf .Ю -@ `$ nf .Ю -@ `0.g <`b . oHn . /?.?<@N Bg?./. ?<BN ]|9@Lg <` `BlL . N^NuNV/.?<IN\N^NuNVBn`&0.A0nf0.ABPRn nLmN^NuNV?>.=|0A"HPgXHf0(>N^Nu)I)J)_NN"l$l/,Nu)I)J)_NA"l$l/,NuNV .9@ .9@N^NuNV .9@ .9@N^Nu)I)JHl)_Hl" <sNB"l$lNuNV9n 9|Bl9|9nN0,N^NuNV)n)n .мZ)@ 9|dBl9| n 9PNt n 0A)HA)HA)H A)HN^NuNV9|eBlBl9nN,N^NuNV)n 9n 9|9|9|9nNA)HN^NuNV9n 9|zBl9|9nNN^NuNV9|{BlBl9nNN^NuNV9n 9n Bn nR2.RnA|0g`9|9|Sn0.9@9nNNN^NuNV)n 9| 9|Bl9|9nN A)HN^NuNV9n /.NX/.NX)n 9|m9|9|9nNA)HN^NuNV0. Sn J@g6 nH| f?< ?<N>X nRH??<N&X`N^NuNV0. Sn J@g nRH??<NX`N^NuNV0. Sn J@g nRH??<NX`N^NuNVH0&n $KA-H nf?./ N4\=n`H nf?./ N`\=n`* nf?./ Np\=n` -KBn?.NTJ@f ndH| f |o@ H-@/./.?.?<@N 9@LHg0<`0,Ln/./<?.?<@N 9@L @g0<`hRnR -@`R``` 6.ƼЃ$@ H-@/./.?.?<@Nf =@9@LHg0<`BlL0.L N^Nu9|9|9|9|9|9|9|9|C"2"2 2"2"2"22"2"2"22"2x9|Nu[1][EEEK! No more windows!|Try Closing Some][Sorry]GEM-TERMterm.rsc[0][ARRG!|Where's TERM.RSC?|I'm Melting...][GOSH] GEM-TERMCON:AUX:PRT: GEM TERM version .9 1987 by Paul Chinn. Gem-Term is free...give it out all over the free world. Gem Term is a handy little ACC that gives you a simple terminal program. While it doesn't have as many features as other terminal programs, Gem-Term has the distinguishing feature that it has its own window, and can be run right on the desktop, or from within any other GEM program. This means you can be running a word processor, doing file stuff or even playing a game and instantly have access to a terminal program at the same time. Useage: Gem-Term is extremely simple to use. Make sure that TERM.RSC is on the same disk as GEMTERM.ACC and boot up your system. To open Gem-Term, go to the DESK menu and select the Gem-Term option. A window will then open on the screen. In version .9 the window is 15 lines high and 80 or 40 colums wide(depending on the resolution you are in) The window can not be resized but can be moved around. When the Gem-Term window is the active window, it functions like any other terminal program: typing sends output to the modem and the modem will output to the screen. If the Gem-Term window is active, clicking on the Gem-Term accessory slot lets you change the following options: Baud Rate: toggle between 300 and 1200 baud Duplex: If you can't see what you're typing switch to Half Duplex. If everything you type is double, switch to Full Duplex. Line Feeds: If the lines of text over write each other turn linefeeds on, else leave them off. Click OK when satisfied. If the Gem-Term window was inactive, it will be brought to the top. Gem-Term is my first working program using GEM, and was written completely with standard GEM and VDI calls in Megamax C. Some proposed additions in the future are: -function key macros -multi tasking auto dialer -capture buffer -more control over RS232 settings -re-sizable window -Vidtex support -file transfer capabilities If you find Gem-Term useful or have any comments, drop me a line. I can be reached on Compuserve 76157,55 or Dark Knight BBS- 707-585-9126. To encourage future development, clear your conscience or otherwise make the world a better place to be, why not send some cash incentives to: Paul Chinn 4995 Fern Place Rohnert Park Ca. 94928 ||||$||FULLHALFDUPLEX3001200 BAUD ONOFFLine FeedsOKGEM-TERM1987 Paul Chinnv.9.5?FNY vz% A6:  | AG J   A  $)    ]f   Z.  G t ..  G tQT DOCI t -QT TOSN t cSAMPLE CFGU t /QT(1) QT(1) USAGE qt [no][conn|image] [verbose|terse] [cfg=s] [timeout=n] [dial=c] [prefix=s] [suffix=s] [escape=c] ABSTRACT Qt is a modem program for the Atari ST series of microcomputers. It can transfer files via xmodem or kermit, it has a builtin phonebook with autodial capacity, it allows definition of keyboard macros, and it allows reading and writing of configuration files. DESCRIPTION Qt is moded; that is, you are either talking to the modem or talking to Qt. Qt takes single-character commands ('.' prefixes some extended commands) to do a variety of things; COMMAND WHAT IT DOES. b= Show the current baudrate. (Qt supports 300,1200, and 2400 baud.) b1 Set the modem to 1200 baud. b2 Set the modem to 2400 baud. b3 Set the modem to 300 baud. b? Print a help message for the b commands. c Connects to the modem. You get back into command mode by typing the modem escape key (the default escape key is the undo key, but you may change it -- see .s for details.) d List a disk directory. When you type 'd', Qt finishes the word 'dir' and waits for you to type in the directory name. If you just type a return, Qt lists the working directory. Each listing show the permissions on the file, how many Kbytes the file takes up, and the filename. The permissions are set up in a list 'dwsh', with a dash meaning that that permission is denied. PERMISSION WHAT IT MEANS. d File is a directory or volume label. w File is writable. s File is a system file. h File is a hidden file. h Hang up the phone. When you type h, Qt echos (thud) and drops carrier for a second. If this doesn't hang up the phone, repeating it two or three times should do the trick. QT(1) QT(1) m Show current macros and their values. Macros are used only in connect mode. When you type a key that you mapped to something else, the string you mapped it to is sent to the host computer. (See the explanation of .m for more info) o Show current settings of user-settable variables (See the explanation of .s for more info) If you are connected to a host computer, Qt will tell you here. p= List the phonebook. Qt maintains a phonebook of up to 26 numbers, which you can call by typing 'px', where x is a lowercase letter. The listing of the phonebook is formatted => :. Letter is the letter you type to call that number, is the string that is sent to the modem (any ascii character except a colon), and is anything that comes after the first colon on the line. (See the description of .p for how to add numbers to the phonebook.) pa-z Call phone # a-z. When you dial a number, Qt will automatically add a prefix and suffix to the number it sends to the modem. (So, if you are using a Hayes(tm) modem, Qt sends ATD to it.) If you want to abort a phone call (before the connection has been established), just press any key -- the phonecall will be cancelled and you will return to the 'qt>' prompt. If you have a comment for this phone number, Qt will display 'calling ' while dialing. p; Call a number not in the phonebook. When you type this, Qt will prompt you for the phone number, which it will then dial just like a stored phone number. p! Redial the last number. p? Display a help message for the p command. q Quit. Qt completes the word 'quit' and returns you to the calling program (the Desktop.) QT(1) QT(1) xr Get a file using the Xmodem protocol. Qt will prompt you for the name of the file, then for a start character to send to the modem. (so, for example, if you are getting a file from a Citadel BBS, you escape to command mode when it asks you whether you are ready to accept the file -- after doing the xr and entering a filename, using 'y' for the start char will start up the transfer.) On systems that do not wait for a start character, the spacebar is a harmless character to type. Qt defaults to image (8 bit ascii) transfers, but you may specify a 7 bit ascii transfer by entering 'xtr'. (You may force binary transfer by typing 'xbr' as well.) xs Send a file using the Xmodem protocol. The details of xs are exactly the same as xr, except you are sending the file. x? Print a help message for xmodem commands. ! Do a system command or a shell escape. When you type '!', Qt will wait for you to enter a line to execute (Just return will call up an inter- active shell.) To use !, you must have the program command.prg in the root directory on the current drive or have a shell name specified by the environment variable SHELL. .b Print out a version/author banner. .m Define a macro. When you enter '.m', Qt will prompt '.map: ' and wait for you to enter a C/R terminated string. If this string is of the form 'x=yyy', Qt will assign the macro 'yyy' to the key 'x'. (If the string is not of that form, Qt will give you a nasty message.) You may enter special characters (except ^C -- if you enter ^C, Qt will crash!) via '\N', where N is 1 or more hexadecimal digits. (So the string \04=spam\0d assigns the macro spam to ^D.) Also, \n maps to ^J, \r maps to , and \t maps to . .p Add or delete a phone number from the phonebook. When you enter '.p', Qt will prompt '.phone:' and waits for you to enter a C/R terminated string. To delete a phone # from the phonebook, enter a string of the form '-x', where 'x' is the menu selection for the phone number you want to zap. Any other string is added to the phonebook. (See the description of 'p' for the form of a legal phone number.) QT(1) QT(1) .r Read in a new configuration. When you enter '.r', Qt prompts '.read cfg? ' and waits for you to enter a C/R terminated filename. If Qt can read this filename, it will add the configuration information in that file to your current configuration. (See the section on initialization for the format of a configuration file.) .s Set a Qt option. When you enter '.s', Qt prompts '.set: ' and waits for you to enter a C/R terminated string. This string may be of the form 'opt=val', 'opt', or 'noopt'. 'opt=val' sets the option to 'str', 'opt' sets the option to TRUE, and 'noopt' sets the option to FALSE. Option What it does [no]image Set the default mode for file transfers. If you specify 'noimage', files will be transferred with the high-bit stripped. if you specify 'image', file transfers are 8-bit. The default is 'image' verbose Qt will print more and longer messages. (This is the default) terse Qt will remain as silent as it can. timeout=NN Set the file transfer timeout in seconds. If you are transferring a file and the host computer doesn't reply in that time, Qt will attempt to restart the transfer (or abort if repeated tries fail.) The default is 'timeout=30' prefix=str Prefix phone numbers with this string when you dial a number. (Qt uses 'ATD' for its default prefix string.) suffix=str Append this string to phone numbers when you dial a number. (Qt uses a single C/R for its default suffix string.) escape=char The key you type to return to command mode from connect mode. (Qt uses for its default escape character.) QT(1) QT(1) The options below are only used when you first invoke Qt. You may put them into your qt.rc file or specify them on the command line. [no]conn If you specify 'conn', Qt will drop into connect mode when you invoke it. If you specify 'noconn'(the default), Qt will drop into command mode when you invoke it. cfg=name Instead of reading configuration data from the file 'qt.rc', Qt will read the file 'name.' See the section on initialization for more detail on how a configuration file is set up. dial=x Dial phone number 'x' when Qt finishes initialization. .w Write the current configuration to a file. When you enter '.w', Qt will prompt '.write cfg?' and wait for you to enter a C/R terminated filename. Qt then writes out the configuration. .? Print out a help message for the '.' commands. INITIALIZATION When you enter Qt, it attempts to set up your configuration from the arguments you give it on the command line and the contents of your qt.rc file, if any. The arguments on the command line follow the format of the .s command (opt=val, opt, noopt...) and are described under the description of the .s command. After dealing with the arguments on the command line, Qt will read more configuration from the file 'qt.rc' (or the filename you gave it in cfg=name on the command line.) A Qt configuration file is a ordinary textfile with different commands on each line. Each command is of the format (cmd) (argument): command what it does set Set a Qt option. The argument for this command is of the form opt=val, opt, or noopt (the options are described under the .s command.) map Define a macro. The argument for this command is of the form 'x=yyy' (just like the .m command -- look there for details.) dial Set up a phone number. The argument for this command is the same as the argument for the .p command. QT(1) QT(1) In addition, lines beginning with '#', and blank lines are ignored. Here is a sample Qt configuration file: # this is a comment line set noimage set dial=a map \01=password\r map \04=other password\r dial 123-4567:BBS #1 dial 123-7654:BBS #2 This file configures Qt for ascii text transfers (7-bit), maps ^A to 'password', ^D to 'other password', puts the phone number for BBS #1 and BBS #2 into your phonebook, then dials BBS #1. MISCELLANEOUS There are 2 main prompts for Qt. If you are not connected to a host computer, Qt will prompt for commands with 'Qt>'. If you are connected to a host, Qt prompts with '*Qt>'. (All Qt commands are available with either prompt.) BUGS The documentation is a wee bit verbose, but it 'probably' doesn't tell the novice everything s/he wants to know. AUTHOR Orc (David Parsons) `M,(*O*m#_ - ЭЭм "ҍ¼.A// Bg?<JNA y_"h#_ E?/ N4BN"/0<NBNu o AdpNu#_ BNuNV0/"/ NB_ d0< AO8"NB0<NBN^Nu o2/0/ HoSQBNu o0/JfBNuf SNuNV?<?<NMXN^NuNVH>.| l??<`??<?<NM\JLN^NuNV?<?<NMXN^NuNVH>.??<?<NM\JLN^NuNV?<?<NMXN^NuNV?<?<NMXN^NuNV9H3_N^NuNVHy?<&NN\09_|N^NuNVa-@=@Jnf .r⠀||`B@0.N^NuNV`a*arJ@fN^NuNV`$ nH>aRaNJ@g a>a nJfN^NuNVH*nBn`|fc.QaSnS`ľ|ff`.QalSnSc-H>/<P|NXJg`.Qa:SnSc-H>/<P|NXJf`V|f`.QaSnSb`60.n l$RnǾ| e|~b>a`>@a`>aa>| fB.QaJL N^NuNVHaJ g(Jg". a.aJyP`g .QaJyP`g .Qa.Oa\.aT.PaJaJ@g a>JGgJGg&aNJyP`g.Qa.Qa:/<_NX#O\JO\g yO\Jg yO\BRO\`BO\.O\/<Q/<_aP=@.Qa(0.``>a.QaX.QaB@N^NuNVH*n` H>aJfJL N^NuNV>?<?<N0X>E?<?<N0XN^NuNVH *n(|_`  m ~n`n\H|=@`Hn`Vr`Pt`JB@0.HH@B@H@мPd @B@0.|H@B@H@мPd @``| g| g| g`RJf|B <_JL0N^NuNV n m n~o0.`-|Q`-|R`-|R`0.|vP-|P`-|R`x-|R `l-|R`b-|R`X-|R `N0.@HмPd @P0.|HмPd @P-|P`H |PrW hDN.a.NK` ` >apN^NuNVBn n cB0. >a=@B0. H@>W0a0.R@N^NuNVBn` nH>anR nJf0.N^NuNVH. <am<zn H|`HJLN^NuNV` nH=@R n\f nJg nH=@>/<PdNXRJgxBn naenW` nAen7`n0B@0.HBA2.|A=@ nJg$ nH=@>/<PdNXRJf=n`4B@0.`=| `$=| `=| ``|ng|rgڰ|tgB@0."n R nJf n BN^NuNV-n>=/.NX-@Jg nBR`-|R&./.aX.NK|g .a$.R(a.RQNBB/B@0.HH@B@H@м_ @ B@0.HH@B@H@ @"|_Jg(.B@0.HH@B@H@ @"|_/0NKbX`.R?aV.RNa`XB@0.HH@B@H@ @"|_Jg'aL>Waa@.RQaz.Raa(`,0n"|c.NC0nc `=|a`Rn nzn0n"|cJf nzn\>QNBB/0nc g$.0n"|c/0NKbX`.Rda.Rsah`.Rva.RaRN^NuNVH.NK<g@BG`*>/.0G"|Q/0NJPJ@f0R@`RG0G"|QJfB@JLN^NuNV>=/.NX-@gP nBR.ar`" nH|3P^ByP\`./<ObNKbX`.N1=@ n m n /NX-@g nBR`-|S./<SNJXJ@f .a`r./<SNJXJ@f .a`L./<SNJXJ@f .a<`(.Tab.aV>'a .Ta.?<Q/N2P\J@f.NO`?Pba.TKa` .TYa.TfaJyP\fJyP^m>P^aJ@gNjN^NuNV. ?.aTN"JyP`g .Tia.TnaBN^NuNV>!N>/|NZXA|-H`R nJg n  oA-H` n"nRR n  n мf0.UZN1-@g.`.U`/NKbX` nB`R nJg n  oS nJg/./.RNKX _` R nB(B/./N.P-@Jl* f.Um`.U}NR.UN N^NuNVdBnBn.UNR>O/NZXJ.f.U/NKbX`f.NKHЎ @ (:f.U/NJlX`2.NKHЎ @ (\f.U/NJlX .:f.H| |=@.x?<N0T>/?<NN0\JgZ>?/NXJf>*/NXJg.UNR` .UNR.UN `(.H|g>d`>-N.g>-`>wN.g>s`>-N.g>h`>-N> N.H|g.UNR`8/</.NM>P>RWN=@`> NRn nm.NR=@ nf.UN `` > N n@RnDm0.R@HH@=@>ON0JgJng .UN >/h?<6N0\/</.t/.p/.hNLP/NLP/NM>P-@Jng>W`N.UNR .>N.UNR g >sN>.N.UN N^NuNVBn.UN N=@>NB@0.`$.UNR3 O`Rn`.UNR3O`Rn`.UNR3O`Rn`09O``,.UNR`0.UNR`".VNR``|g|gְ| g`.VN .V NR.VN .VNR.V2N .V5NR.VGN .VJNR`8>NJyP`g .VeNR``H |TrrW hN.V~N Jng*>O`? NT>?<N0TJng.<`SJn`.<`SJo NJ@g>?<N0TJLN^NuNVH`zNxJ@gRN>yPbg`B@0HH@B@H@ @"|_Jg B@0HH@B@H@ @"|_.N$`>NTNJ@gN@>WN`JLN^NuNV>pNN=@>N nae nzb>N,`` n=f> N.VN =|a`jB@0.|HH@B@H@ @"|cJgF>N.VN B@0.|HH@B@H@ @"|c.NR.VN Rn nzc`L n;fV.VNR>O/<_NZXB#O\.B/<_NtP=@.VN B@0.`` n!fDJ9_f.VNR.VN `.O\/<V/<_NtP`` n?fn.VN .VNR.VN .VNR.VN .VNR.WN .WNR.W3N `*JyP`g .W6NR> N.WON B@N^NuNV.WRN NJ@f$.WUNR.WiN .WlN .WoNR>PbN.WzN JyPXg.W}`.WNR.WNR.WN JyP`g.W`.WNR.WN .WNR>PZN.WN .WNR.ONR.WN .WNR.PNR.WN N^NuNV.WN Bn`R0n"|_Jg:>N.WN 0n"|_.NR.WN Rn nmN^NuNV>.NN=@>N`>N.WN .WNR.X N .X NR.XNR.X/N `Z.X2NR>O/NZXJ.g.N`".X8NR>O/NZXJ.g.N f`.XGNR>O/NZXJ.g.N `.XMNR>O/NZXJ.g8.NJ@f&.XXNR.NR.XgN `P.XjNR>O/NZXJ.g8.NRJ@f&.XvNR.NR.XN `>N.XN .XNR.XN .XNR.XN .XNR.XN .XNR.YN .YNR.Y(N .Y+NR.YNN `D>NJyP`g .YQNR.YjN ``H |TrW h NN^NuNV=|Jng NJ@g.Ym`.YqNR`=|N>N=@`aX`JyP`g .YvNR.YN aN`a`.YNRa.YN `a`a`aJ@ga`z`vN-`laT`daL`\N0.YNR.YN .YNR.YN .YNR.YN .YNR.YN .YNR.ZN .ZNR.ZN .ZNR.Z-N .Z0NR.Z:N .Z=NR.ZWN .ZZNR.ZqN .ZtNR.ZN `J>NJyP`g.ZNR.ZN `Bn``H |Tr W h0N nQfN^NuNV>N`D.ZNR3_p`<.ZNRBy_p`&JyPXgB@`p3_`|Bgΰ|Tg`B@N^NuNV>,N0-@`NJ@gN@`>,N02.HҮmpN^NuNVB@=@=@B@=@=@=@BnBnN.ZNR>NTB.> ar=@ ng ng nf ngB@`p=@ nf>a2=@>a&=@0.n|g =|.Z/NKbX`0.R@HH@nfazng =|.Z/NKbX`Bn0.HH@=@Jnf<>NT./<?9_j?<@N0PmB@`p=@> N.ZNR>N.ZNR>N.[NR>N.[ NR`J0.ng(=|.[ /NKbX>NE`>aj|f>NTJngJ.g.NR.[N RnJngRn>a|f> N.[NR>N.[(NR>N.[/NR>N.[7NR>NT ng n lJng nf n m.[;NR.[DN B@`8`6Jng.[GNR` >NT.[VN JngB@`pN^NuNV.[YNR>P/NZXJ.g.?<AN0TBW/?<.N.[vN `J.[yNRN=@>N.[N >NTa>_j?<>N0TN^NuNVBn`> N.[NR>_hN.[NR>N.[NR>NT>_hNT09_hF@>NTBnBn`00n"n0H|n0n"n0H>NTRn nm>NT>>PZa=@ nfp`f ng ngRn0.| mB@`B``>Jy_lgB@`2Bn`">NT>PZa|fp`Rn n mB@N^NuNV".[NR>P/&NZXJ.&gBW/&?<=N0\3_jl@.[N .[NR.&NR>.N.[N `T.[NRN@>N.H>NT.[N BnBWaJ@g`jBn`Z N2n"N4nixxJy_g N2n(x0.R@HH@=@Jnf.xaJ@gRn0.nm.x/<?9_j?<?N0P=@npJno,` N2n|xRn nm.xaJ@g&>aJ@f .[NR` .[NR.[N >_j?<>N0TN^NuNV.[NRN=@>N>a*J@gN=@>N>N`a8`a`.[N .[NR.\N .\ NR.\8N .\;NR.\cN .\fNR.\N `N.\N JyP`g .\NR.\N ` |g|?gX|Rg@|Sg@`N^NuNV>./.NX=@>\/.NXJf>:/.NXJfB@`p=@./NKbXJngB`.\/a XJ@g&./. /Bg?<KN0 `JgJnf>;/.NX-@g: .>/./NKP N"nB( .R-@`./NKbXB./NJlXJngB`.\/a8XJ@g$./. /Bg?<KN0 ` Jf:pN^NuNVH*n(n BWBg/ ?<CN0PJmp`B g<.NKH&@ `&./ NKbXBWBg/ ?<CN0PJmp`JfB@JL8N^Nu#_nNN/9_nNu#_nNM/9_nNu#_nNA/9_nNuNV y_ P-h,.NK=@`x>/./.NJPJ@f$ n2n =g n2nJf .`F.NKR@HѮ n (=f n g.NKR@HѮ n fBN^NuNV.aL-@g:.NKHЮ @ (=f.NKHЮR`` <\``BN^NuNVH*nBGBF`RHHм^6 @f +fR` -fRRF` H@| 0m 9oJFg0D@>0JL N^NuNVH*n>. (n&M`Ƽ| gSGo.N4<|fB|fB` JL8N^NuNVH*n(n BG`|lRG0&@] 0+|f|mB` wg Wf>?</ N;\<`p ag Af>>?</ N>|\<l>?</ N;\<`>B?N?\`$ rg Rf>Bg/ N>|\<`B`@JFlB`8Bk 6B'@'@ rg Rf7|`7|Jnfk JL8N^NuNVBW/. /.aPN^NuNVBW/. /.aPN^NuNV>/. /.aPN^NuNVH *n(n BG`.H?N@2T>|fp`Jf0JL0N^NuNVHNFBW/<OQN?vX>/<OQN?vX>/<OQN?vX n2n B*n`&HHм^6 @g H| `HRJf> /.N8 XJL N^NuNVH*nSm m mH|R` `.N5JL N^NuNVH*n-fp`-g m p`Jf&-f>NBB+@fm`m-g0Hм_r+@] f9]1g .].N=-g>`>/-?N6\;@ Jm n m fm0`m p`Sm +m mH|RJL N^NuNVH>NG<*@ fp`b-gB@`V-g3 ^23_^4p`8-gB0../. / N6P``B0../. / N7PJL N^NuNVH *n(n ..-G`> ?/ /-/ NLb=@Bn` L2n gRnB@0.neJng L2n f =nU >/ aPX=@B0.ѭB0.B0.Jo -g` -o+m .JL0N^NuNVH *n-M B2. Ё-@(M`  gRe JL0N^NuNVH *n(n ..> ?/ /-/ NLb=@JnfU B0.ѭ -o+mB@0.JL0N^NuNVH BWNE^#_#_By_.OGa*n`N`RJgHHм^6 @fJg2 "g 'fFH>/ RNX(@ f.\/ aVX H> M2GBRG.Ra`BG`RG M2GJg5pHHм^6 @gJ5pg M2GBRGH`BWN=RBW/ RN?XJ@g.R/<\aX`l>N=R ->f@>/ TN?X|f>B?<N?\|f.R/<\a|X`$BW/ RN<~X|g.R/<\aVX`>?/ NXJf>*/ NXJg-|j.8?<NT>/ ?<NI(\<f.]/ aX`^.H?/.aZ\.NK>RWNL$(@./ NKbX.a>/ ?<NI(\<f`.a`|g`JfBaSy_._Nz|f.]/<] a*XB/9_?9_N\>NN|fp`>NF08*@dPJnfU.OQ/.NKXJ@f U0`R`.OV/.NKXJ@fU0`2>/.?NI(\J@g3#^23_^4p`U0JL N^NuNVBW?. /.a:\N^NuNVBW?. /.a"\N^NuNV>?. /.a\N^NuNVN<>NN^NuNVHBG`0м] .NN=RJL N^NuNVH>.>NG<*@ f3 ^23_^4p`NBF0|f>?<>NLT<l|>NF>NFJFf0``3^23_^4pJL N^NuNVN^NuNVH*n0-| |f, -<o >/-?NE\>Gg mp`J-gJg-g;| `;| `>0- D@H/?N?\Bm +mB@JL N^NuNVHNFF>|fp`>NF08*@dPJn fUJnfU.OQ/.NKXJ@fU;n 0``.OV/.NKXJ@fU0`d>/.?NI(\J@g>NF3^23_^4p`0U>B-H?N?\BWB-H?N?\0JL N^NuNVBW?. /.a\N^NuNVBW?. /.a\N^NuNV>?. /.a\N^NuNVH>NG<*@ f3 ^23_^4p`$>?-/. ?<BNLP+@U -JL N^NuNV>B?.a\N^NuNVH. *n Sm mH"m|R``.H?N@xTJL N^NuNVH. *n BF:-fp`$JfV-fN>NBB+@+@fm`2m>NAJ@gm@`;| H"mR`-gA+H +@ mR-gz>/-?NE\<Bm `n-g>< g -мb" -:>/-?NE\<+mBm `( -:>/-?NE\<;| +mFg mp`H|JL N^NuNVH>NG<*@ fB@`-fB@`pJL N^NuNVH>NG<*@ fB@`0|JL N^NuNV>aJ@g <OQ`BN^NuNVH>.^GORG>a*@ fB` >/ aXJL N^NuNVH (y^*T`ZB@0-BA2-@F@J@g>NEVB`:B@0-ne `*^f>a*@ f>NEVB`(M*U`JL0N^NuNVH n*PB@0. X@me n `F(MB@0. HH@B@H@B@0-n 9@B@0,F@9@( n ;n B@0-F@;@#^ PJL0N^NuNVH >.|?GG0@>NE^*@fB`* R*@(M9GB@0,F@9@.Pa 9^JL0N^NuNVH *nQB@0-BA2-@F@J@g>NEVp`(y^eeecd(T`e2 BA2-IHABAHAЁ" BB4,JHBBBHB҂b #^B@`n BA2-IHABAHAЁf T0(mB@0-F@;@ T*`* BA2,IHABAHAЁfB@0-lB@0,F@9@(`(#^B@JL0N^NuNVH *n.a>. ^GORG>a-@fB`J n(PPg2d`Sn Jn f`B0. B0. `%Sn Jn f>/.aXJL0N^NuNVN^NuNVN^NuNVH >.HμgR*y_ (G_ .Nz|f3 ^23_^4p`>Bg/ N\ JL0N^NuNVH>NG<*@ fp`XJnfB@`N-g3 ^23_^4p`0-g>/. / NGP``>/. / NHPJL N^NuNVH|BG` ^ f ^ 0`RG|m3^23_^4pJLN^NuNVp2.`F@H^ B@N^NuNVHBG`>aRG|mJLN^NuNVH 0.8*@dP0.@BUB-+| BB> Bg/ N\> ?< / N\JL0N^NuNVH>.|e3 ^23_^4B`0B@08*@dP-f3 ^23_^4B` JL N^NuNVH *n(n >.B@=@=@``Rnnc L2n  fB@0.ncf>?.B@0.W B2.Ё//-/ NL=@B0.ѭJnf3^23_^4p`^=n`8Rn>?</<^/-/ NL=@B0.ѭnb4 -o+mB@0.JL0N^NuNVH*n>?./. /-/ NL=@Jnf3^23_^4p` B0.ѭ -o+mB@0.JL N^NuNVH*n 0.8мdP-@~.a&M`RJg :fJgc .Am .On*K`K0.`BW/ ?<o n1GBG`BW/ ?<NNL\JgB@`0<>`d>ONLJgB@`0<>`J.?<=NLT>o n1GBG`,.?<ANLT>``||b@0@^ PN0JL8N^NuNV n am n zn n nHRJfN^NuNVH *n (n`RJff .JL0N^NuNVH *n(n `op`lp`JgJfHHAJL0N^NuNVH *n(n >.` JfB@`RRSGoHgHHAJL0N^NuNVH *n (n`RR0.SnJ@ofRn`B0.SnJ@f .JL0N^NuNVH *n (nf .JL0N^NuNVH *n(M`RJf HJL0N^NuNVN^NuNVH *n(n `$H>a0H>a&op`lp` JfJfB@JL0N^NuNVH>.|am |zn|0JLN^Nu _B0Z"y_ CCbNC NJg .NuNV n=h.0n/0n/NLP/?.?<?NLPN^NuNV n=h.0n/0n/NLP/?.?<@NLPN^Nu#_NA/9_NuNVBBJlDRBJ lD RB0. -@0.2. An=@ .gDN^NuNVH?BCB..,. f#_ <`hlDRCJlDRCn8fzB`0l :HGH`xe`Jge`|fD#_ D`#_ JLN^Nu Stack Overflow$StupidityCON:LST:qt.rcATD 0123456789abcdefABCDEF \xx ,8DPPPPPPPPPjvRRRRRRRRRR 4 R R R n R R        -- type anything to cancel. (cancelled)calling : not in phonebook. \t\n\r: improper mapping. out of memory. ' not a phone # out of memory. too many phone numbers. imagetimeoutconndialcfgprefixsuffixverboseterseescapetimeout must be 10 to 60. funny escape key unknown option is a boolean option. unknown option is not a boolean option. w# Qt Lim [1.4-e] e->0 set noimage set verbose set terse set timeout=set escape=set prefix=set suffix=set dial=set conn dial map x=rdialmapsetunknown command ' Quick & dirty terminal vLim [1.4-e] e->0 -- Type '' to command.?' for help. quit 123=?||?BMPRSW"|! J !T"^!.?BCDHMOPQX##x#""#"#*#J#R#Z#j#n$SHELL\command.prgfile not found.Permission denied. dir *.*\*.**.*no files found.no such file. : free kbyte baud 00400200 300 1200 2400 1 - set 1200 baud. 2 - set 2400 baud. 3 - set 300 baud. = - show current baudrate.? -- type 'b?' for help. => call what number? nothing to redial. calling a-z - call phone #a-z. ; - call another number. ! - redial last number. = - list the phonebook. ? -- type 'p?' for help. *Connected to host. escape = imagetext xfers. verboseterse timeout = prefix = suffix = = QT was written Dec-86 by Orc (David Parsons) This is version Lim [1.4-e] e->0 map: phone number: set: read cfg? couldn't read write cfg? couldn't write .b - display banner. .m - define a macro. .p - add a phone number to the phonebook. .r - read in a configuration file. .s - set an option. .w - write current configuration. ? -- type '.?' for help. Qt>*Qt>(connect) (thud) b - set the baud rate. c - connect. d - get a directory listing. h - hang up the phone. m - show macros. o - show options. p - call a number. q - quit. x - xmodem file transfer. . - extended commands. ! - shell escape. ? -- type '?' for help. ext inary Sector #0 (Try=0, Errs=0)parity error on sector#checksum errorSector # (Try=, Errs=) VeryBadSector# Sector # (Try=, Errs=) (abort) (write error) eceive file? cannot create start char? Sector # (try ) (abort)end file? cannot open start char? (timeout)(timeout) xmodem x[m]r - Get a file using Xmodem protocol x[m]s - Send a file ... [m] - transfer mode; b(inary or t(ext x? - Print this message ? -- type 'x?' for help. \\\.tos.ttp.prg: unmatched quoteCannot open Cannot append Cannot create : No matchStack Overflow $   ^^ IJ,IIJJ,J,I!!!!"CP/M-68K(tm), Version 1.2, Copyright (c) 1983, Digital Research XXXX-0000-6543216$ ^<  $ 6"    DL,.   j F  &6  0  $2  &  B        @       $ ,  B ..$ "    \>(.    ,         ,   "                (  . *  $ > v6 P*     &    .       60 B*   4\ N   8".($0,6  4(4*zJ2$,   ,:P& \& DN ,D( 0 <    >  h 0HN&  jhF \@(B4.J".86 Jp $""@2&"fHR">* vf  (8ZX # # This is a sample QT configuration file. # # lines beginning with # are comment lines # set timeout=30 set prefix=ATD set suffix=\r # # 'dial' adds phone numbers to the phonebook # each phonebook entry is set up as : # the phonenumber can be any string that your modem can eat. # dial 123-4567:System 1 dial 234-5678:System 2 dial 345-6789:System 3 # # 'map' defines keyboard macros. The format of one of these is # =. # by using \, you can have nonprinting characters in the macro; # \ followed by 1 or more hexadecimal digits gives you the appropriate char. # The mappings below are for f10 (\c4) and f9 (\c3). \n maps to # newline, \r maps to return, and \t maps to a tab. # # the special keys on the keyboard produce: # key shifted key shifted # f1 \bb \d4 help \e2 \e2 # f2 \bc \d5 undo \e1 \e1 # f3 \bd \d6 insert \d2 0 # f4 \be \d7 clr/home \c7 7 # f5 \bf \d8 # f6 \c0 \d9 # f7 \c1 \da # f8 \c2 \db # f9 \c3 \dc # f10 \c4 \dd # # the mapping below makes f10 produce the string "your password" # map \c4=your password\r map \c3=your other password\r .  t1..  tWTERM ACC t 2WTERM DOC t :NWTERMF ACC t BVWTERMF RSC t Xp`<N NXK mNf]` m"m -So Q m -SBQ(m)MO*mNN*?<NH?<A?<NAX <B@SfLNuNVN9@9|2V9|2T9|R9|dPN HnNtX n(fN `N^NuNuNVBnBnN @f`2HlPHlRHlTHlVN?,P?,R?,T?,V?<?<8Bg?<N?,P?,R?,T?,V?,N HlBHlDHlFHlH?<?,N09lHL9lFJNx?<?<NpXHnHnHnHnHnHnBgBgHnBgBgBgBgBgBgBgBgBgBgBgBgBg?<0N|<=@HnHnHnHn?< ?,N0.lg. nf$ ng?<?<NX=|`40.lf( nf ng?<?<NXBn0.| g0.lf?<?<N>XJg?<?<N*X-@ f6 nf?<?<N:X=|`?<?<N"XBn !fNN9lHL9lFJ .??<NX?<NTJg@ nf6?<NT=@Hn?<N\?.N2THn?<N\0.|g0.`|g`N9lHL9lFJ``|g`|g`(BgBgBg?,?< ?,N N,`P`|(g`Hl?<N *\`.`|)g``"``|g`H?,NJT?,P?,R?,T?,V?<?<8Bg?<N 0?,N2T```|g`N``|g`HnHnHnHn?<BgN 0.nS@2.nSAAo0.nS@n=@0.nS@2.nSAAo0.nS@n=@HnHnHnHnN0.lVlL0.lTlJ9nV9nT9nR9nP?,P?,R?,T?,V?<?,N HlBHlDHlFHlH?<?,N ``|g`9nV9nT9nR9nPHlPHlRHlTHlVN?,P?,R?,T?,V?<?,N HlBHlDHlFHlH?<?,N 9lHL9lFJN````jN^NuNVBg?,NXHlN?<N \?<N THnHnHnHn?< ?,N .`X=n=n0.nS@=@0.nS@=@Hn?,NR\HnHnHnHn?< ?,N 0.g 0.fBgN 2THlN?<N \N^NuNVHnHnHnHn?< ?,N 0.lflHnHnHnHn?<?,N Z0.S@n0.S@nBg?,NXHn?<N |\Hn?,N|\Hn?<N `\N^NuNVHnHnHnHn n? n? n ? n??</?<N ``Rn0.HH@ @f`Rn0.HH@ @f/././. /.?.?.?.?.?</BgN N^NuNVHnHnHnHn?<?,N B0,Vnf0,Tnf0,Rnf0,PnfHnHnHnHn?<?,N ?,P?,R?,T?,V?.?.?.?.N9nV9nT9nR9nP?,P?,R?,T?,V?<?,N HlBHlDHlFHlH?<?,N r9lHL9lFJ`HnHnHnHn?<?,N B?.?.?.?.?,P?,R?,T?,VN9nV9nT9nR9nP?,P?,R?,T?,V?<?,N $ HlBHlDHlFHlH?<?,N9lHL9lFJN N^NuNVHnHnHnHn?<BgNHnHnHnHnNnQn?.?.?.?.?</N 9@ llHl@?<N\0<`"BgBgHlr?<?,NZ 0<`N^NuNV?<?<N XXBg?<N 0X-@A:  n n1|  n1| n1| nBh nBh?<?<N XN^NuNV l8f,Hl>Hl@HnHn?<?,N X9|8`BHl>Hl@HnHn?<N T @f 0< `0< ??,N Bl8N^NuNV n f00,Jl>2,FlBl>Ao N^`V0,>lJ`J n f 9lHL`6 nf?<?<?<N \` n f8?< NT?< NvT?< NlT?< NbT?< NXT` n fN9lHL9lFJ` ng nf20,LlHo"0,@lLHl?,J?,L?,N  `t0.@B.Hn?,J?,L?,N 0,@lL0,L2,HlDl@Ao29lHL0,Jl>2,FlBl>Ao N` 0,>lJN^NuNV0,FlB2,>RAA?0,HlDS@??,F?,H0,Fl>lB2,>RAA?0,HlDS@?0,Fl>??,HNJ=lH=lJ0,HlDS@=@0,Jl>=@Bg?,N vXHn?,N V\N^NuNV=n=n =n =n=n=n=n=nHnHnHn?<?,N 4N^Nu)It)Jp"/0<NB"lt$lpNu NV9n.0.| A" AA-H=|` nR2.A.H0Rn nm/,ʬN.X0,N^NuNVA.)HʰA)HʴA)HʸA)HʼA)HA)HAʰ)Hʬ?< NXT9lʪ0,ʪN^NuNV)n?<N6TN^NuNV9n9n 9n 9n9n9n9n9n9n9n9n9n9n 9n")n$9n(9n* ?<NT n,0 n00 n40 n80 n<0 n@00,N^NuNV9n)n ?<#NlTN^NuNV9n)n ?<4NNTN^NuNV9n9n 9n 9n9n9n9n9n?<IN TN^NuNV9n9n 9n 9n9n9n9n9n?<JNTN^NuNV?<MNT n0 n 0 n0 n00,N^NuNV9n)n ?<NNvTN^NuNV9n9n 9n 9n9n?<dNFTN^NuNV9n9n 9n 9n9n?<eNTN^NuNV9n?<fNTN^NuNV9n?<gNTN^NuNV9n9n ?<hNT n 0 n0 n0 n00,N^NuNV9n9n 9n 9n9n9n?<iNnTN^NuNV9n?<kNVTN^NuNV9n9n 9n 9n9n9n?<lN T n0 n0 n0 n 00,N^NuNV?.NT nn0<`?.?<>NPX9@Ĩg0<`0<N^NuNV?.?<LN*XN^NuNV/ A&H`0+ |g/ N*X A"Ҽm?.NT&_N^NuNV/ &n/ NDXJ@g0<`00+ |g /+NXBk ?+ N,TJ@g0<`0<&_N^NuNVH&n0+ |f0<`.0+ |gV0+ |f0<`v0+ |g?<B?+ NhP?/+?+ NHP @f0<`@k 0Hѫ`$ k o?<0+D@H/?+ NP'@&Bk0<LN^NuNV nl <`?.?./. ?<BN -@ m .`?<?.B?<BN| -@?<?.B?<BNb -@ nf .Ю -@ `$ nf .Ю -@ `0.g <`b . oHn . /?.?<@N Bg?./. ?<BN ]|9@Ĩg <` `BlĨ . N^NuNV/.?<IN\N^NuNVBn`&0.Ax0nf0.AxBPRn nLmN^NuNV?>.=|0Ax"HPgXHf0(>N^Nu)It)Jp)_lNM"lt$lp/,lNu)It)Jp)_lNN"lt$lp/,lNu)It)Jp)_lNA"lt$lp/,lNuNV .9@ .9@N^NuNV .9@ .9@N^Nu)It)JpHl)_XHlX" <sNB"lt$lpNuNV9n 9|kBl9|9nN n 0 n0 n0 n00,N^NuNV9n 9n 9|'Bl9|9nNd n0 n0N^NuNV9n 9|Bl9|9nN,0,N^NuNV)n\)nd .мZ)@h9|dBl9| n 9PN n 0A)H\A)HdA)HhA)H`N^NuNV9n 9n Bn nR2.RnA|0f9|9|Sn0.9@9nNfN^NuNV)n `9|r9|Bl9nN>A)H`N^NuNV9n /.NX/.NX)n `9|m9|9|9nNA)H`N^NuNV`4 nH| f?< ?<NfX nRH??<NNX0. Sn J@fN^NuNV` nRH??<N X0. Sn J@fN^NuNV` nRH??<NX0. Sn J@fN^NuNVH0&n $KA-H nf?./ N4\=n`L nf?./ N`\=n`. nf?./ Np\=n`-KBn?.NTJ@f`H| f |o@ H-@/./.?.?<@N 9@ĨHg0<`0,Ĩn/./<?.?<@N 9@Ĩ @g0<`tRnR -@`R ned` 6.ƼЃ$@ H-@/./.?.?<@N 9@ĨHg0<`0,ĨnBlĨ0.L N^Nu9|8C"2"2 2"2"2"22"2"2"22"2x9|Nu Window Term[1][Window Terminal| |by Matt Kimmel|1987][Okay][3][There are no more|windows available!][Sorry!] Window Term 1.0-S CON:AUX:PRT:  Window Term Version 1.0 The Desk Accessory Terminal in a Window by Matt Kimmel 1987 Window Term is a terminal program in a desk accessory. It differs from the VT52 emulator in one major way - it's in a window. This means that you can keep it on the screen while doing other things - For example, you could open Window Term while using a word processor, and switch between your document and Window Term - both will be on the screen. If you've used the Control Panel, Window Term is similar to that. It is a GEM window like any other. Window Term represents a lot of work. However, in the interest of getting this program to as many people as possible, I have made it completely public domain. It may be distributed in any way. My only request is that if you modify the source code, please get a copy of the modified source code to me. If you have any questions or comments, I can be reached at any of the following network addresses: KIMMEL@UMAECS (BITNet) KIMMEL@ECS.UMASS.EDU (Internet) Matt Kimmel on FidoNet node 321/109 INTRODUCTION ------------ Window Term comes in two versions (both are included in the distribution archive). The Stripped version is smaller and faster, but has almost no features. You must use an external program to set the RS232 port when using the Stripped version. The Full version is bigger and slower, but has many features discussed in detail below. It's helpful to read the documentation for both before you decide which is best for you. To install the Stripped version, just copy the file WTERM.ACC to the root directory of a floppy or hard disk. When you boot with that disk, it will be listed in the 'Desk' menu as Window Term. To install the Full version, copy the files WTERMF.ACC and WTERMF.RSC to the root directory of a floppy or hard disk. The Full version is listed in the Desk menu as Window Terminal. Stripped Version ---------------- The stripped version, as mentioned above, is much smaller and slightly faster than the full version. There are two versions of window term in order to maintain as much flexibility as possible. Note that with the Stripped version, you must use an external program (such as the Install RS232 desk accessory or a terminal program) to set the RS232 parameters. When you click on Window Term, a window will open on the screen with the title 'Window Term' (there may be some version information in the title also). This is a full GEM window - you can move it, size it, full it, close it, and select it, just like any other window. When the window is active, anything you type will be sent to the RS232 port, and anything coming from the RS232 port will be displayed in the window. Text will wrap at the end of a line and scroll just as in a text screen. There are two special keys you should be aware of when using the stripped version - ALT-F toggles between the normal text font and the small 'icon' font (the same font that's used for the names of icons). ALT-S stops the text immediately. This is necessary because the terminal is sometimes slower than the incoming characters, and will keep printing backed-up characters after you send a CTRL-S to the remote computer. ALT-S sends a CTRL-S and will not accept any incoming characters until you press ALT-S again. Click on the Window Term entry in the desk menu while the window is open for more information. When the window is deselected (another window is made active), Window Term will send a CTRL-S to the RS232 port. When it is reselected, it will send a CTRL-Q. Full Version ------------ The Full version is larger and slower than the stripped version, but has many extra features. It takes up about 40K of memory, while the stripped version take up about 15K. The Full version has all the features of the stripped version except the ALT-F command (which is replaced by a more flexible function of the same sort). In addition, it has the following features: -Ability to set RS232 parameters, similar to the 'Install RS232' desk accessory -Ability to change the font to any of three sizes (two sizes in color) -An optional cursor -Allows the user to set the size of the RS232 buffer -Ability to save all of the above parameters and the coordinates and size of the window to disk Each of these features are discussed in detail below. To access them, click on the 'Window Terminal' entry in the Desk menu while the window is open. You will be presented with a menu. Click on the option you wish to use. Each of the options are discussed below. About Window Term gives some information about the program and credit to the author. Set RS232 Parameters allows you to set the Baud Rate, Parity, Word Length, and other RS232 parameters. It's very straightforward - just select the parameters you want active, and click on the OK button. If you do not want to set the parameters after all, click on the CANCEL button. Set RS232 Buffer Size allows you to set the size of the RS232 buffer. The higher your baud rate, the bigger the RS232 buffer should be. I find that 16K is usually more than enough for 1200 baud. This program has not been tested with 2400 baud or higher; please let me know if there are any problems with that. If in doubt, though, make the RS232 buffer bigger. Set Character Size allows you to select any of the ST's three character sets - the 'monochrome font', which is the character set used with the monochrome monitor normally, the 'color font', which is the character set normally used with the color monitor, and the 'icon font', which is the tiny font used at the bottom of most icons. Using the icon font, you can get a full 80 columns by 24 lines in a relatively small window. Cursor on/off lets you select or deselect the cursor. The cursor is useful when editing lines and such, but it slows down the terminal quite a bit. Note that backspaces are destructive when you are not using the cursor, and non-destructive when the cursor is active. I don't recommend using the cursor unless absolutely necessary. Save settings saves all the above parameters and the position and size of the window to a file called WTERMF.INF in your root directory. The full version of Window Terminal will attempt to read this file whenever it is booted. If it can't it sets up the default parameters. Cancel cancels the menu. Notes and Program Revisions --------------------------- Thanks to Rick Flashman, who beta tested this and offered many valuable suggestions. This program was developed using the Megamax C Language Development System, K-Resource, and the Gulam shell. Version 1.0 - released 8/2/87 - first version. No known bugs. Of course, that doesn't mean there aren't any! `TN6N.N-"N/N.:N.N-N-|NSK mNf]` m"m -So Q m -SBQ(m)MO*mN0N*?<N(H?<A?<NAX <B@SfLNuNVN!9@/.NI /.N&vXHnHnHnHn?<BgN#0,Vnm0,V2.nAo9nV0,Tnm0,T2.nAo9nT0,VlR2.nAo0.nlVQ@9@R0,TlP2.nAo0.nlV9@PHlPHlRHlTHlVN XN l f?<N6T @g9| ?Hl@HnHn?, ?,NJX?<?,NJX?<?,NJX?<?,NIX?<?,N3nX)@ fHnNLX`N HnN:X n(fN `N^NuNuNVBnBnN 2 @f`HlPHlRHlTHlVN?,P?,R?,T?,V?<?<8Bg?<N ?,P?,R?,T?,V?,N HlBHlDHlFHlH?<?,N!:NF?<?<N4XHnHnHnHnHnHnBgBgHnBgBgBgBgBgBgBgBgBgBgBgBgBg?<0Nl<=@HnHnHnHn?< ?,N 0.lg. nf$ ng?<?<N4X=|`40.lf( nf ng?<?<N3XBn0.| g0.lf?<?<N3XJgd?<?<N3lX-@ f6 nf?<?<N3|X=|`?<?<N3dXBn .??<N3PX?<N3FTJg nf?<N3,T=@Hn?<N\0,"gb0,L2,@HA=@0,JS@=@=n0,Jl>R@=@?<?,NFXHn?<?,NHP?<?,NFX?.NT0,"gb0,L2,@HA=@0,JS@=@=n0,Jl>R@=@?<?,NFXHn?<?,NHP?<?,NFhXHn?<N\0.|g0.`|g`N9lHL9lFJ`x`|g`|g`(BgBgBg?.?< ?,N NJ`:`|(g`N `"`|)g``` `|g`H?,NT?,P?,R?,T?,V?<?<8Bg?<N?,NT```|g`NZ``|g`HnHnHnHn?<BgNn0.nS@2.nSAAo0.nS@n=@0.nS@2.nSAAo0.nS@n=@HnHnHnHnN0.lVlL0.lTlJ9nV9nT9nR9nP?,P?,R?,T?,V?<?,N HlBHlDHlFHlH?<?,N``|g`~9nV9nT9nR9nPHlPHlRHlTHlVNb?,P?,R?,T?,V?<?,Nl HlBHlDHlFHlH?<?,N N````N^NuNVHnHnHnHn?< ?,N0.lf N`Bg?,NDnXHn?<N\?<N THnHnHnHn?< ?,Nv`X=n=n0.nS@=@0.nS@=@Hn?,NE\HnHnHnHn?< ?,N0.g 0.fBgNzTHn?<NF\N^NuNVHnHnHnHn?< ?,N0.lfHnHnHnHn?<?,N0.S@n0.S@nBg?,NCBXHn?<N\Hn?,NDD\9lHL9lFJ0,"gT0,L2,@HA=@0,JS@=@=n0,Jl>R@=@?<?,NAXHn?<?,NCRPHn?<NB\N^NuNVHnHnHnHn n? n? n ? n??</?<NB`Rn0.HH@ @f`Rn0.HH@ @f/././. /.?.?.?.?.?</BgNN^NuNVHnHnHnHn?<?,N$0,Vnf0,Tnf0,Rnf0,PnfHnHnHnHn?<?,N?,P?,R?,T?,V?.?.?.?.N9nV9nT9nR9nP?,P?,R?,T?,V?<?,N HlBHlDHlFHlH?<?,NT9lHL9lFJ`HnHnHnHn?<?,N$?.?.?.?.?,P?,R?,T?,VN9nV9nT9nR9nP?,P?,R?,T?,V?<?,N HlBHlDHlFHlH?<?,N9lHL9lFJNN^NuNVHnHnHnHn?<BgNnHnHnHnHnNnQn?.?.?.?.?</N 9@ llHlT?<NV\0<`"BgBgHl?<?,N< 0<`N^NuNV?<?<N*fXBg?<N*>X-@ n  n1l0,H n1@ 0,H n1@ nBh nBh?<?<N)XN^NuNVBn`^0. l2 hg0. l2 hf*0. l2h 0. l2h Rn n oBn`F0. l. hf*0. l.h 0. l.h Rn no l(f"Bg?<BgBgBgBgBg?</,2N l(f"Bg?<BgBgBgBgBg?</,2N l(f"Bg?<BgBgBgBgBg?</,2N l(f"Bg?<BgBgBgBgBg?</,2N l(f"Bg?<BgBgBgBgBg?</,2Nf l (f"Bg?<BgBgBgBgBg?< /,2N< l$f"Bg?<BgBgBgBgBg?</,2N l$f"Bg?<BgBgBgBgBg?</,2N l$f"Bg?<BgBgBgBgBg?</,2N l$f"Bg?<BgBgBgBgBg?</,2N0,&|g.0,&|g"Bg?<BgBgBgBgBg?< /,2N\0,&|g.0,&|f"Bg?<BgBgBgBgBg?< /,2N$0,&|f"Bg?<BgBgBgBgBg?</,2N0,&|f.0,&|g"Bg?<BgBgBgBgBg?</,2N0,&|g.0,&|g"Bg?<BgBgBgBgBg?</,2N0,&|@f.0,&| f"Bg?<BgBgBgBgBg?</,2NP0,&|@f.0,&| g"Bg?<BgBgBgBgBg?</,2N0,&|@g.0,&| f"Bg?<BgBgBgBgBg?</,2N0,&|@g.0,&| g"Bg?<BgBgBgBgBg?</,2N l f8?<N%rT @g&Bg?<BgBgBgBgBg?</,.Nl`, l f"Bg?<BgBgBgBgBg?</,.N> l f"Bg?<BgBgBgBgBg?</,.N l f"Bg?<BgBgBgBgBg?</,.N?<N$T @g"Bg?<BgBgBgBgBg?</,.N?,HlHlN+ N^NuNVBgBgN lX?<NnTHnHnHnHn/,6N8?.?.?.?.?.?.?.?.BgN?.?.?.?.?< Bg/,6N Bg/,6NZ\=@BgBgBgBgBgBgBg?./,6N BgNT?.?.?.?.?.?.?.?.?<N$0.`|g`N``|g`Nn``|g`N`r`|g`( l"f 0<`0<9@"N`@`|g`N`(`| g`Hl?<N \``N^NuNVBgBgN X?<NTHnHnHnHn/,2N ?.?.?.?.?.?.?.?.BgN ?.?.?.?.?< Bg/,2N BBg/,2N \=@BgBgBgBgBgBgBg?./,2N PBgN.T?.?.?.?.?.?.?.?.?<N  n f N`?</,2N\J@gBl(?</,2N\J@g9|(?</,2Np\J@g9|(?</,2NV\J@g9|(?</,2N<\J@g9|(?< /,2N"\J@g9| (?</,2N\J@gBl$?</,2N\J@g9|$?</,2N\J@g9|$?</,2N\J@g9|$Bl&?< /,2N\J@gl&?< /,2N\J@gl&?</,2Nj\J@gl&?</,2NP\J@gl&?</,2N6\J@gl &?</,2N\J@gl@&?</,2N\J@gl`&l&? nf N`t?</,.N^\J@g9| ?</,.ND\J@g9| ?</,.N*\J@g9| Hl>Hl@HnHn?, ?,N1NN^NuNVHlHlNP-@ fHl?<N\`Hn?<N\?,(Hl/.N#b ?,&Hl/.N#N ?,$Hl /.N#: ?,"Hl$/.N#& ?, Hl(/.N# ?,Hl,/.N" ?,P?,R?,T?,VHl0/.N"/.N HXHnBgN"\N^NuNV0.  n0( |g0<`` 0<`N^NuNV n f00,Jl>2,FlBl>Ao N`0,>lJ`| n f 9lHL`h nf?<?<?<N~\`H nf"0,"g0,LlHo 0,@lL` n f8?< NVT?< NLT?< NBT?< N8T?< N.T` n fN9lHL9lFJ` ng nf:0,"f20,LlHo"0,@lLHl>?,J?,L?,N0 `t0.@B.Hn?,J?,L?,N0 0,@lL0,L2,HlDl@Ao29lHL0,Jl>2,FlBl>Ao N` 0,>lJN^NuNV0,FlB2,>RAA?0,HlDS@??,F?,H0,Fl>lB2,>RAA?0,HlDS@?0,Fl>??,HNJ=lH=lJ0,HlDS@=@0,Jl>=@Bg?,N/ XHn?,N0\N^NuNV=n=n =n =n=n=n=n=nHnHnHn?<?,N/N^Nu)I)J"/0<NB"l$lNu NV9n0.| A" AA-H=|` nR2.AH0Rn nm/,HN.X0,xN^NuNVA)HLA)HPA)HTAx)HXAl)H\Ad)H`AL)HH?< NXT9lxF0,FN^NuNV)nl?<N6TN^NuNV9n9n ?<NTN^NuNV9n9n 9n 9n9n9n9n9n9n9n9n9n9n 9n")n$l9n(9n*?<NT n,0z n00| n40~ n80 n<0 n@00,xN^NuNV9n)n l?<#NNTN^NuNV)nl9n 9n9n9n9n9n?<*NTN^NuNV)nl9n 9n9n9n9n9n9n9n?</NTN^NuNV)nl9n ?<2NTN^NuNV9n9n 9n 9n9n9n9n9n9n?<3NdTN^NuNV9n)n l?<4NFTN^NuNV)nl?<6N.T n 0z n0| n0~ n00,xN^NuNV9n9n 9n 9n9n9n9n9n?<INTN^NuNV9n9n 9n 9n9n9n9n9n?<JNTN^NuNV?<MNtT n0z n 0| n0~ n00,xN^NuNV9n)n l?<NN2TN^NuNV9n9n 9n 9n9n?<dNTN^NuNV9n9n 9n 9n9n?<eNTN^NuNV9n?<fNTN^NuNV9n?<gNTN^NuNV9n9n ?<hNT n 0z n0| n0~ n00,xN^NuNV9n9n 9n 9n9n9n?<iN*TN^NuNV9n?<kNTN^NuNV9n9n 9n 9n9n9n?<lNT n0z n0| n0~ n 00,xN^NuNV)nl?<nNTN^NuNV9n9n 9|?<pN|TBl n d0,xN^NuNV?.NT nn0<`?.?<>N0X9@g0<`0<N^NuNVHl@/.N#PJ@g`HlF/.N#xPJ@gNHlL/.N#fPJ@g n(g nf. n-P n(f HnNX` HnNXA-H/./. 0.A PNPLN^/W D.NuN^Nu)@$Hl$NXONuHl$N XO ,$NuNVH n "(fJg"¼м@ LN^NuNVH nB fB`м8 LN^NuNVH n$fBCB`nD6< f႖|NN^NuNVH0&n$n Bn-J @)P$)h(-l$-l(BEG>O|g|JGn|m` REHl>/ NPO`SEHl>/ NbPO`&0+H@JGgDG0<0dR@0.BAQ,>QQֆG|0QB`Rn0.g$nB`0R 2.HmB`b .6.HЃR$@ nH|0fRZ"` R"H|9n nH|0f$n R&@fSE .6.HЃ @B n0L N^NuNVH0&n BnH|bf=| RH|rgH|wgH|ag <`F ,$@ f*A$H`0* |f` A"Ҽm A"Ҽm <`BBj Bn+H|+f =|j H|wf?./.N\\>j `hH|afB0<n?/.N<\> @f?./.N\>?<B?NPPj `0.n?/.N\>j Gf Bj <`05G Bj <$%@?<B?* NP%@5l L N^NuNVH$.f BB`J". BnJlVnDJlRnDvd`Bbd nmDdD-@-A LN^NuNV/BnJlRnDJ lRnD 0. -@0.n0. nngD -n N^.JNuN^NuNV nl <`?.?./. ?<BN -@ m .`?<?.B?<BN -@?<?.B?<BNj -@ nf .Ю -@ `$ nf .Ю -@ `0.g <`b . oHn . /?.?<@N Bg?./. ?<BN ]|9@g <` `Bl . N^NuNVH0><2.|SA¼0?N T&@f <` $@5G \/NX ,L N^NuNVH0><2.\ASA¼A ,$@ fA $@)@)@Bl&R0+Ge*0+Gf$`0k0+7G)J \`, f?NT&@ f <` $@ &@`L N^NuNVH0 .]&@$l` m n l`$R o l 2+Ёf R0(k R&`& 2*Ёf 0+j$`$)JL N^NuNVH0. <?NT&@ gBG` 0 KBRG0Fe LN^NuNV/.?<HN\N^NuNV/.?<IN\N^NuNVBn`60.A0f"0.A00.A0 ` Rn nLmN^NuNVBn`&0.A0nf0.ABPRn nLmN^NuNV?>.=|0A"HPgXHf0(>N^NuNVHlf/.NPJ@f =|`Hll/.NfPJ@f =|`Hlr/.NJPJ@f=|`f0. |g0/.N>XJ@g0<``Bg/.?<NX0. |?/.?<=NlP=@9@ @l0<`0. | ??.N~X0.N^Nu)I)J)_NM"l$l/,Nu)I)J)_NN"l$l/,Nu)I)J)_NA"l$l/,NuNVH&n Bn0.|dg`>< `.`|ug`>< ``|og`><``|xg`>< l* ndf SR- .D-@`0. f Gf .`& Gf .` ./0H/NzX 2.RnA0 Gf .`( Gf .` ./0H/N, X-@ .fp`FSn0.A P m0.A0| |A`0.A0|0 SR0.fLN^NuNVH&n n f=| )n$)n(HlxHl$?<N ]|@0. R@?HnHnHnN~.g SR-.H|0f.f SR`J nff>.n RG0l0o0,0`0> Gl0<`0?HnHnHnNBF`0RFA SRSGSn0g nl` SR0Sn nl0. g SR.` SR0RnSn 0. g nm`" Go0RFAH`0<0 SRSG0. Sn J@f`` SR0. g SR.><`0RGA SR0. Sn J@f SRE?.Hl/N: /NrXHѓLN^NuNVBn`"0. n PHC|0=@ nR n PH|0m n PH|9o0.N^NuNVH0&n -n @$PX`R` nRg H|%fH|%f,RBn=|Bn| H|-f=|RH|0f|0R-JHnN$X=@$nH|.fR-JHnNX=@$nH|lf=|RgH-n Gdg Gog Gxg GufB0.g @ ` @0H/Hn?.?NV 0.g0<`0<H` Gcf R @ nRT` Gsf4 @-PX<.` nR nRSF0g nf`J Geg Gfg Ggf, @)P$)h(/,(/,$Hn?.?NP` 0 nR .nl0.g$<.".A` nRSF0f`b .2.SAHЁ-@-@,.` .2SAHЁ @ nSSF0f` nR .o .R-@f nB .L N^NuNV/. HnNhP=@/.HnN8P0.N^NuNVHn /.NPN^NuNVHn /.N&PN^NuNV`/. nRH?N\ nfN^NuNV nf:0,jlhf0<9@h9@j`?<NT=@ nf*0,jg Slj?<?<NX?<D?<NX` n f00,jRljAl ?< ?<NX?< ?<NX`v nf ?<N*T nf20.2,jRljAl?< ?<NfX?< ?<NXX`*0.2,jRljAl?.?<N4X0<fAlhH|f0<`0,hRlhAlH`` nf?<NT``0.=| 0.HN-l$-l(BnBnBnBn=|Bn=|)l$)l(-l$-l( G-f|N>`B.Bn` G-f0.g =|` G0m G9n0.g0. G|0=@`t G0gBn0.fRn`^0.gSn0.fN)n$)n(HnHl$?<NSn 0. f0.f9|\0.g 0.n`0.n`b nl.)n$)n(HnHl$?<Nv-l$-l(Rn`,)n$)n(HnHl$?<NH-l$-l(Sn0.f.g()n$)n(HlHl$?<N-l$-l(0,^g/,d?Nt\`S`)n$)n(LN^NuNVH0BnBl\ nX&P`.H=@ n g n g n f.N=@ ng0,^g/,d?.N\`S`` n%gHNN=@ nf0<`0.ng"0,^g/,d?.N\`S`0.``0<=@=@=|H|*f=|RH|0m H|9n-KHnN\X=@&nH|lf=|RH=@ ncf4Np=@ @f0<`0.f0. nX PRn` ndg nog nxg nhfN@=@ @f0<`?.?.?.N\-@0,\g0.`0.fF0.g nX  @ `. nhf . nX" A` . nX" A0Rn`< neg nffN=@ @f0<`?.?.NXX-l$-l(0,\g0.`0.fH0.g$)n$)n( nX" A $!l(`)n$)n(N nX" A Rn` nsfN=@ @f0<`0.f nX$P`$0.f0.N=@ @f0<`LSn0.g n g n g n fB0,^g/,d?.N\`S`Rnf0.L N^NuNV)nd9|^Hn NXN^NuNVH0&n$n `RRgHHAgHHC`L N^NuNVH0&n$K`Rf `L N^NuNV n R @H=@` n R @H=@ n g n g n g0.N^NuNV=| nxg nXf n f0<`f n0m n9n0.|0=@`2 nam0.|a| =@` nAm0.|A| =@0.n o0<``0.N^NuNVBnBHnNX=@ n-f0<=@ nRH=@`0 ./0.H/N 6.HЃ-@ nRH=@?.?.NX=@ @f g n 0.g .D` .N^NuNV?< /</.N@ HN^NuNV/.?<AN^\9@g0<``0<N^NuNV .9@ .9@N^NuNV .9@ .9@N^Nu)I)JHl)_HHlH" <sNB"l$lNuNV9n 9| Bl9|9nN0,N^NuNV9n 9|Bl9|9nN0,N^NuNV9n 9|kBl9|9nN^ n 0 n0 n0 n00,N^NuNV9n 9|Bl9|9nN0,N^NuNV9n 9n 9|'Bl9|9nN n0 n0N^NuNV9n 9|Bl9|9nN0,N^NuNV)nL)nT .мZ)@X9|dBl9| n 9PNf n 0A)HLA)HTA)HXA)HPN^NuNV)n P9|9n Bl9nNA)HPN^NuNV9n 9n Bn nR2.RnA|0f9|9|Sn0.9@9nNN^NuNV)n P9|r9|Bl9nNA)HPN^NuNV9n /.N(X/.N@X)n P9|m9|9|9nN>A)HPN^NuNV`4 nH| f?< ?<NX nRH??<NX0. Sn J@fN^NuNV` nRH??<NX0. Sn J@fN^NuNV` nRH??<NX0. Sn J@fN^NuNVH0&n $KA-H nf?./ N4\=n`L nf?./ N`\=n`. nf?./ Np\=n`-KBn?.NTJ@f`H| f |o@ H-@/./.?.?<@N 9@Hg0<`0,n/./<?.?<@N 9@ @g0<`tRnR -@`R ned` 6.ƼЃ$@ H-@/./.?.?<@N0 9@Hg0<`0,nBl0.L N^NuC[1][Window Term 1.0|Full Version|by Matt Kimmel, 1987][OK]C"2"2 2"2"2"22"2"2"22"2x9|)lR>)lVB)lZ:)l^2)lb69|0CA"A"A"A$"A*"A"A ")|)|9|j9|hNuWTERMF.RSCWTERMF.INFr%d%d%d%d%d%d%d%d%d%d Window Terminal[3][There are no more|windows available!][Sorry!] Window Term 1.0-F %d[3][Not enough memory|for a buffer of|that size.][Cancel]WTERMF.INFw[3][Couldn't open|WTERMF.INF or writing.][Cancel]%d %d %d %d %d %d %d %d %d %d CON:AUX:PRT:@$??CON:AUX:PRT:%d@H $`9pWindow Term OptionsSet RS232 ParametersSet Character SizeSet RS232 Buffer SizeCursor On/OffSave SettingsCancelAbout Window TermSet RS232 ParametersBaud Rate192009600480024001200300ParityEvenOddNoneWord LengthStop Bits12Flow ControlNoneXON/XOFFRTS/CTSBothOKCancelSelect Font Size8x16 ("Monochrome")8x8 ("Color")6x6 ("Icon")OKCancelPlease enter the new buffer size:16384_____99999CancelOK??@?~D$89 &  ! : O b x    %  2                8765    & + 4 <  A%D("  K\p~ % # !   '(