nPp4 =TO`  @o! #@%`')+-/1 35`79;=?AC@E`GIMO/S@U`WY[]_a c@e`gikmoq s@u`wy{} @` @ ` @ ` @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` @`Oo   !A/')+-//3A5a7;=?A!CAEaGIKMO/SAUaWY[]a!cAeagikmoq!sAuawy{O`  @o! #@%`')+-/1 35`79;=?AC@E`GIMO/S@U`WY[]_a c@e`gikmoq s@u`wy{} @` @ ` @ ` @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` @`Oo   !A/')+-//3A5a7;=?A!CAEaGIKMO/SAUaWY[]a!cAeagikmoq!sAuawy{G_SYS_ED S QUICKCAD S RAMDISK KMRS TOS2DOS S DESKTOP INF S #&README 1ST S $IMG_SCAN S %.  S..  SG_SYS_EDPRG S DG_SYS_EDDOC S  `D&|`Nqz8< 6< ><4<|(o*lNN55N+| <*~=~=~Nt*NNL! ASSIGN.SYS Editor by K MillicanNN*NNL! ===============================NN*~DGNvN+G ~+G *;| ;|d *>- =A .6<N0>- =A .v!N0>- =A .6<N0>- =A .6<N0>- =A .v!N0* NL A:\ASSIGN.SYS-~=~=><N* Bm * ~N=.- />N-.N=>- =>- NV^JGf`LNq* >- RGNv;G * ~N>- =A .6<N-NNj*`~Nq*~N*Bm *~=>- =~A N`Nq*~H->- =A .6<N-NL.FNTND-~HNjJGf`NqN *`0Nq>- =A .v!N-.- N0GgN(Nv ^0*N2< Nd*A N`\Nq*~=~=~=~=~N$*~=>- =~A N`Nq*>- =A .v!N G>=.- />N-.NJGf` Nq~=~=~=~=~N$`Nq~=~=~=~=~N$*>- =~NNvXGNv=~ =>- =~NNv0GgN(TGNv=~Nt*N>- =A .6<NN*A N`Nq*;| Bm *~=~=~=~=~N$* >- G f`~Nq*!>- =~NNvXGNv=~ =>- =~NNv0GgN(RGNv=~NtNNL NN*">- =~NNvXGNv=~ =>- =~NNv0GgN(GNv=~NtNNL NN*# m g`Nq>- =~DG^Nv;G *$ m g`Nq>- RGNv;G *% m g`Nq>- =~DG^Nv;G *& m g`Nq>- GNv;G *' m g` NqN J*(>- =>- N8JGf` Nq;| *)>- =~NVJGf` Nq;m **>- =~NNvXGNv=~ =>- =~NNv0GgN(RGNv=~Nt*+NNL>NN*,>- =~NNvXGNv=~ =>- =~NNv0GgN(GNv=~Nt*-NNL<NN*.~N;G */`tNq*1~=~=~Nt*2NNL(W)rite or (A)bort ? ...N*3~N;G *4>- =~WNH=>- =~wNH^JGf`NqN*6~=~=~Nt*7NNLWriting new ASSIGN.SYS file ...N*8NL A:\ASSIGN.SYS-~=~=><N*9~=>- =~A N`Nq*:>- =A .v!N G>=.- />N-.NJGf`&Nq~N>- =A .6<NNN*;>- =A .v!N G>=.- />N-.NJGf`Nq*<>- =A .6<N-~=~N-NL N&=>- =A .6<N-~=~N-NL;N&^JGf`LNq*=>- =A .6<N->- =A .6<N-~NNj*>`LNq*?~+G *@~=>- =~A N`rNq*A~H->- =A .6<N->- =A .6<NND-~HNrJGf`Nq>- N+G *BA N`Nq*C.- N0GgN(Nv=A .v!N G>=.- />N-.N=.- -~N^JGf`:Nq~NNL ->- =A .6<NNNN`4Nq~NNL;->- =A .6<NNNN*EA N`BNq*F~N*HN*K>- =A .6<N->- =A .6<N-~H->- =A .6<N-NL.FNTND-~HDޞNv-~HNNj*L>- =A .v!N-.- N0GgN(Nv ^0*M.- +G *N>- =~N8JGf`Nq*O~=>- =~A N`|Nq*P>- =A .6<N-~=~N->- =A .6<NN&JGf` Nq.- +G *QN2< Nd*RA N`Nq*T.- -.- NJGf`NqNu*U>- RGNv;G *V>- =A .6<N->- =A .6<N-~=~NNj*W>- =A .6<N-~=~N-NL;N&JGf`6Nq>- =A .v!N-.- N0GgN(Nv ^0`0Nq>- =A .v!N-.- N0GgN(Nv ^0*XNu*[>- =A .v!N G>=.- />N-.NJGf`6Nq>- =A .v!N-.- N0GgN(Nv ^0`0Nq>- =A .v!N-.- N0GgN(Nv ^0*\>- =A .v!N G>=.- />N-.NJGf` Nq~=~=~=~=~N$`Nq~=~=~=~=~N$*]>- =~NNvXGNv=~ =>- =~NNv0GgN(TGNv=~Nt*^N>- =A .6<NN*_~=~=~=~=~N$*`Nu*a~N O/0C0<HЈ",Іd䒆 Ь `H`// Bg?<JNAO JfLEA@,A0,Hp!!!.HA 0D"MBQ;@+F +LfSE;ED;D CaHNHz+_>?F?F"/FN<+g <-fPN<.g<0e <:dBo?|Bo <:d<0eaG0ajNRo`Jf /k WeR<.f6Bo N<:d<0eanG0a$RoSo ` ooR߰<Dg <EfZ`N<+g <-f?|N<:d"<0e2/A0AA@GA0?AN` g oo8/o gadAC$Ia1``ھ<&fN߰<HfBN<:d <0e2G0`"<Gd <Ae G7`<gd<aeGWaa&``H<BfN<2d:<0e4G0aaN`<OfN<8d<0eG0azaN`Jf0 /k eRdS|"` |"Ag ggfN/"g,Sf f" /H/@` e /a-HPz./gLJ/gv?a*v:p`J/"f Jj a,`J/gDJ$Nu%&!#HJf߯eNua a,AC$IHa/`/d / a,H PNuJf /Ѐe"ЀeЀe Ёe/@NuaAC$I`/rJf /ЀeЀeЀe Ѐe/@NuaXoNuJf /ЀeЀe Ѐe/@Nua|VoNuJf /Ѐe/@Nua`RoNuJfaR HGJD[jDD<AB!zVB.T/zTBNd A"O$Ha.JFg O"O$Oa.` JgCA$Ia/&HGPNuA ,0-JgPQa gBNu?a0@`  Nu !INu("hNuH+H+HY+I(+I$` - A䐈∓+I ch+@LNuJk*"mg ɉRɉAH d+HNua`a j$Ha JahNu/-BHa a`G^pv.<"m AF"A$m $ QN m*g $ N E P`A"+I, U+@0NuNuSBeg"‡gf"`f$P(*SJg "‡g"`Qd`Nu$m X&m,Qd,m$(/ / / K R,I` (*X"Tbf(f"eef)fe$*ICʹd o( o- Y- XE` o oX- Y- E`d&^$^`|*_& _"X$"X b(g)fG(H$S) $cef*f) $dNu m X.-0S,-"F*<& $X,ReV(*gȅe2؎e,$`8ȅ e^&ր*gR"&F܄ge@$SQdQd+FL+_/ح d(Nua a$Memory exhaustedH/GpvaaJ _a`SBe g"`Nu*<(I m ٭ ٭$$-0gRňX$`,Rd2Ho8 ^("hajSoRgSe(`x"Dp!aT.NuaZH ^Jk ga^c R--`.Nua`a, G("hapψa h`H *-JcaVJgbS/ Ř*bSS H@J@f2 H@J@f*SWfJkSH` VLfˉ`pH@SWgd`JkSH` VLfږd`afafXgXSeTaaVf>d`8<ae <{dNuafgSetHB Vfd`z`z Ga ^.`aJfgSetHB Vf֘d`ac`ad`a e`ab`aSe Se gNuJNu G&$P(<Ƅ VȐ"hNu >HǏNu0HiH@>Nu H@g(Jg$HAJ@gJAfHA`JAgH@HAJAf ށeNu~NuDNu$JnDJnDai JkJjDNu^_HNu^]HNu^WHNu^fNu^\HNu^^HNu~Nu_HNu]HNuWHNufNu\HNu^HNu~Nu Ga4)k2BHҁC. Nuv!`:FBH*6HÖk&n"UDk>HǞkn"aևQ"`L` GalJgH<fZxCiff4)C k2BCHUDk0BAҀQ8. NuHxCSDt =QaL`a3a a a a FBH*&k趙nUDk.k־n"a2ևQ"` GaJgV<fxCift4)C kJ^f2BCHUDkJ^fx0BAҀQ8. NuHxCSDt -QaL` GJf.4-4/ x$Nr6ASAHDJDfHD0BkR@Q/ pgaC2 AA ?H؁a222"8B2HR2 UAk0B22R@Q2prHASCd2`"Qd&_Nu2 4BSAA M BC p0 !Q&_ GJfb4-4/ H/~$Nz6ESE"kJRaQ( pga C2 AA?H؁a222FY"."R: UEk"""Ra\Q(*`0 Ga<f()aB`,a!_HNu,a!]HNuWHNuVHNu,a!h\HNu,a!\^HNu,<@Jj<ah Nuai 0GgDNu H@GA6a G@VGa GUU|vGaL`(*`A"aJvg mvNJga`A a"a"JUgAar2aNuSe<dAaAJgJfS`LIBRARYSTARTUPOPENPEEK/POKEBLOAD/SAVESOUNDLOCATEINKEY$GEMDOSDIMARRAYBLITREDIMCVsMID$==MID$RIGHT$ASCINSTRPALETTEMALLOCMENUSCREENSQRTWINDOWJOYSTICKTIMEDATEMOUSELOG Y8 Runtime error at line in module on #A+HvNuA g<PdJfSfNuRETURN without GOSUBOut of DATAIllegal function callArithmetic overflowOut of memorySubscript out of rangeRedimensioned arrayDivision by zeroType mismatchString formula too complexRESUME without errorLine buffer overflowWrong number of dimensionsFIELD overflowInternal errorBad channel numberFile not foundBad file modeDevice I/O errorDisk fullInput past endBad record numberBad file nameToo many filesDevice unavailableDisk write protectedPath/file access errorPath not foundBREAK pressedFatal bus errorFatal address errorApa+@0Apa+@(Apa+@,NuaHm|9|rPJ-6fr(A|a>ra(rwa"Q"B,#`H Lpa#L (IL)HNu l p` &_|dVA``&FLLn0kN0SN0kNp*JgHP0SNL fS`NuzpgH P0SNL f < gR`"NupJgH P0kNL fS``<daTa@pNupDNu`aHz<d̰<g a"Ra`-5f -5fNuH?<?<NMXJ@gN/<NMX-5g<g,-5g*<f$/<NMX<g-5g<faM+@LNuJ,"gHrazrfatLNuHradrf,"aZLJNu<dA`HL.6H>HHHHd Q"aapNuP"pNuQ"pNur,#pNupDNuB,B,#rarE`pNu|dp,@dAB#A B H`rarYaL8a`/ Jikrarba"W2)a2A av"WJikrahrcab"_2)aA `RXpNuAAJ-6g -6gA0Nu    H @rareaLx*&I/ at&_< gT< gN<g <g< eںgHR/ a|&_`JgSJ,gS,/ rar ara&_`r ar a"p@Nu?,?<NMX<f lf -5frpNu?r aFr ax2< gp< g4R,,g,e lf< d<g<d<dp`0,<f< f ,#dR,#A???<NM\Jlg pNuB,`Rgp9Nu0,??<NMXrJfrpNuSgSgUg|SgpDNu&fvRBg/?<=NAJkb8>N?|NAJfPP0(<(؃Aa:)mV)C)C$)C |||9@p)@@)@NuPH`t9+@8lAgf LNuF5LCKKBg/?<NAXapNu`8,<d$ gA @N.T@(eа|dA``tp<gJf",gaBf atrpNur)ApNuHl(/, ??<?NAO Jk)@gB$Nup>Nua ,$e agp>)@NuA(r0R<gR$pNua",g$S)AS$dBg?/?<BNAO JkavpNua|pDNuat?(,$gA($e(٬a8)l$Jg$/ /??<?NA"/O Jk$ѬfLpNua$< g4< g2R,,g(,d"B O | ApB,aXNuB,I? OpaTNuJg&//??<@NA$/O "Jkpgp=Nup"Nua  IJ,f6,Sev H x ggRQdAL0`r`Jg, I,< g< gReSf C`Zv`SH @vapAaBLgNu fXp6Nufp6XNuaB$BSt QdBg?/?<BNA"/O f Hl(/,??<?NAO Jkgr)ApNuaB$Bg?/?<BNA"/O Jl |fZ/?<?B?<BNAO "Jk@g(*HEJEgpH@ @ajf(SE`HE  |aVf ,B$A(aDfNu` f$Jj", R $,Ga"GA( ,NuXp6Nu?<?B?<BNAO /?<?B?<BNAO "&Bg?/?<BNAff$, `$/`$,"O pNua Tp6Nu< g,< gR,,g,e&,$d 8(R$pNuB,`?r ar a2`p2Nu",pNuPRT:AUX:MID:KBD:LST:H@b0HCAag (IpLNuLp4Nu8<0DaQNuH@af Hp0a L LJNu lN -f ?a6 Va<"0 I0af ^`v`. naSfXv<Igv<Ogv<Rgv<Af2HCt4>.ab6 Va"0HC Iaf ^aߚT ^`ߒa6v`a.paf fpra`0|aSH0fNuJGo |d0GNu0Gp4`>;m.$Nua;G$Nu;|$Nu GaL$0m$pa G`p0m$aHA86HBrBDHAJAgHAJCgAcVB8SDpr aQNuJGo8SD0m$`JGkg.p0m$ajgJBgHGJGgHBRBBdBSGHzCt0m$p`6 m ,gx m`fa;G$Nu+W+G m;m.$arJg 0m$p$aC$<0m$paA, +HNu"m , If(xR<,g< fS+HJg fSfNuafaFiJf>0BfNuafa&iJf.Nuafai.JfNuaxfa؈`x"m ,fv< g8<"g< gAR<,g< f` I<"g < gR`RJg 0 HfSf/S+Ia. _``C&t p0m$a^C!tp0m$aN.`?Overflow ?Redo from start C/ xR  fa . _a m`ܞ&<a\/ a. _`&<aFai 0Bf>NuDNu&<a(ai.Nu&<aai.Nu&<a`NJf(<a+HaVf< g$m$jxg<"fva2f< g`< gL<@d  efR|gJag`*0m$p`*<gJfaf< g< g<,f( "m"iNuaƲ< gah`aafz m f(<a+H$hx< gRD|ga|g` at< gaaaߤ. m h`|0m$p+` -gB`&x?<?<NMXJ@f xah.Nu/<NMXJ@g$-5g <faM?xa:.0NuxH@?a(.0BNug./ m fAN _`??<?<NM\Nu/<NMXNuCDjDG@AB|Ab DSGkUĆQ(k(j2xc 0D@`fc 0D@`D@@`D@@ԆӅdf UĆR@(fJk0<NuJkJkxAS@J[NuJkV`a8 g0HGOGG,H@O@@HGBG p̀Nu|Nuއg HGNu gV H@H@@mH|lFJj@H@VHFNFr FJgdH@Ri H@.<H@Nu~NuDNut"g pJk S@ҁ`0<vNuMC68341 FLOATING POINT FIRMWARE (C) COPYRIGHT 1981 BY MOTOROLA INC.,GgT klknf`@,k^g>k^g2k8<d,&B<ރeNuRid~S<Nu.NuJNu<oD&B<ރeNukgvgPk<<d&B꫞kBSbHGއ[kgNu~Nu<oD&.<`DgjD`k gBAkjDNu<Nu~NuBkjDDNufDJjNuHz_Jg0jzDi&SbHGއ[Jj dRNuJj Jjf NufNuMC68343 FLOATING POINT FIRMWARE (C) COPYRIGHT 1981 BY MOTOROLA INC.rtvx2(4(6(8( |o864BA@`J@gHCv6BBHANuH0)hlH0)h|?ovx`J@ga`LL*jfcCD@` ԄӃdR@HLNuJfJgJk S@jHNu0<5@NuJfJg JfJfBBB|XONua/ 04R0(iR@5@&Oz////zL81P֣7CBCSHCԃ6BBHB҂ң7ABAQHAЁ'@\KUEjLJkSjjH&_NuaL/04R0(i5@LL xzJk SjjJk Rjj|?Eg҃тQJk SjjH0,NuB\$G_SYS_ED - ASSIGN.SYS Editor by Kevin Millican ============================================== Imagine this - you've just managed to get a GDOS configuration finally sorted out with all the fonts you'll ever need and suddenly you find that you've insufficient memory or that you can't be bothered waiting for your application to load all those fonts just to knock out a simple letter. Familiar Problem ? Put G_SYS_ED in your \AUTO folder BEFORE copying GDOS.PRG into it and make sure all font names conform to the following ATARI standard :- * * * * # # @ @ . F N T where **** is the font name ## is the font point size and @@ is the device, e.g. HI - For HIRES fonts CG - For MEDRES fonts EP - For EPSON printer fonts MF - For META fonts etc. If you need to change any font names don't forget to alter them in your ASSIGN.SYS file. Also make sure that all sizes of the same font have the same first 4 characters. When you boot the computer you will be presented with a screen showing all the available fonts. Move around the fonts with the cursor keys and toggle them on or off with the spacebar. When satisfied press and follow the prompts. The program works by inserting a ";" in front of the unwanted fonts thereby causing GDOS to interpret the font as a REMark. THIS PROGRAM IS IN THE PUBLIC DOMAIN - ENJOY ! .  S..  SQUICKCADDOC S MLOCUST_CQUI S ,LOCUST_MQUI S 4SHUTTLE QUI S <SHUTTLELQUI S BST_C QUI S HST_M QUI S KQUICKPLTBSC S N; QUICKCADACC S QbqQ_CONFIGPRG ׁS KWELD_M QUI ܁S  ****************************************** * QuickCAD v1.08 * * An Object Orientated Drawing Accessory * * (c)K Millican 1988,1989,1990,1991 * ****************************************** 1.0 Specification 1.1 An object orientated drawing accessory with import of DEGAS pictures and export of DEGAS & GEM "*.IMG" bit image files and support for Kyocera Laser and Epson-compatible 9 pin dot matrix printers. 2.0 Overview 2.1 QuickCAD is an object orientated drawing package that produces compact diagrams in its own format or PRESCRIBE page description language. 2.2 QuickCAD v1.08 is a desk accessory written in FAST BASIC and tested on 520STFM (TOS 1.0,1.2), 1040STFM (TOS 1.2), and a 520STFM with 1 meg upgrade (TOS 1.0,1.4). I am also told that it runs on an STE (TOS 1.6) but I haven't tried it personally. The program is designed for a mono monitor although I have recently adapted it for use in medium resolution. It will also work with most mono emulators. 2.3 The utility uses a system peeks for the mouse coordinates and buttons (response in mouse reading is the one problem area with FAST BASIC which I still prefer to Hisoft/Power BASIC) and senses whether the host computer is TOS 1.0, 1.2, or 1.4 at startup. It is therefore possible that it may fail with newer versions of TOS as and when Atari stun us all with the next compatibility problem (read TOS upgrade). Anyone who has problems should note that I have enclosed a fourth set of mouse addresses within the code which will be used provided the default TOS versions don't work. These addresses can be changed using a disk or file editor OR simply by running the configuration program - "Q_CONFIG.PRG". If you choose the latter course, run the mouse address location routine a couple of times to check that the values are consistent before selecting the option to configure QuickCAD (with the consistent values displayed on screen). All other program operations are entirely legal so if it can't be made to run on a machine then Computer Concepts or Atari are to blame. 2.4 I have included the FAST BASIC source code for the load and plot routines should you wish to use QuickCAD digrams in your own programs. The routine is quite short and I don't imagine it would be that difficult to convert for GFA Basic or Hisoft Basic, although I haven't tried it yet. 3.0 Startup 3.1 Merely copy QUICKCAD.ACC onto your boot disc and reset the computer. Owners of 520ST's should be careful to ensure that there are not too many other accessories eating into the precious RAM. 3.2 Select QuickCAD from the GEM Desk Menu as with other accessories. 4.0 Operation - General Guidelines 4.1 When you start QuickCAD you will be greeted with dotted crossed lines showing the mouse position. Normally you will want a clean drawing page so select ERASE or REPLOT from the main menu. 4.2 The mouse buttons have three functions :- Left EXECUTE Right CANCEL/QUIT FUNCTION Both Main Menu To avoid problems with drawing unwanted lines there is a special mouse technique which needs to be learnt when selecting both mouse buttons to pull up the main menu; press the right mouse button and while still holding down the right button, tap the left button. Once learnt this is a very quick & handy way of recalling the main menu. If you find this difficult the CLR HOME key also performs the same function (provided the right mouse button is used first if a function is in use). 4.3 Menu items can be selected with either mouse button but I tend to prefer tapping the right button to avoid starting the selected function. Clicking outside the menu returns you to the default function, i.e. rubber banding of lines. 5.0 Operation - Specific Functions 5.1 Rubber Banding is the default drawing tool. To begin press EXECUTE. To fix a line press EXECUTE. The rubber banding continues from the last fixed point until you press the CANCEL mouse button. If the SNAP function is not activated continuous drawing can be achieved by holding down EXECUTE while moving the mouse after fixing at least one line. While in default mode (and when not rubber banding) text can be entered merely by typing from the keyboard. The left and right arrows switch the direction of the text and the BACKSPACE key deletes one character back at a time. Pressing RETURN or EXECUTE fixes the text, CANCEL aborts and the mouse can still be used for accurate positioning. The text size and style can be altered using the OPTIONS menu. 5.2 Boxes and filled blocks are selected from the main menu; the left mouse button selects a box outline and the right a filled block. The box is drawn in transparent mode (useful for outlining text) and the block in replace mode (not strictly compatible with PRESCRIBE but more useful for general use - I find the advantages outweigh the disadvantages) Press EXECUTE to fix one corner and press it again to fix any other corner. CANCEL quits and returns you to the default mode (rubber banding). 5.3 Circles are selected from the main menu. Press EXECUTE to fix the circle centre and again to fix a point on the radius. CANCEL quits. 5.4 Arcs are noted for being difficult to define in most ST drawing packages. In QuickCAD the arc drawing mode is selected from the main menu. Pressing EXECUTE fixes one extremity of the arc; a small circle marks the spot. Pressing EXECUTE a second time fixes the other extremity (partially) anticlockwise from the first and rubber bands an arc about a centre defined by the current mouse position keeping the first point fixed and the second in correct angular position. Pressing BACKSPACE on the keyboard switches the first and second points. Pressing EXECUTE fixes the arc, CANCEL exits. This all sounds very complicated, but when you experiment you will find the function much easier to use than most drawing packages with a bit of practice. 5.5 Painting is performed by selecting this option from the main menu. Pressing the up and down arrow keys on the keyboard changes the size of the brush. EXECUTE paints and CANCEL exits the function. If snap is selected you cannot paint continuously. The paint pattern used on the screen can be selected from the PATTERN menu ; the pattern used by the PRESCRIBE created by the program is an 8 bit estimate of the 16 bit screen raster. These patterns are a worse estimate if you are operating in med-res but are still quite pleasant. 5.6 Patterns are selected from the pattern menu. 5.7 Area Fill is selected from the main menu. The current fill pattern is used. EXECUTE flood fills the selected area; CANCEL quits the function. This feature is not supported by the Kyocera Laser Printer; to fill areas when using PRESCRIBE use the paint function (its tedious but effective). 5.8 Moving Objects is accomplished by selecting the MOVE function. The area to be moved is defined by a rubber banded box. All points within the box that are used to define a shape are moved. To move a circle its centre must be enclosed. To move an arc both start and finish points must be enclosed. This is handy to move an object which is connected to another by lines or boxes. If the up and down arrows on the keyboard are used the size of the moved object is changed proportionate to the defined area. 5.9 Copying Objects is performed by selecting the COPY function. Only objects that are completely within the defined area are moved. For circles the active point is the centre. For arcs both ends must be enclosed. Size changes and usage is similar to the MOVE function. 5.10 Scaling also allows the user to copy an area but a new area also has to be defined. This allows disproportionate copying to be achieved. It may cause problems with the fit of arcs and circles however. 5.11 Editing allows the user to delete objects from the diagram. When this option is selected, the user can step back and forward through the diagram using the up and down cursor keys. To delete an object step forward so that the object is the last thing drawn; then press delete. If you continue to press delete previous objects will also be deleted. When you have finished the deletions press return. There is a short period of garbage collection and then the diagram is redrawn returning you to the default mode. It is best to imagine this facility as an incredibly versatile UNDO utility. Note that when stepping across a fill command a message appears rather than the action being performed; this saves time and a lot of RAM ! 5.12 The other menu items are fairly self explanatory with the exception of the DUMP command. If the orientation in the PARAMETERS menu is set to Portrait, a 240 x 216 dpi image is produced. If it is set to Landscape, a proportional 72 x 72 dpi sideways dump is produced. The built-in dumps only work in high res, but if you want a standard ST dump press the spacebar when in default mode and then press ALT-HELP (making sure you've remembered to set up the printer using the control panel accessory !). All the printer dumps are intended for the EPSON FX and compatibles (i.e. most 9 pin dot matrix printers). This dodge also gives access to a host of screen grab utilities due to the clean screen approach of QuickCAD. 5.13 If you press HELP on the main drawing screen an alert box appears showing the system statistics. I'd be surprised if you were able to exhaust the number of points available but no doubt someone will do it ! The QuickCAD system memory is not that relevant; it shouldn't ever fall below about 5K. 5.14 The OPTIONS menu allows you to select the PRESCRIBE parameters and the screen text size and style. To change the numerical values click on the number box and enter a new value - you can't exceed the built-in limits. 6.0 Creating PRESCRIBE files 6.1 Selecting MAKETEXT from the main menu creates the PRESCRIBE text in either Portrait or Landscape orientation depending on that selected in the OPTIONS menu. The ASCII may be written to a disk file, a printer, drawn to the screen, or sent down the RS232 port. 6.2 Those of you lucky enough to have access to a Kyocera Laser at work will be pleased to know that the companion program TOS_DOS.TOS will convert a standard Atari formatted disk so that it can be read by an IBM 3.5" disk drive without affecting the data contained therein. NB This works very well with either single or double sided standard disks but is unlikely to be successful with special extended formats. If in doubt, only use on a backup disk. Also note that if you write to a single sided disk using the ST you will have to use TOS_DOS.TOS again before using the disk in an IBM drive. I must admit to not being able to find a disk format that was unreadable on the ST after using the utility but I must obviously disclaim any responsibility for problems that could arise - use at your own risk ! Users of TOS 1.4 or 1.6 won't find much use for this utility unless they wish to convert other people's disks. 7.0 Special Notes 7.1 QuickCAD is the sole property of the author, Kevin Millican. It is FREEWARE and may be freely copied but it may not be sold, distributed on a commercial magazine cover disk (except the ST Clubs 'ST Applications') or modified without my written permission - all rights are reserved. 7.2 The FAST BASIC source code for the load & plot routines only is public domain and may be freely copied, modified, or converted to other programming languages and included in public domain or commercial programs with the sole restriction that the file extension '.QUI' is maintained. 8.0 Hints & Tips 8.1 Diagrams can be exported to any application that uses the GEM IMG format. If you save a diagram with the extension '.IMG' you are able to select any area on the screen (or the whole screen) by outlining the area in a similar manner to the BOX drawing facility. This is only implemented in high res. Using QuickCAD as an accessory can therefore be useful in programs that import IMG files e.g. 1st Word Plus, WordUp, Superbase, Calamus (I know - who has more than 1 Meg anyway ?), etc. The accessory appears to work fine with everything I tried except WordUp and Hyperdraw; everything seems to be OK but there is a problem when exiting QuickCAD in that all GDOS fonts are lost. I don't know enough about GDOS to solve this but if anyone out there does, please let me know and if it can be fixed I will issue a new version to the PD libraries. 8.2 Some public domain art programs actually allow QuickCAD to be used as an additional set of tools, e.g. Megablit, Public Painter, Masterpaint. This can be quite useful for programs that do not have a good SNAP function or arc drawing capability. The trick is to to use one of the host art program tools to draw on the screen immediately after exiting QuickCAD before moving window sliders or using other functions that cause the host to redraw the screen. 8.3 The diagrams produced by QuickCAD can also be easily exported to bit image graphics programs by renaming the file extender to ".PI3" (or ".PI2" in medium res) on saving. This saves the file in DEGAS format. 8.4 DEGAS ".PI3" (or ".PI2" in medium res) files can be loaded into QuickCAD although there is obviously no way of creating an object file from a Bit Image. I added this feature so that I could import DEGAS clipart pictures and save the relevant areas in GEM ".IMG" format for use in WordUp and Calamus. QuickCAD supports different load and save paths and so this operation is very easy to perform. The blank fill pattern can be used with the PAINT function as a very effective eraser for removal of unwanted areas. If REDRAW is used (or the MOVE ,COPY, & SCALE functions) the Degas picture is erased but the QuickCAD picture is retained - useful for creating QuickCAD images of bit image pictures. 8.5 When drawing small objects draw them larger than you need and then MOVE them and reduce them to the required size. 8.6 Try to use the snap option for most drawing; this makes picking up previous line ends etc. that much easier. 8.7 You will find that some application programs get their text alignment messed up by QuickCAD. All the programs I have tried require one of two different alignments or are not bothered either way. The two exit alignments are achieved depending on which mouse button you use to click on QUIT from the QuickCAD main menu; if you get problems re-enter QuickCAD and exit with the other button. 8.8 I haven't found any bugs with the exception of the GDOS problem. One problem that can occur however, is deleting a boundary between two filled areas - the second fill then attempts to fill the first filled area which can take ages to complete ! If you are doing anything more than a small amount of deletion it is best to save the picture first or delete all the fills and do them again at the end. 8.9 I haven't disabled the program from working in low-res, although it doesn't directly support this mode. It doesn't work too bad if you use the BIGSCREEN emulator (available from the ST Club). 8.10 QuickCAD, as indicated above, allows editing of large picture files if you use the BIGSCREEN emulator, although it is a bit slow if you use other than the default double height screen. Authors Note: I hope you enjoy using QuickCAD - please pass a copy to a friend. QuickCAD was developed originally for creating PRESCRIBE picture files for printing macro-hardness diagrams when I used to manage a mechanical test laboratory. It was later developed further when I joined a large fabricator, SLP Engineering, as their Welding Engineer for drawing the weld run details in a Weld Procedure/ Welder Qualification database dubbed WIMS. QuickCAD has been used on a daily basis for about 2 years as a support to this application; dump out the WELD.QUI drawing for an example at 240 x 216 dpi. Any Welding Engineers out there who are interested in the WIMS system please contact me for further information. WIMS (and QuickCAD) has already been successfully used on the following projects :- Shell - Leman Inde B,C,J, & K Accommodation Refurbishment Arco - Thames/Welland Development BP - Miller Accomodation Module Laings - Sizewell B Embedments Shell - Sole Pit Project BP - Bruce Accomodation Module Amerada Hess - Scott Field Development Kevin Millican 0493 782176 (Evenings) ---------------------------------------------------------------------- 1262 0 iZlQlQtOtO|M|MKKLLOOQQUU``eemKIIHHFFFFFFFFFFFFFFGGHHJJMMOOQQSSZZ]]ddiikknnqqqqrrrrqqoolJ8Kidd^^$T$TCGCG\=\=h7h7r0r0|*|*(())**--..--..2277<<xDxDjNjN\Z\ZPePe>t>t1111//++(()|)|7r7r_Q_QrBrB|:|:}9}977667744110,++++{,{,x0x0w2w2q8q8k<k<e?e?TETE7Q7Q![![__ee ij=WMWMHYHY6f6f&n&ntwF{D{D~C~CDDGGJJKKxLxLnL}A>>998899;;>>BBDDGGHHHD@@>>==>>>>>DFFGGHHJJKKLzLKKMMPP'R'R4V4V;Z;Z?_?_?i?i?o?o:r:r0w0wyyyyyywwGl^]]\\XXX]dTRRQQLLJJJJJJKKMMMMOOOOQQddffjjTTRRUUTTSf[~_xZxZwWwWwTwTzQzQ~Q~QQQUUXX\\^^~_~U}W}W~W~W~UiZi`i`ididliliononoqoqrsrsststzyzy|{|{||}wZu]u]sasaueuexixizkzk|m|m~h~h}d}d|`|`z]z]xZu\8K8K>Li]4Z4Z@[|mumumpo|mzqzqwwyzrtuzyv}mpprrssttvvxxyy||~~~~||||zz||~~}yyuuuuxx~~{{wwuussqqww~~}qmmkkkkllppsswwxjddaa___kffeeffd~ryyyyyyvvttttvvxxyy{vz~zzvvrrtsxxzz}}~~xxvvuurrrrqqrrvvxxzyuwwxxnnmmkk m m n n o oqq r ryyy]]\\cciillv^p`mq((,,jj jzw{{||}}}} | |v |uww v vu)<<@@<<::<<<<,=FFMMRRUUU>FFMMNNO1==UUUUqqpp||v9yU|U|V|V|o}o}~~~~~~vYmVrVrV{V{Wpooxoxo}o}pryy~~s~~tu|~(((**++0055AAIIMMCCGG==>>==)HOOUUUUZKQQXXZRTTSSPP4M`XLRdyfyfiinnppqqqqqq/o/o>l>l>kS[T^zWWWQ]\````^^Sbeeffffffbb"V0Xi._k8b m<gmmf?bkk&n^gg-j!\#d#d5f(X+`+`<b0U2Z2ZF\9R:X:XIX@OBTBTNUHKHPHPRQMHOLOLXLTFUIUI]IYDZFZF`E}U|U|U|X|X~X~X~Y~YVVUU~T~T~V~V~W~W|X|X{U{U|U|U~Wx,t,t<k<kL^L^fGfGfFfFv<v<8hOhQeSeU`UaX\Z]\Z\Z^W^W`U`UdQdQeNgMjLjLmLmLlHkIoIoIoDnDpArAs=t>v:x:x8z8|5|5~ZxZzZz\z\zYxszs{s{u|u|sz{||||||||}}|im8JBMBMBMBM8K4Z4[4[<[<[<Z<Z4Ztt||=C(u+{QSSSSSSSSRRPPOOOOOONN7KOPPSSSSSSR2 rT2 mc2 yu& tp& z. wc$ c" r" " p" " " ~. S. K& S& U& NC  Q" Z! o! |! k! i! ! i! x! e" |" t" }" u" ~$ c=$ ~=$ ;$ J$ *" i" e" b" &^" .Z" 5V" EO" JL" QI" WF" [H" WK" QO" KR" FV" B[" :^" 1c" *g" #k" o$ t% ~2% C% oS" 6" 5" H$*! $z! -u! I! Jq! M~! bs! c! wu! {! x! ! x! ! z! ! w! ! {8 ZC mC Z" =R }13 1259 0 iVlHlHtDtD|A|A??@@EEHHMM^^ggr?;;99777766666666668899==AAEEGGKKUUZZddmmppttxxyyzz{{yyuuq=8>mee\\$L$LC8C8\)\)hhrr| |         ''x4x4jCjC\U\UPfPf>}>}1111//++(())7z7z_G_Gr1r1|$|$}#}#    {{xxwwq!q!k'k'e,e,T5T57H7H!W!W]]ff mj(WBWBHTHT6h6h&t&t}w6{3{3~2~24488<<??x@x@n@}/**##!!##&&++1144889994--**))****+3778899<<>>@z@??BBFF'I'I4O4O;U;U?]?]?l?l?v?v:{:{00Gq[ZZXXRRRZdLIIGG@@==<<==??AABBDDEEHHeehhnnLLIIMMLLKhW~]xVxVwQwQwLwLzHzH~G~GHHMMRRXX[[~]~N}P}P~P~P~NiVi^i^ieielmlmototoxoxr|r|s~s~zz||wUuZuZs`s`ugugxmxmzpzp|r|r~k~k}d}d|^|^zZzZxUuY8>8>>@iZ4V4V@W|sururpv|rzyzyzztz}rwwzz||~~zz||{{wwuussqqww~~qmmkkkkllppsswwxjddaa___kffeeffdz}}~~{{~|{{{{yyzzttssoo r r t t v vxx z zZZYYccllqq[w^sx((,,nn n     )<<@@<<::<<<<,=FFMMRRUUU>FFMMNNO1==UUUUqqpp9UUVVooYsV{V{VVWpuoooopz|~(((**++0055AAIIMMCCGG==>>==)HOOUUUUZKQQXXZILLJJFF4B`S@Rdyhyhmmttwwxxxxxx/u/u>q>q>pJWL\zQQQH]X^^^^[[Kbgghhhhhhbb"O0Rl.]o8b r<irsf,bpp&t\jj-n!X#d#d5h(S+_+_<a0M2V2VFX9I:R:RIR@DBLBLNMH?HFHFRGM:O@O@X@T6U;U;];Y4Z7Z7`5}M|N|N|R|R~S~S~T~TOOMM~L~L~O~O~Q~Q|R|R{N{N|N|N~Q,},}<p<pL[L[f8f8f7f7v'v'!hEhHeJeN`NaR\U]XZXZ\W\W_U_UdQdQgNiMnLnLrLrLqHpIuIuIvDtDwAzA|=}>::8855ZZZ\\Ysssuusms8=BABABBBB8>4V4W4W<W<W<V<V4V}}=C(+GKKKKJJJJIIFFEEDDDDCC7?EFFJJKKJJI2 rL2 mc2 y& tw& . wc$ c" {" " p" " " . K. ?& J& N& CC  G" V! u! ! o! m! ! m! ! f" " ~" " " $ c($ ~)$ %$ <$  " l" g" a" &\" .V" 5O" EE" J@" Q;" W7" [9" W>" QD" KI" FO" BW" :[" 1c" *j" #o" v$ ~% ~% 2% oK" 6" 5" H$*! $! -! ;! Jx! M! b|! c! w! {! ! ! ! ! ! ! ! ! 8 VC r13 1008 33 3<?BEGu|r2;F8a`>x  [xp =SUY>l[_. .  !:=@DE!G$G&H*I*K,M-O- ,<ADI.''.."."')',."..-,$1"4&.- + +#  +" "   "E@BFDZSU]Y~LOQ  :EIHM&6=#- 5,GII       %(32:<>DCI3  WCk N! " #f }Yv M" k #2 eG+k$63@   LuzLORrB = Fiefcpl}qknr|loun   =qrr|}     ~Q ]>0G3EBNA[=B5I7  M a2B>NY=_dihgh-T7Q@P[>X?PIMTQW O&V]WB:G5D?GCJCGFGLLTT\\cckjsrzz~~EFOPY[dforzDDCB X     N NP.+y  3m     j  e h""--44lp{oott}}wwqqmnsnytz  % %,(-305;8>DBKQFMKB;_c& s" 8" 8@" .N" 1V" q" " 1" O" [" n" s" " |" " e" g " " " " "  " " " " " " " " " " " " " "" +" ?" D" i" ^" b$ }$ $ $ $ $ $ $ v$ z$ ~$ $ $  $ $ $ $ " " % % % %     % " " " >" :" L" o" " " " " " " " " " " " " " " " " " " " " " " " " " " " " ( (  %( ,( &*( 0'& C& W& O& M& U& P( ( ( ( ( ( ! .!  ! wQuickCAD v1.05BY KEVIN MILLICAN4 878 0 3<?BEGu|r2;F8a`>x  [xp =SUY>l[_. .  !:=@DE!G$G&H*I*K,M-O- ,<ADI.''.."."')',."..-,$1"4&.- + +#  +" "   "E@BFDZSU]Y~LOQ  :EIHM&6=#- 5,GII       %(32:<>DCI3  WCk N! " #f }Yv M" k #2 eG+k$63@   LuzLORrB = Fiefcpl}qknr|loun   =qrr|}     ~Q ]>0G3EBNA[=B5I7  M a2B>NY=_dihgh-T7Q@P[>X?PIMTQW O&V]WB:G5D?GCJCGFGLLTT\\cckjsrzz~~EFOPY[dforzDDCB X     N NP.+y  3m     j  e h""--44lp{oott}}wwqqmnsnytz  % %,(-305;8>DBKQFMKB;_crvqr26 355 143 qwqwqwqwqwqwqwqwqwqw"q,w1q;w@qJwOqYw^qmwzzzzzzzz zz"'z16z@czmEzOcmTTz^z^JJT ',6;E "'16@ET;J6qwqwqwzzzqwzwzzzwwqwqwj``jj``jj``jj%`;`%j;jQ`g`Qjgj}`}``jgjjWj&W&M^^Z``ZZd`dgdegA ,  *9!H#u%u'u)u+u-u/u1u3u5%u74u9Cu;Ru=?ACEGIKM O/Q>SUWY[]_a ce*g9ifkumuouqusuwy{}ATARI1040STQWERTYUIOP[]1234567890-=`ASDFGHJKL;'\ZXCVBNM,./#()/*789-456+1230.4 355 143 s}s}s}s}s}s}s}s}s}s}"s,}1s;}@sJ}OsY}^sm} "'16@cmEOcmTT^^JJT ',6;E "'16@ET;J6s}s}s}s}wwws}s}iZZiiZZiiZZii%Z;Z%i;iQZgZQigi}Z}ZZigiiKiK<WWPZZPP_Z_d_bdA    *9!H#z%z'z)z+z-z/z1z3z5%z74z9Cz;Rz=?ACEGIKM O/Q>SUWY[]_a ce*g9ifkzmzozqzsuwy{}ATARI1040STQWERTYUIOP[]1234567890-=`ASDFGHJKL;'\ZXCVBNM,./#()/*789-456+1230.4 REM ********************************* REM * QuickCAD Load & Plot Routines * REM * By K Millican - February 1990 * REM ********************************* REM *** SET UP MAX NO OF POINTS AND TEXT BUFFER SIZE *** maxpoints%=4000:maxtext%=5000 RESERVE codes%,6*maxpoints% RESERVE texts%,maxtext% PROCload("SHUTTLE.QUI") g=GET END DEF PROCload(myfile$) IF SCREENMODE=2 THEN yres%=1 ELSE yres%=2 han=OPENIN myfile$ IF han<0 THEN alrt%=ALERT("[3][ | | Can't find "+myfile$+" ][WHOOPS !]",1):CLOSE#han:ENDPROC IF INSTR(myfile$,".QUI")<1 THEN alrt%=ALERT("[3][Not a valid picture type][SORRY]",1):ENDPROC INPUT# han,no% INPUT# han,no_of_textbytes% GETBYTES# han,6*(no%+1),codes% GETBYTES# han,no_of_textbytes%,texts% IF EOF#han=FALSE THEN INPUT#han,gtsize$:gtsize%=VAL(gtsize$) CLOSE#han IF gtsize%=0 THEN gtsize%=13 textptr%=texts%+no_of_textbytes% oldno%=no% PROCreplot ENDPROC DEF PROCinterp(n%) GTXTSIZE gtsize% ofset%=codes%+n%*6 func%={ofset%}& AND $FF IF func%=0 THEN ENDPROC done=TRUE X%={ofset%+2}&:Y%={ofset%+4}& SWITCH func% CASE 1 LINE {ofset%-4}&,{ofset%-2}& TO X%,Y% CASE 2 GTXTALIGN 0,0:GTXT {ofset%-4}&,{ofset%-2}&,FNgettext CASE 3 GTXTALIGN 0,2:GTXT {ofset%-4}&,{ofset%-2}&,FNgettext CASE 4 ELLARC {ofset%-4}&,{ofset%-2}&,X%,X% DIV yres%,0,3600 CASE 5 ELLARC {ofset%-10}&,{ofset%-8}&,{ofset%-4}&,{ofset%-4}& DIV yres%,X%,Y% CASE 6 pat1%={ofset%-6}|:pat2%={ofset%}| IF pat1%=0 AND pat2%<>99 THEN BAR {ofset%-4}&,{ofset%-2}&,X%,Y% ELSE IF pat2%=99 THEN pat2%=0 FILLSTYLE pat1%,pat2%:GRAFMODE 1 RECT {ofset%-4}&,{ofset%-2}&,X%,Y% GRAFMODE 2:FILLSTYLE 0,0:IF pat2%=99 THEN pat2%=0 ENDIF CASE 7 pat1%={ofset%-4}&:pat2%={ofset%-2}& FILLSTYLE pat1%,pat2% IF pat1%=0 THEN GRAFMODE 1 FILLPERIM 0:ELLPIE X%,Y%,{ofset%}& DIV 256,{ofset%}& DIV(256*yres%),0,3600:FILLSTYLE 0,0:FILLPERIM 1 GRAFMODE 2 CASE 8 pat1%=X%:pat2%=Y% IF editmode THEN GRAB 0,0,scrwid%,scrhgt% PRINTTAB(1,1)"PATTERN :- "STR$X%","STR$Y% WAITTIMER 400 PUT 0,0,3 ENDIF CASE 9 IF editmode THEN GRAB 0,0,scrwid%,scrhgt% CIRCLE X%,Y%,2 PRINTTAB(1,1)"FLOOD FILL @ "STR$X%","STR$Y% WAITTIMER 400 PUT 0,0,3 ELSE t%={ofset%}& DIV 256 IF t%<>0 THEN pat1%=1+(t% DIV 32):pat2%=t% MOD 32 FILLSTYLE pat1%,pat2%:FILL X%,Y%,1:FILLSTYLE 0,0 ENDIF ENDSWITCH GTXTSIZE 13 ENDPROC DEF PROCdrawmode GRAFMODE 2:LINECOL 1 FILLSTYLE 0,0:FILLPERIM 1 FILLCOL 1:GTXTCOL 1 ENDPROC DEF PROCreplot TXTRECT 0,0,SCREENWIDTH,SCREENHEIGHT GRAFRECT 0,0,SCREENWIDTH,SCREENHEIGHT CLS editmode=FALSE pat1%=2:pat2%=15 PROCdrawmode FOR i%=0 TO no% PROCinterp(i%) NEXT GRAFMODE 3 finmenu=TRUE ENDPROC DEF FNgettext IF {ofset%+2}&>0 THEN gtsize%={ofset%+3}|:GTXTSIZE gtsize% gteff%={ofset%+2}|:GTXTEFFECTS gteff% ENDIF textofset%=texts%+{ofset%+4}& text$={textofset%}$ =text$ `nz2l` kJ QuickCAD v1.08MJy f2*O*m-M - ЭЭ// Bg?<JNAO JkO a0a.A=X=P=| N6Jf`BnBnBNaa p N1JngAV-H=n0<#N1a>"< <NJg-H<-H@aNN/N/a/N.zLNuH0<?N.zLNuB@=@AD-HpNN1Nu0<`0<`H=n =|A-Hp!N1LNuA$ k"X"`Nu=|BnphN1LHH=|p3N1Nu=|A-HpN1NuJngA-HpN1 n(fpaa0. |g |ga>Jnf`&Ab @!@!@C!I!I-I-I"Bh Bh"=h$B,B0B:BNu n,n^A@Rh0<(AQAh AhA@ShAPUhAPhQhAThZh*PhBNuH2IA!2I naL?NuH=@R2IA-p na,L?NuH0.RA pa0.RaLNuI8.L(t@0,$AaNu?:MGdI&K&PPJ4Pg RR`TTR| m.BDCJQgBQ:MG7PRDTT| m8.RL0.Ra0.RAH1NuBngPa=@HA1aJf -nv`H0.aaJf6 nv .r".za28.LGH/3@?<INA\L'v@0.2IK;aa@nRf-nv0.Ra 0.a a .BnNung` Nua>N^JgH?<NNT/?NAXJzfBra .r".z nvNua$Jg?AQ-H=|p4N10NuH@P nv"CXf"(fBLNu=@B.Ad-HCB<.:<PQA-HpZN1JngaJf&=|Aj-Hp4N1 nf`t0.a a8Jfb nv .r".za8.LGH/3@?<INA\L'v@0.2IK;-nv nv0.Ra0.0.Nu=n =|phN1Lnbf=|phN1LHH=|/=|plN1LHLH=n =|piN1NuLaB8.HĈDl4B8.nLDl68Bno0.B8Cnno 2.CnNuaL aaBn=|-LHplN1-n-n=n=|piN1LH0tH$@NVL0tN`,Ha(?A?C26/:/>/ a>?CLNuAnEG0C@n2E6@n6NuvNu=n=| piN1Nuaa=n=| phN1JngJngLL aZJBgdJCg^JgNH@0HB4Ԁ-@ -B -@ -B A-H A-H =| 0<1N.z` BDN0=n=| `ba`H=|=|)HplN1-n-nnnLNuBn=|phN1-n-nLB(C KCJBP@CTAUACCB@axNu=|--n-npdN1=nNunnBn=|--n-nplN1-n-n=npeN1Nu=npfN1=npgN1NuA-H=n=|piN1Nu Output Id?<NATA:Bg/ ?<GNAPJfS\*.BSCBNuAdC0<BAA|mRRQNuLBDN0IAd"<SAf"O /NuNPJ  !z!n!n"1n$NuJng"a$p=@RaAb-H-Ha`J/<?<HNA\Jg-@-@"-A" @@2<CSAf-H @aj></<?<HNA\JgJE%p-@"-A" @@2<CHSAf-H @aXG|(mB@Nu<NuJf.-n-n-n B/<?<HNA\-@-@Nu nJg2< BAfNuI8< H/?<INA\LSDfNuJg/.?<INA\NuH~T.,/?<HNA\JfnB` @ L~NuH?<NNT-@?<NNT|f=|=|=| `2|f=|=|=| `=|@=|=| 0.H=@LNuHA-H -H =| JDjD`D@ASBSCJDjH DDH `H DDH 0<1N.zLNu  02 46@ N f ~   {  "$&,. &%x7'6&H(8*G,.467YIXH@jXZZi\^dfY { k z   j p |   { &Z-H\JgB@BABBJg6 [fRAR@ ]fSA |fRB|g |fPNu|nJAfJ@g|nJf/< ?<HNA\JfpNu-@ n0<r:< n^n:<1A!|1|1EBB BBhRAQ nC0|g 21`0<1|. nn 0< 1| .1n1n,1n1n!n2<F4<1Q"n\ n-H"n\$n [g JfPNuRJfPNu ]g`B%nD-H$n`&nBG [g Jf`` nR ]g$ \g |g`B%n `B<F '`G-H ]f`AR"n#H\A[#HT"n80<a><0<?a>Q"nH0<$i gBAJgPA`3AQ"n$IHB@2<i3@5@Q nh1@D1hL41h$ 1h1hT<1h1hl1h  1h 0<"n a><"n0<?a>Q"n0)bh24<@3AQ"nH0<J f Q n4<2.A0(h@l 6h1CQ nh0<BhQ-n=|pN1B@Nu$I8< n^l8<BEJ g5EDQ3ENuBB$I2BC&i gBDJgPD`Dn6Q5CQNu-------------------- Desk Jg/.?<INA\A-HBnpN1B@Nu` 0 00}    0 @ P`p8ppp p0p@pPp`ppp}T ,(<22 2 F m@ d z    $x  $<Z< n00P<%P< D @ @(@8@X@hd@xxd@xd @xd @ @h `  "" Desk File About Runner-------------------- Load Program Run Program-------------- Show Info Dump Output QuitFast BasicRun-Time InterpreterComputer ConceptsProgram execution stoppeddue to:OKProgram InformationCANCELRUNNERFast ST BASICRun-time InterpreterRUNNER bits: Phil MartinInterpreter: Jeremy RustonGavin TheobaldPhil Martinand Nigel, who doesn't like to be mentioned!Version Number: 1.05a/00 Computer Concepts 1986Gaddesden Place, Hemel Hempstead,Herts. HP2 6EX EnglandTelephone: (0442) 63937PROG1 .BSC32___FFFFFFFFFFF99999Name:________.___Kbytes of Workspace :_____XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX_________________________________________________________________________________[3][A loading error has occurred. |you may try again or cancel.][ Cancel | Retry ][3][The file you tried to run|was not in Fast Basic format.][ OK ][3][The file you were trying|to access cannot be found.][ OK ][3][The pathname chosen could|not be found.][ OK ][3][Access not possible.][ OK ][3][Invalid drive letter.][ OK ][3][An error has occured.][ OK ]?p``p?%t%z,%t%% L% d% |% % % % % %!<%!T&"%%%%% % $!)$& "&:"%"&B"&E#&B#&Y#$#%#L'$'%'$'%'$'% &`#&g#&u$ &$$&$<&$T&$l'$'$% ",%<"D%X"\'8% 'Z%<'t%X(4%$(V%@(p%\'%((%D(%`$$aؼ-H/=@JAgp6N1L`LH THHBnp3N1L TH=|Bn-Wp*N1=n-_p2N1=nL THH=|p3N1`(Nu?(|ff6<UT`<If,C$g|<(xaf6SCUT``\<.f"C$gF<(xahf86UT`<Af P6; Ja6.gr)a(F|fr+a`~ApNuDodgy assembler token!BWLSRD--SCYf<` TQDNuDNuhWfd~VBCDDDADDIDDQDDXDDNDINDSLSRTSTTSRHILSCCCSNEEQVCVSPLMIGELTGTLELOHSRACHGCLRSETHKLRMPAMPIMPMMPCRBTBFBHIBLSBCCBCSBNEBEQBVCBVSBPLBMIBGEBLTBGTBLEBLOBHSBRACSIVSIVUORIORVENQUXGXTNCLUDEMPSREAINKSLSROVEAOVEMOVEPOVEQOVEULSULUBCDEGXEGOPOTPTRGRIRESETOLOROXLOXRSTETRTSBCDTOPUBAUBIUBQUBXUBWAPTFHILSCCCSNEEQVCVSPLMIGELTGTLELOHSPRASRAPVRAPSTNLKSPP $Zlqxڏ(9D bB.Bn A$$<2<`=| < gX< gb< gr<"g<$g<%g"`F T`8`b. T`pANux<0fRD`v`0m <n`SHCJCg 0<8a0a 0aHC0a`\0<:a0`vJ.g<ae <zb 0m<n< o < m鋆`SHCJCg0<,a0aHC0a`0<.`0<*a<"g< g2Sgt`<"gSSg`B0gBSgL`pANu0<a0 A$Nu0<  fR@`Sa`r0<  fR@`Sa`ZC ¼<ae <zb )<ae <zb f0HR$LJ.g<ae <zb g` gJ)fa(JS|@g\|BgV|gV|gP|Dgl|RgZ|Tg`|PgZ|FgN|Hgΰ|Jgư|Lg$|Ng2|Vg`|XgZ``"`B@a`rB@aB@aB@aa`XS|cBS0g@BS`8B@aa<0eμ<9c<Ae¼<Zc <_e<zbSg`TfJfJ)f`.B@a|< gSgt`<.f<0m<9n`<9n<0mH`NxS<g><g^L&H@J@g0<a H@aH@a`b0<a0a`PNpL&0<a H@aH@a`*N(&L0<4a H@aH@a`ȼ<AmL<znD<Zo<_m6&L<0m<9o<Am<Zo<_m<zox <|g$x <&gx<%gx<#g x<$gxS (fRD |gf|g|g| g| g0aB@aa`Ja( VDDmSgS`BS8DgBSNuJn f :f0<6aB@aR` fp(aB@A@av`* <fnp&a`RB@A@aP`* <fHp$a:RB@A@a*`* <f"p"aRB@Aa`fUg0NuXpANuDodgy token-K -H *H b-H <k|:o2|Fo`pANur |lr FFaVQ`C`NLbZrpnljhfdb`^\ 0D2*TJTga`2 A<:a`V|<`,r%az0aQ`.8|<`8,r%a`2<0aQzJk Q`0aQ`|<`,r$alzfSEj2<0aT`A;aBQ`0123456789ABCDEFr"a"ga<"fa`r"a2 gjR`d< a Mp&n Nu|<`,C6BC(kBARAj܄SAfJCg0av`JCfr0a`;B@'d H NANLEgaR`HLNANLEga&`r#a`2AAar|a `r2AAAar&a`\2AAAar%a`F2AAAa`6Xga`2 A`C`fga`|@gV|BgP|DgJ|PgD|Rg:|Tg8|Fg0|Hg2|Jg,|Lg|Ng|Vg2|Xg,`T`TTX`Tga6`2 A`X`No entry in DeTokKeyTab!!#(-379>FLSX]kmoqsz-137;?Y_w| &/8@JRWak} ",6:?INimqw !$(+.02579;=?AFKQW_fp     % . 6 ? G O U ] f n s   >    $ + 5 7 = C E J H P X ` h n w { "  CI #,4<D    $ . 7 : G N U h r { 7>   X   # ( - 2 7 < B G L P T Y ] c h m r x %   $ ) 3 : B I@gNuXB@ANu@THENBELSEDGOTOFGOSUBHREMJ\LDATANRESTOREPWHILERSWITCHTCASEVPROCXFNINKEY$INKEY`!b#d(f)hSNDREGjLOGBASEl,nPHYSBASEpHELPr:t;vERRORxERR$zERR|SETMOUSE~RECTSCREENWIDTH?@[]SCREENHEIGHT>ENDUPDATEENDIFENDSWITCH{~CALLCHAINCLEARGRAFRECTCLOSE#DIMENDPROCDEFAULTDEF|ABSENDRUNTXTRECTPRINT#INPUT#PRINTVDU(TIME12$*TIME24$TIMEESCAPEHEX$READAPPLREADPOLYGONNOTONOFFLENRESERVESCREENFREESCREENFREEACSASNATNDEGEXPINTLOGLNPIEPIRAD%TANCOSSINSQRREPEATUNTILFORMAT$(\DOFORM^SETWINDTITLE`SETWINDINFObGETWINDWORKdGETWINDCOORDSfSETWINDCOORDShGETWINDPREVjGETWINDFULLlHSLIDEnVSLIDEpTOPrGETFIRSTtGETNEXTvSETDESKxHSLSIZEzVSLSIZETOSTEPNEXTIFRETURNINPSTATOUTSTAT&INPUTINPFORRS232LINEENDSGRAFMODELINETYPELINEPATLINEWIDTHLINECOLLINE FILLPERIM FILLSTYLEFILLCOLFILLPATFILLCIRCLEMOUSERESERVETXTXBASETXTYBASETXTWIDTHTXTHEIGHT GRAFXBASE"GRAFYBASE$GRAFWIDTH&GRAFHEIGHT(OUTXBASE*OUTYBASE,OUTWIDTH.OUTHEIGHT0OUTDUMPDOUTHANDLE2OUT4HIDEMOUSE6SHOWMOUSE8CLS:HOMECHR$@GET$RGETREC#VGETBYTES#BGETDINKFPAPERHTXTSIZEJTXTEFFECTSLTXTXPOSNTXTYPOSPPALETTERPOINT(TGRABTPUTREC#XPUTBYTES#VPUTWAITBUTTONWAITEVENTWAITTIMERWAITMESSAGEWAITMOUSEXWAITZPC\<<^>>`DIVbMODdEORfORhANDj<>l<=n<p=r>=t>v+x-z*|/~^EOF#EXT#BPUT#BGET#MAKEDIRDELDIRLISTFILE$PATH$DRIVEMAPDRIVEDISKFREEDISCFREERENAMEDELFILEFSELECTOPENINOPENOUTOPENUPPTR#FILEATTSFILETIMEFILEDATEBLOADBSAVEMENUTAKEMOUSERELEASEMOUSEDSQRPOLYMARKMARKTYPEMARKSIZEMARKCOLPOLYLINEINSTALLPERFORMTRASHSEGFREESEGNAME$SEGMENTBLIT{something}WENDSETCOLLEFT$(RIGHT$(MID$(ASCINSTR(EVALEXEC}|}&}%}#}$$}$}DUMPVARSDUMPPROGLOCALCURSONCURSOFFCURSCOLCURSLEFTCURSRIGHT CURSUP CURSDOWNDUPDEV#REDIRECT#LAUNCHMEDIACHANGEVARCOUNTFIELD '"TAB($SPC,DATEUK$.DATEUS$0SYSTIME2SYSDATE4TRACE6TRACKING8KEY:ALTTRANSBLIT@SYSVARBMANDEL(DJULIA(FSEARCHLISTJeremy-L =@ Jng|g |+g|f.n!PNu=@ :.n *|g|+g|g |gJn 4f / .0a` .0a`4N a Nu(n 6`J@gF|gF|gF|gF|gF|qgF|ugFH~A~HNDNAL~NuA(NuAbNuA9NuABNuAJNuAtNuAsNuComputer Concepts Fast BASICEnd of programOut of memoryBreakEND encounteredEND found during assemblySTOPPrinter not respondingRun-time error Tokenising errorH .K-L <=l @=n BJnf\`H .K(HB <=| B/ 0<a{xBn -W N 9N 8:@R8..,$" @>N"  B\B\BNuXNuTNu\NuPNuBJf0 @NuT La"L1INuTY9JNuP Br J` Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo B   @AB   X P(Q(R(S(T(U(V(W(X(Y(Z([(\(](^(_( Z ` f  Ȁ  nNHNNA NW 8B HGA !! J. f@g"4BBPBA<FC4hJ. g(4(. g . f4(. fp*aJfzJhk. . J. gE L. N=F Jaabۮ pۮ t`Dn bSn bJ. g p aMBn Jn bfXJ |gaP(n |-L 0. =@ H`"J. gJ. gtaB JBn NzaJ. f . p d-@ l-n ^ hn $WgaRaNuDeep and crisp and, J. g*H瀀E qtaQp aMB. aM:Tn LNuQ 4. J. fn aH (n xUA 0<aj| p< gfJ. f<\W <"fn <:fJ. g@< gJ. g2.$Hn$Rn$Dl&aLRn `4. n RB n a|`L0NuP :ifp/ara/ac . fabNpr`f . f*abNzJ. g E J$$aۮ pۮ t`8Jg& f n "x8SDp. aQ`ab^. aa nl!Tgt _NuP :fp/a&rahab&(gp~|lfab . faaNpr`D . f0ab,N,.rS. a aQ Q_ Nuaa. a . ,S abQ Q_ NuP :fp/arJ. gtaaaz-@ TJ. gH(n xUar~ . TaqdL@`p5aBJ. gp=aJRn E TtarQNuP :fp/araR . pgrpa`P :tfp/araa¾|g.a`. <W . ga B ^ nl!TgzNua`ڰ|kAC xaXgZRQa J. gnJ. gh nl!Tfna`t=@ \J. jN n bfFJ. gtaG J6`& lBz a6G J& hBza&G JBBB[z a. Nu nl!Tf``Nup-`P :|fp/ara_-@ p-@ t-@ d|lfa_-@ tzNuP :Qfp/arJ. gta> . ^Jg R-@ ^J. gH(n xUap~ . ^aoL@J. g p[aIE ^taQp]aHTn a_V. aѮ ^Nu:fp/a0r<<V$O͵eDn b/. /. HNxL-_ -_ Dn bB xP Nu:qfp/arJ. fJ. f,a. NuJ. gBB. ZB. Nup*aNuk::fp/ar . fJgJ. gJ. fa8`Pa<`B . f,?a Nu0 . g@|> Nu . f @|> Nu . gj<Nu j<Nu:zfp/aragp.aX@`:Xfp/araJ. fJ. fa. NuJ. gar. Nuk:fp/ar` . f |> Nu . f2J g:fp/aTra`0:fp/a>ra`:fp/a(ra`J. fP:fp/a r4FZBBaJ. f. ZB. Nuagp.aX@. Nu:Nfp/ar . f S gp.a`kj:%fp/ar . a pU . g 6@f*4NugHH°fNu/ Ea $_< Nu0<`` 0<_`0<[<fzNuzNuJ. f4BB. ZBJ. f:fp/ar`:fp/ar` F . ap4`:`fp/ara`k:Dfp/ar` . f-n p-@ G a0<|> Nuk:fp/azraJ`P . f 0<s|> Nu . f 0<t|> Nu:fp/a Nu:fp/a>rJ. g J. gH` J. f@a. Nu. `Ԍ. `:fp/a ra@. Nu:ffp/a r`:Tfp/a ra`:Efp/a r`:,fp/a r. . a 4Nuk< . jv . j: fp/a br . fp*a R` . f Jfp/a >|G a0>|G a$4F^B8JBG<jrfrYANu . g"J. fp*a : vfp/a r<<@` . gp*a : Wfp/a ra @< NuBBBNuG `G ` G ` G `+ +<k|gf<gh<n/ E a v$_<g@`:< j p< k0g6g< kg8` . g.a ,`( . f$`a &4`a :4` a $4+4t+B+BNu . a . k$Nu4Nu: fp/a Hr`kp: fp/a 2r<f . g . fp . 4` . gX . . g4`x4pXZdQ4` . g" . g . o . n 0<|> Nu: ,fp/a r<fJ. fJ. ga<. . 4NuJ. fa2. . 4Nu: fp/a Fr . a` Bn Tn T` Bn Tn T4. TBBNu: fp/a ra`: fp/a ra`: nfp/a r`0: Vfp/a raF` 751`6: 0fp/a rB. Nu: fp/a ra . a=@ L2Nu: fp/a hr. Nu: fp/a Tr`:0<Nu0<Nu: fp/a 6r . $gp.a BNu: fp/a rt. BNup,`NuBn b-| -| B ^=| \Q B pB tNu n bfD-n p dB |`-| -| J. fQ =| =| J. g =| =| n Nua2A A@gxa(gp,`dFF=F F|Pk4BPBAj . fJhg (B /B. B. B. B. B. G 0(ak nl!TfG W0(apr. . _Nua <.!T|rg|f6Jlg8\J. gJ xga p a=HBn B xn Q ` F;j*J xfP -L xP ad~ . pacz`pI`bJ xf-L x FJgNu`p@f(fa rNu<kR. ra)2:>=lz"@#  N]::J:j:x::9;8:;$:;@;= =2=8=>=j=x=~=>]$?@99>>>&>.>4==>N>?m~mffhh8wnn$nHnohopFpqq^qr0rrs.^Vs;D:t$tJHFuv6v|vzwwwxfxdxt0y"y&yz&$|{{{hiVd ??@@ApAA@nA|x>vVBBB BBBBBCCC&<k|pfaD _ NuHn ^`<k|pfaD=@!NuNNN"Apraf`HaDx@@?a6aDf@??<NN\NuaDL@?Bg?<NN\~Nup`00. .aSn.n &(n X`&<kaUnH<k|pfaDL@`Tps`p`<k|pfaCal"9a~-@!Nu<k|g|f`r<k|g`|f`Np `zaCxa- nl!TgNu<k|pflaCZ-@ p-@ tNuaTH<k|lfaC8Ёa+ L@BGaS*Nup%`p&`p'`<k|mؼ| b2;`HtX L0T@fvHpaBLRCXR/H0aQi/ nl!Tg nf!TfL"L(HaTg(I ЂЁ/ a+.$_$LB00@f00@"H`#QR`BXQ<k|lgB=F!TNuaB4H //L?!VD!,_N,_@!H?!VL0Nu=\!TNuaBH@J@fH@|eaQ0/ (n NV(_Nup9`aS(H(n F f (n a`<|lg|Lg>|fTaaBv|lg|fU-L FL@aQ<k|lg=F!TNuT` g/ (@aXY-L F(_`AT<k|rg.|Bg(|g"a4E0DP/ (IaY-L F(_`U"n X `<k|Lg@|g|`la`T<j(f`X<k|Lg |`la`TNup<`Ҳa@`ҪpA`Ҥa@/ ?.!T(n " N9J@kr2$O͵e&OBgBgUA?0JAf(O/ a<.!T|rg|fԼ.W=_!T(_Nu<k|g|g|8fԚ`<k|g|g|8g|:fx`pq`a?/?< NN\NuBga??a2a??@?<#NN\Nua?/a1a? _a Pa fNua? @a >pa RBGNu?<?<NAXJkT`X<kaPHa1<kaPLGf?FE`N$"4`002`  "`L !iH`gg`f`f`(n 0. `p>0.!Nup>0.!Nu<k|pfa>=@!Nupa(`pa(Z?<`Bg:.!BD<k|rg|g|Bg|g|lg|tg| g޼|"g|$gUH a?2L0|ga:6@kg?0< SCa'Q02p n "`a'Q<.!T`l=F!T0< a'J_g pa'pa'Nux`DJn!g6r2.!g,!HADAg n!0< `a'bQ` <k|rg|g|BgBDBE`=F!T`0< a',`H a=|2L00< `a'Q`H a=bL0|lg$|ff|2n!gd?0< a&2`?H a=*L0|ffL20a,`fH JDf.|ga< n "a}: n "pR@JfL0Nu n "ayn`a<2<BNZfr~" NOO////////0000 NO//0T~|P$PjvPrpQHR.RRRdb`O"O8O<:86<:862fr|(&$" n^j  ,X|6d@*45  NPNNaK`FPaI`FHzaH`F>aKv`F6aI`F.zaH`F$aK<`FaK`FaI`F zaH`FaJ`EaI`EzaH`EaK@`EaI`EzaH`EaI`EzaH`EaK^`E n "p0. .g S@fp`2 gRn .D@~NuT ~NuTp>0Nu ap~NuLapj~Nua6|ffNup`a5F~Nua6JGg|g|f5ANuBNuDNu`a& 9a8Ю!BGNu . pBGNuA& BGNuH/B?< NA\,_-@#L?NuH/.#?< NA\OLNuaa5bBGNu BGNua4N~Nua4N~Nua4NR~Nua4N~Nua4N~NuaXJGg|f N~Nu|f4N~Nua4N @~Nua4tN P~NuN r~Nua4\N ~Nua4NN ~Nua4@N ~Nua42N ~Nua4$N ~Nua4N ~Nua46 n "p~Nup>0. :Nu0. :aƐ"n "p0. .`WD@n .S@~NuaER ~Nua3 n "CVrfQ0p~NuB1 Q " ~Nua4a%޾|g>?a3Ha3a%,L>a3C "$$n "Np0~.WNua3a3a%a3C"/ W (P$n "N.W.Wp0~Nua3Ta%\a3|a3"a%\$a3c ~Nua3*~Jg 0 n "NupNua3a% a3@a2a% $a3b.c., n ""H`Q ~Nup~Nua2a$a2a2JgS@|fg<|lf/a2a$&$a3eb , n ""H`Q~Nu$a2ܐe`pA`Ha2f/ (n " =| N9J@kr2$O͵eƔ&OUA?0JAf(O/ a2.W(_Nu?<NNTHBGNua1aBGNupBGNup>NuaNJGg"|g|f1N~NuN<~NuNGNua1N<~Nua1N~Nua1N~Nua1N~Nua1N~Nua1(N~Nua1N ~Nua1xN0~Nua1jN ~Nua1\N ~NuN |~Nua1DN ~Nu<k|dg UN ~Nua0|ffN GNuaF|g|gJGf0NuN ~NuN ~Nua0N ~Nua0N 2~Nua0N :~Nua|g|gJGf0Nua}~Nua}@~NuaȾ|g|gJGf0ZJjDNuNuNua|g2|gJGf00Jgjp~Nup~Nup>Nufg`fg`aT|ga/ n "ap  "~Nu n "alJ  "~Nua// (n "B4< g<+gD<-g4a(_Nu< g<.g <9b<0e anlGNu~pNua(_`a(_Nua/D?a!pa/`|ff`2gtJ@gn4HBJBf;HBn .b;SAgSA n ""H$n "ڳfQ  "~Nua.4 | bFr Bg `a./|lgXt fSBf|ff n "`g1`0Q  "f n "0p~Nua.a.a a.~|lfa.a.Z.gSa.ּ|ffvJf.Wp~NuA"d."H&n "d$n "f/ggg _`X.Wp>Nu _S AR~.WNua-Ha a-|ff$& .0ag @"Aao$& .0agaoH#Lao$& .0agaorH#,.1BB#B#B#B#B#B#B#B#L#aoRAL #ao0H#L#CaoL #aoH#Rd>L#NH#L#NH#L #an$<vNk-G1x ~Nua,Haa,|ff$& .0af @"Aan$& .0afanH#NH#Lan$& .0afanXH#NH#,.1B .0afH# .0afrH#`<k|rg|fJlg\/ <kJ.f6|g"at<.!T|rg|fdJlgb\`a+f(W`XNuaX`p`a=$0k|pf|g|g"|g*p`a"`\O.a+ W |fa+/@|g /|`a+p/@|rg|fJlg\/L <kJ.f|g"a<.!T|rg|fJlg\`<kafaH |g <r`a*$H|rg|fJlg\/L<kJ.f|g"a<.!T|rg|fJlg\`<kafa;Z|f<kf` WU ad Lak$&ac W L Jk avg k`avgj(o`fO<|lg=F!TNua`jO.a)ac WH n!Tfa)H|g <rt`a)zH|rg|fJlg\/L<kJ.f|g"a|<.!T|rg|flJlgj\`<kafa:D|f<kf` WULacLLac&(*ab WHLJ k aug k`augj(o``O <|lg=F!TNup"`ha(f|@fJgX<k|g|g|g`<k|Dg|g|g F|pg av<.!T|rgμ|g0|Bff L g (@=|!TNu<k|g |`la` =F!TNu L <k|gJg\(@<k|Dg(|gv|g ¼|pg B|g|ga<.!T|rg|f=F!TNu<k|g|Bg|`la>` U=F!TNuX `Jlg\<k|g&|Bgaހ<.!T|rg|g`t L g(@`ad|f `޺p>`JlgR\Jg:(@ \gޜX<k|gގa"<.!T|rg|fJlg\`aU `Bn#<k|g*|Bg0|g6|g |`la^`Jlg\`Jn#gSn#`Jn#gX`Nu<k|@g|gƼ|`la`X<k|ga`Rn#`C`Nrplfhjhfdb`^\ZXVTJHFDLD>@:0*06640.," NuPNu\NuTNuXNuXJf> GNu g (@=|r!TNuAal(I=|r!TNu gB/ (@<k|g,aܰ<.!T|rg|fJlg\`Cf(_`ATa/ E0DP(I`<k|g|gT|dgp`0a Nu/a% _|ff|g a$a^XNu/ (n "B4B4a(_XNuXa Nu"n  i6gJQfp@`z, . C0Yf@fNu"F(G`"n  igJQfp$`DifPINu<k|pg|vgUa$"Jgdb|Dg||Ffp LI?a0S@g<k|lfA`0g /(I`z/ UA<k|rg|Bg|g|lfa`UE0DP / (@`8 LI?a0S@g<k|lfA`(I=|r!TNupt`\<k|fBn 4`U-L 6=| 4`-L 0Nq<k|g |`la`=F!TNu|bG` JSNu<Nua`./ /a"RgGCpNHN0HNYO/NLHN&_`&_L>GCpN N0N NHN&_GCpN "/BgNaR/?<NaS H?<N. a $G?<N&_N_FC`N8<HTXdpr~ N aRaeNLaRae,N 0N aRbad0NLaRae0N N aR@ad NLaRad N aYaQ N NLaRhaYaQ N aSPaRHN aQaS6aQHNLHN. ,/1Fpc dЁ/a$$H _ 1@C._`Q$GNB$?A?@?Coo`n n >?A?B?CWWJEk$n n ?@?A ?B ?Aoo`"n n ?@?C ?B ?Co o p1N.rL@m Am8/adL@mAmaTaNua=@ Bn p N.r-n$RaNua `a`avL$@8.$La anB$HNuaPH?=| p N.r=| pN.r=_ pN.rBn p,N.rLH p6N.rNu@SBASCNup?N.rNu=| p>N.rNuJ.$WgHp%N.r?.=n$Z pN.r=| pN.rBn p,N.r=| p N.r .$HЮ$@"Ү$RH p6N.r=_ p N.rLNu|W$W`J.$WfP$WafNuJ.$WgaZQ$WNuL$Hn$Rj4.$DH„$RSB$R0aBH$Hn$@n$BL $R8.$La`,a`$a8`a:`a` 2.$Jn$Tj:.$TBDa$L$HNu=A$JNuL$H`xL$Hn$Rj4.$DH„$RSB$R0=B$HaH$HNua$R$T=@$H=A$J`?<?<NAX`-n$\$`A -H$\`x/=@$dA -H$\ _NuH-n$`$\20.$daLNuP$X`D-n$\$`A -H$\`2J.$Vg HaL-n$`$\Nu=|Bn =@ =n$@ =n$B pN.rNuL$J.$Yf*%Kl5|pBj6%iLTBjh5|FL~0\H~P&iH?@5sH&J*.$@ڮ$H0.$L@A5pj5|$%ELBjJ%n0XB5|@.0g0`X0.$N5|$@A\$K5pj%ELBjJ%n0XB5|@P$Y.0gfNu=| n$TSE=E =E HE=E n$RSE=E pN.rNu  |m| m&n$rt | g`$&n$rtBm`&n$rt|fBE`BD`xBvzhv=C0X=D0Z-K$E0\44R$L4PTJ$>4:48464Nup)N.jN/LH0taB0|at-@0a-@0NuaH =| pEN.j<k|lgp `¼|fgp`<k|pfɺNuaa ?n0v=@ =_ =_ =_ p6N.j`2apHa@adHa4aXHa(aLHpON1p0.BGL@ap0.BGL@a0.n0vHBGL@a0.n0tHBGL@a`j]a n$@>aa n$B?@aa z?@aa n6LadH =| pEN.r]a Jn0t>ara E S@k4n0t44n0v4Q0N.j`haP=@ pN.jNua>Bn =@ pN.jNua(=@ pN.jNua/><?a/Qa =@ LGH -_ L=G <=F -_ 6:4820@ASBSCH FGSDSEH0 -_ p=N.jNa`aŨ|fNuJGgA|gA`2aaJNup`az`aJGfNu|gL־|gLp`aT`a|fNua`a<|fNuJGg;8|f$rNu"PgR$O͵e$_"O O "n "`QN$_ O.X 2"n "`QNҼ|~b:E\e:;PNuzNuaĚ<k|~b:E\ea`=F!TNu|~b:E\eEGEAPN f ` ^ tnlJ TJ ~L J F H &: 0 , z | . 0 taZ/a<ka|b aB"~Nua.`a0/aÜ<ka|b a~Nua`a/at<ka|b a~Nua`/aP<kap|bJGfVHH~Nua`޾|g |g"p` @"A a?2$& aJVHH~Nu @"A$B a8&( * aJVHH~NuHa<ka|b|gaL aJPVHH~Nua,`&(*L$raJxVHH~NuHa€<ka|ba4L8aJLVHH~Nua`/aP<kap|bJGf\HH~Nua`޾|g |g(p` @"A a>2$& aIgkp>Nup~Nu @"A$B a7&( * aIgk`Ha<ka|b|gaL aIHgj`a"`&(*L$raIngk`|Hat<ka|ba(L8aI@g\jX`Na`/aB<kab|bJGf^HH~Nua`޾|g |g$p` @"A a=$$& aHgk` @"A$B a6&( * aHgk`Ha<ka|b|gaL aH>gj`a`&(*L$raHdgzk|`rHaj<ka|baL8aH6gLjN`Da`/a8<kaX|bJGfWHH~Nua`޾|g |g"p` @"A a<$& aGWHH~Nu @"A$B a5&( * aGWHH~NuHa<kaܺ|b|gaL aG8WHH~Nua`&(*L$raG`WHH~NuHah<ka|baL8aG4WHH~Nua`/a8<kaX|bJGf_HH~Nua`޾|g |g$p` @"A a;$& aFgj` @"A$B a4&( * aFgj`Ha<kaغ|b|gaL aF4gk`a`&(*L$raFZgvjr`hHa`<ka|baL8aF,gHkD`:a`/a.<kaN|bJGf]HH~Nua`޾|g |g$p`~ @"A a:$& aEgj` @"A$B a3&( * aEgj`Ha<kaκ|b|gaL aE*gk`a`&(*L$raEPgfjh`^HaV<kav|ba L8aE"g8k:`0a`/a$<kaD|b JGfП~Nua`|g|gpNSr @"A ?a9a9J<~Nu @"A$B ?a2&( * a2R<~NuHa<kaԺ|b|gaL ?a9<~Nua`&(*L?a2za2<~NuHad<ka|baL8?a1<~Nua`/a6<kaV|bJGf" ~Nua`|g|g&pNSr @"A ?a8$& Ca8T<~Nu @"A$B ?a1&( * Ea1T<~NuHa<kaֺ|b|gaL ?Aa7<~Nua `&(*L?a1xEa0<~NuHa^<ka~|baL8B?a0<~Nua`/a,<kaL|bJGf"aCdGNua`޾|g|g"pNSr @"A ?a7 $& a7<~Nu @"A$B ?a0&( * a1<~NuHa<kaҺ|b|gaL ?a7Z<~Nua `&(*L?a0xa0<~NuHab<ka|baL8?a0<~Nua`a6ZHa.<kaN|b|gapL ?a7J<~Nua` @"A$BL?a/&(* " $ a0<~NuHa<ka|baL8?a0b<~Nua2`a5Ha<ka|bF|g*|gJGf"*La74~NuL?a7<~Nu _"|$_?a7d<~Nua`Ha<<ka\|b*JGgaL?a70<~Nu&L?a76<~Nua`a/a<ka|bap"Jg ~NuaV`aX/a<ka|ba@"Jg ~Nua&`pNSra /a<ka|b a"aA"Nua`a/ab<ka|ba"a@<g Nup>Nua`aa,<kaL|bJ|f O.X"$ԀHBJBfhHBn .b^4"n "$I`!Q4"n "`QЁNuaV`aa<ka|b|fTaJVHH~Nua$`axa<ka|b|f"aSHH~Nua`aFab<ka|b|faUHH~Nua`aa0<kaP|b|faWHH~Nua`aa<ka|b|faTHH~Nua\`aa<ka|b|fZaPRHH~Nua*`4&HCHCJCf((HDHDJDfH@J@gHAJAf"҃e ҄e<Nu<Nu$_a.WN&_ n "C"/gJgfSAgS@f`S@@NH@B@H@=@ .*n " 0 @ &d0<9A3C0BBQNuFC`N(.44Lp NSr~ `*~L`*pBGNu0HBGNu BGNup0(2 P"n "`Q~Nup0. ."n "W|gn .D@~Nup NSrFGCpN8:<>HPV\bhpv|Nu0Nu Nua18a) Nua+a)HNua<>Nua<60Nua<. Nua)h Nua*a)HNua<<Nua<40Nua<, Nua0a)6 Nua)xHNu.hcTJgp0(/ Pa@ _p|c |d@Ё1G/aט"_"3@"n "`QNu1G$n ""P`QNu"n "`QBNu<kzgz|bC`NpNSrj$>4~|zxtrpnl"&LB@@E2 g$@A0\f@fNu(K`pNu|`|`|` |`|`| g" @0@f0k|`g|gULNuCaf"`JEgJn bj^p1ahQ |B TA T`;`NHHIpT2AfЇH`aLI$B00@f""H`BQ`rpNSra|0k|`g:|gVULNuaҁ|0k|`g|g4ULNua|0k|`g|gULNua`|0k|`g԰|gULNua>|0k|`g|gULNua|0k|`g|gULNu gh @0@f4|gNAXJkPNuaa?<?|pfa/?<BNA Jk Nua?<?/<?<BNA JkBGNua?<?B?<BNA*?|B>BNAW/E>BNA Jk HHBGNuaBNA,/E>BNA Jkr BGNuHn T/<a?a a@ T?<@NA Jk>NuHn T/<a??<?NA Jkp. TBGNua0/ ?<9NA\J@kNua/ ?<:NA\gJ@kNua"n "n .d>B1NuazC $n "S@kQB/. "Hn3?<NA\C ?</ ?<NNAPJkh$_"J " .l\C4 .4g * `  J fSg f / ?<ONATJj|f"  "~NupNSrC *.*BaL"n "2SAk paQ`B?<NATJk"n "A:?</ ?<GNAPJk"n "Jf|\ "~Nu<k|pf0aD?"n "S@k$ :Wg"n "`)H@A??<NAX0"n "B1/ ?<;NA\Jk@Nu?<NATHBGNu<k|pfa??<NAXNuaR?Hn3?<6NAP .333BGNuaBgaHoaצa"_/. "/ Bg?<VNA JkaJ_Nua/ ?<ANA\gJkNu/ <ka&_H/ aD<kal&_H/ a0aT&_H/ (Kaaa>a "n "E -J|dS@kQBaF"n "B1-I/ pZN1*_(_0.D@HJnfpBGL@a"n "Jf "SL@.aC $n "f "S G~abaL@~aT`a`aB/ ?<CNA JkBGNua>a|pf ada >a"n "B1??</. "?<CNA JkJNua?<?Hn T?<WNA Jk(p0. T~Nuaax|pf?<?Hn T?<WNAJk/. Ta-_ T=@ TBoNA Nuaf?<?Hn T?<WNA Jkp0. V~Nua=@ T?<?B?<BNA Jk /?<?. TB?<BNA Jk?. T?<?NA `VBBBga/ aaԢal.a/G aԐaZ/@?<NAXJkNua??<ENAXJkrNuBgaa.?a?@?<FNA\JkNNuaBga.Hoaa.BgaBBHzFHo/aa?aaH@?<KNAL@BGaa J_aJ_`Dal??< NMXBGNu?< NMTBGNuaH/ n "X@| o@ J@fp a: ah ar X@| lA`PM  " ~Nua/ n "a a" a, " ~NuX@a$:NuH@?a:Nu@@aNu4H 20 A0Nuaz/ n "a@ aH aR  " ~NuaT/ n "a( a a,  " ~Nu@a/NuH@a/NuX@@BGaa HNu?<,NATBGNu<k|pfa??<-NAXJkBNu?<*NATBGNu<k|pfaߺ??<+NAXJkNuaߤ?aafa0@/aX,C>N nl!Tg0Nu8@//<`//<`//<??<@NA JkNu//<`?an .g"n "B1 n!TfaU>-@ THn V/<??<@NAJkR /. "/. T`/Jf/`a?aaH>/E T0@CNL@aad|lg0Nu2Vx/ /<??<?NA Jkp. TBGNu/ /<??<?NA Jkp0. TBGNu/ /<??<?NA Jk . TBGNu/ /<??<?NA Jk^ . Ta~Nu/ /<??<?NA Jk6 . T". XaF~NuHn T/<??<?NAJk p0. Tn .dj"n "B1/ /??<?NAJk "n "Jf "S ~Nu|"n "/ .-I T/<??<?NAJk"oJg  e`Jg Tg/I` " S~Nup//a?a&a/@aa/@?<?NA Jk8Nup//a?aaܸ/@aaܬ/@?<@NA JkNuaܐ?aμa`|g(|f n "a " `a6 n "a " >|g$H /. "/??<@NA JkL0` n ".SpaźQ><.!T|g |rg|Bg|lg| g|tg`p a.TNuUp a$`Rp a"La|rg|g(I`2|f@`JH @ THn T/<??<@NA JkL0Nup NSrat?a͠aH>/|aL@|lBH (n "Bn T<-fFn T`<.g <0m<9na&L0~Jn TgaRL@aaм|lgTNuBn4=|4NuJn4j=|pkN1Jn4k BnpkN1=|4Bn4NuaF INJ@g|gNUNUNuRn4fp`Sn4 n4fp=@pkN1`|lf?a2-@0` aH-n@=@=_p!N1Nua?a2a"|lfaHa-@al` a-n n "H@B@H@B0-H=_p"N1Nua׶?aa׬-@=_=|piN1Nuaא?aɼa׆-@=_=|piN1Nuaj?aɖaHaɆaHazaHanaH=o =|phN10.H~L@a 0.H~L@a0.H~L@a0.H~L@aTNy@a?aa$HaaHaa HaaH=o =|phN10.H~L@a0.H~L@a~0.H~L@an0.H~L@a^TNy@aF?araa?a4a|ff$=@=_=_=_=_pdN1p>0.Nua?aa?aaѸ?aaѮ?aaѤ=@=_=_=_=_peN1NuHaa~L@NupNSraaH炀aÊaaH炀azaaH炀ajaaH炀aZa(/aTa/aJa/a@a / /4"/($/&/(/ */,/.NH~L@8a~ /L@,a~ /L@ a~ / L@a@NuaИ/aaЎ?aºaЄ?a°az?a¦ap?aœaf?a’a\=@=_=_=_=_=_-_p*N1NupNSra*/aVa ?aLa?aBa ?a8a|ff=@=_=_=_-_p+N1~0.HNu .~Nuaaaaϼ|ff=@a2 n "B0-Hp4N1Nu~?aώ>?aQa~=@=_=_=_=_=_=_=_=|p3N1Nu~?aF>?apQa6=@=_=_=_=_=_=_=_=|p3N1Nu a/a(a?|lgBoBn oLHp3N1JogLH=|p3N1-oBn=|dB=n$x=n$zp*N1-o=Wp2N1 oLHJogLH=|p3N1=|p3N1Nu?|a?@aHa?@ aa`H炀a a.aPH炀=o=o / =@ =@pFN1L@~0.HaܨL@~0.HaܖNy@az?aap|ff4=@=_pjN1~0.HNu?<`BgaB?anaݎaH炀aZa~aH炀aJanaH炀a:a^aH炀 =@ / =@ /=@ /$=@=o0=o2plN1L@~0.HaL@~0.Ha۶L@~0.HaۤL@(~0.Haے4Ny@aaH炀aaܼaH炀aaV?aaL?axaB?ana8?a2?a,?=@=o=o=o=o=o  / =@ /=@pGN1L@0.H~aL@0.H~a$Nua?aaʶ?aaʬ?aaʢ?aaʘ?aaʎ=@=_=_=_=_=_pHN1Nuah/aa^?aaT?aaJ|ff=@=_=_-_pKN1~0.HNua/aHa?a>a?a4a|ff=@=_=_-_pLN1~0.HNua=@H@=@pN1Nuaɸ-@pN1Nuaɦ?aaɜ?aaɒ?aaɈ?aa~?aaHaaھHaaڲHaaڦH=o =o"=o$=o&=o(pN1L@0.H~a"L@0.H~aL@0.H~aL@0.H~a*Ny@a-@=|pN1Nu<k|pfaȬ=@=|pN1NuBnpN10.H~Nua~?aat?aaj-@=_=_p N1NuaP?a|aF?ara<-@=_=_p N1NuaB"n "-I|l  R`B1p N10.HBGNua/a|dԼE "n ""SkQBA NHNuaǸ/aذ|dԊE "n ""SkQBA NH"n "$I .Sgg` " S~NuafJ@kP|bH@A N BGNu>@FJPV\bhntzpNSr NNuANuA$\NuANNuAnNuANuA@NuAy@NuAxNuADNuANuANuApNuANuANuANu nNu0nNuANuA Nu MNuAxNuASrNuANuA'NuANuANupNSrpNSrpNSrpNSrp=NSrpNSrpNSrpNSrpNSrJjzdRAHAfB NuJAkRj"g HBNuJj.dRdRB>GGBfABB ABBNurpNuJBk`p$g$4 BBANu&jDRBkRAk2gA lDAJjRJjD2aJk2NuE @"A$< LevaaaGNu&<ԚxK(<z`&<;)(<\za| mJjprtNua?aJk4NuG 4 @"A$Baa a aaa_NuaL8`aL8aL8`Jj4dRAB$RAk"gA lDAJjDJgJjSNupJjpNuJjdRdRBA&(RBk,g :SE؄׃QB lJDBJjDgJjSNupJjpNua$<[ةvUC`f.kJjTeRGH?a*,$<vaaEaJjRA4g @"ArpjD@H@aa`a&<[ة(<7(qzUE`t.k|JjvTeRGH?axH&<xzaxL8aG ~a0JjRB6g @"A$Btpr0jD@H@aa`2H?a @"A$BaHadRAB$RAk,gA lDA⨴fgJjRJjDNupNuJjdRdRBA&(RBkg :SE؄׃QB ljDBJffgJjRJjDNu|n$$<ڢv`j| n&NuafE~*,ada^ @"A`Aa`fafG8~H?ava @"A$B`Ba`aBRG`a:gaANug Ea @"A~ "aaQNu*,ETa$&`aRG`agaBNug&Ga @"A$B?<Laa0SWfTNuHGaL8`$k*j.BUH$B,$/7i+Z*SFe4K`+>Zu! sǵk}1ۏt=.p{?2 k( ` h&4^TmԳ1ne}I<" 6FŏŏLG`g0VGf͖tЮbⰏs=%mecV,57SF€f/-Z\*x*n{PIЋ e|! sLK:Nװ:i2)2}*)Қ ?N󈈈L?Ӿzp e%7Xx}  XÀp T%0 FF X)}/Հ ` ` vH;`[FF$;`Nu@P$ k(C@ԥ* _2ɿ/ k:#x !$'+.158;?BBBaJAfNuJAgfSANua< g<@f J@gRS@Nu<Xf `@<Nf `4<|fa`(<gθ<|faa`<CfJ@gBS@RBn .b Nu<{fFJ@g(H@@ }gaz`J@gL`RSANuH }gaR`LRSANu<1eҸ<9bD 0e 9bSAE E` *f"RSABc8:g@DEDa^SDPQNu $fRSA`@ LfRSABcDa0SD QNu Rf,RSA:BcDaSDkPQSE PQNuH@@?aSWgL` Nu<(f )ga\`<Af J@gS@<ae<zb`<af J@gS@<Ae<Zbx `p<*f JBg``<BfVJBgSSBNuH"`H 2E4BBBa|JAfBaLHBBBHBJk4EFgFA4 SBf`8Hav(<<g&<xza"aRF>LxaaL0A4BBaJAfNuaH< g<Dg(<Eg <.g<dg <Zg<zf<DRB|(bNu<^fPNu<|g<g"<|fa`<+fJj H a|LNu<-fJjNu<1eH<9b@D 0e 9bSAE E`H@@?a0SWgL` Nu<(f )ga `aN< g<Xgj<Ngn<|gr<BgB<Zg<.g<JFf>Ek$aQg 5eR 9c0`>A4E5' 0gSRGNuJFfT0gJGkGg k S@fJEg0jD@Ec00S@f0GkgS@f0g"H !0f S@fNu0gS@f0gS@f"H0 !0f S@fD0jD@H|e0B@H@d|e0B@H@ |e0H@0DF 00`f  `RFfNuNPJ  BF2 B!{ϐmӐܐ0J *********************************00J$ * QUICKCAD V1.08 *00J$ * Kyocera Laser Drawing Aid *00J$ * (c) K Millican 1988,1989,1990 *00J$ *********************************0J 28 May 19910J$----------------------------------0&vDprogerr& lV(setupV main6progendVȶrev|lVdefullout4l6 Tpressp@4l6  6progerralrt%p*[1][Fatal error number vdzfv* :- |vxv*|Please attempt to save the |diagram and restart QuickCAD... ][ OK ]lfVsaveDprogend2J&--------Parameter Handling----------2VparamsPj@pgtprm%pB gtprm%p P4l. gtprm%0 l,Vrctdl lqlf,( lr fc3%(,Vrctdllllf,.Vrsboxdlllf..Vrsboxdl<lrlf.( lr fc2%(,VrctdlAlDlf,.Vrsboxdl_llxf..Vrsboxd|l_llxf.4Vbshboxdldlxllf4.Vxemboxd;lFllf..Vrsboxd(l<llf.4Vbshboxd-lAlllf4.Vxemboxd-l_llKf..Vxemboxd-lnll<f..Vxemboxd-l}llf..Vrsboxd(lllf..Vxemboxd-lllf..Vxemboxd-lll<f..Vxemboxd-l1llf.4Vbshboxd-llllf4.VrsboxdlllPf.4Vbshboxdl lllf4.Vxemboxdl;llf..Vrsboxdlll<f.4Vbshboxdllllf4.Vxemboxdlmllf..Vxemboxdllxlf..Vxemboxdllxlf..Vxemboxdl}ll<f..Vxemboxdlllf.dp@w<l2liBldld>V,gtxdl(l*QuickCAD v1.08 - Optionsf>0.V,gtxdKlUl*TEXT SIZEf.0:V,gtxd@lUl*PRESCRIBE PARAMETERSf:02V,gtxdlxl*OUTPUT DEVICEf20,V,gtxdll*SCREENf,.V,gtxd ll*DISK FILEf.,V,gtxdll*PRINTERf,*V,gtxdll*RS232f*2V,gtxdlxl*Pen Diameterf20V,gtxdll*Top Marginf00V,gtxdll*Left Marginf0.V,gtxdll*X - Scalef..V,gtxdll*Y - Scalef.02V,gtxdAll*TEXT EFFECTSf2*V,gtxd_ll*BOLDf*0*V,gtxdZl,l*LIGHTf*0,V,gtxdUl@l*ITALICSf,00V,gtxdFlTl*UNDERLINEDf00,V,gtxdPlhl*OUTLINEf,08V,gtxdll*PICTURE ORIENTATIONf80.V,gtxdl6l*PORTRAITf..V,gtxdlJl*LANDSCAPEf.04V,gtxdl'l*SNAP INCREMENTf40.lul2p@|ll 2>V,gtxdlwl*C KEVIN MILLICAN - 1991f>nV,gtxdlwl* Screen Size : vd kscrwid%fv* x vd jscrhgt%fv* fnp@,V,gtxdZlil*4 POINTf,.,V,gtxdUlxl*6 POINTf,. .V,gtxd2ll*12 POINTf.. .V,gtxdPll*13 POINTf...V,gtxd2ll*26 POINTf.B.,VgtxdZlil*4 POINTf,,VgtxdZlxl*6 POINTf,.VgtxdZll*12 POINTf..VgtxdZll*13 POINTf..VgtxdZll*26 POINTf.  . gtprm%0 6 V"flicktext &p  , gtefft%p~d&xf,`d gtefft%h 0gteff%fp gtefft%@Vflickd&f`  VvflickdeviceVxflickorient.V,gtxdlxl Trgteff%pgteff%d>>Trgteff%pgteff%d>>Trgteff%pgteff%d>>T rgteff%pgteff%d>>T rgteff%pgteff%d><T rVflickdevicerdev$p*S<<T rVflickdevicerdev$p*D<<T rVflickdevicerdev$p*P<<TrVflickdevicerdev$p*R<<TrVflickorientrdor$p*P<<TrVflickorientrdor$p*L<XTrspdpXnewsizedlxlspdl|l fXdTrtpmarpXnewsizedlltpmarllscrhgt%fddTrlfmarpXnewsizedlllfmarllscrhgt%fd`Trxscale%pXnewsizedllxscale%l l'f`8yscale%pxscale%z(`@8 l \b1&(flb2&(flb3&(flb4&(f\4Vgtxdllyscale%f4 l^Tryscale%pXnewsizedllyscale%l l'f^Trsnp%pXnewsizedl@lsnp%lldfrsnp2%psnp%`   :Xnewsized&l&l(l(l(f:Rp@&p&`r&p&`r.Rtext$p*Vclearbuf  Xkp%pdfr&pkp%h.rka%pkp%^Xtka%phtext$t@text$ptext$ltext$xftl&nh&thtext$n@text$ptext$v>&l8,&l&ltext$v* lf8&p Ptext$j*@(ptext$B(p(P:(r(h(l(@(p(: l Zb1&(&flb2&(&flb3&(&flb4&(&fZ,&l&l( lp(6 paramdata$L-l_lln$$L-lnll}$$L-l}ll$$L-lll$$L-lll$$L-l ll$$L-lll1$$L-l1llE$$L-lEllY$$L-lYllm$$Lllhl$$Lllhl$$Lllhl$$Lllhl$$Ll'll;$$Ll;llO$$Lldl0l}$$Ll}l0l$$Lll0l$$Lll0l$$Lll0l$$Ll1lDlE$2Vrsboxd&l&l&l&f2&&p^p@&p&`r&p&`r.r&p^  lr  .&l&l&v&l&v&.F&vl&v&l&v&xl&v&x&F2&l&&vl&v&2>&v&l&&v&xl&v&>>&l&v&&vl&v&x&>J&v&xl&v&x&&v&l&v&J fc3%  2Vemboxd&l&l&l&f2Rp@&p&`r&p&`r.R l .&l&l&v&l&v&.  8Vshboxd&l&l&l&l&f8Rp@&p&`r&p&`r.R l& .&l&l&v&l&v&.  &Xupperda$f&Tda$ftZ@a$p>dda$fx fTpa$0J$---------Initial Procedures-------0Vsetup(jl(\l(`l(Xl((\p@ jscrhgt%p(vBscrhgt%p(v \ kscrwid%p(X kwindexistspVjfullout6&l&l q.dummy%l q>dummy2%6H qNxpmous%p'@r q^ypmous%p'Br qnbumous%pDH6&l&l q.dummy%l q>dummy2%6bd qNxpmous%x&ftfd q^ypmous%x&ft@bJ qNxpmous%p&r q^ypmous%p&r qnbumous%p J8&l&l q.dummy%l q>dummy2%8ddxpmous%x&ftfdypmous%x&ft@dJxpmous%p(rypmous%p(rbumous%p`J8&l&ldummy%ldummy2%8ddxpmous%x&ftfdypmous%x&ft@d4H *** MOUSE PEEKS - STE (or other) ***4Lex$p*xpmous%=00000000:ypmous%=00000000:bumous%=00000000Lex$xpmous%n@al%p*[3][Please configure for an STE|or unusual TOS version after|referring to the manual.][I Will]lfr      BH *** SET UP MAX NO OF POINTS AND TEXT BUFFER SIZE ***B6 qzex$p*maxpoints%=04000:maxtext%=050006 qzex$" qbefcode%l("4 r0codes%lz qmaxpoints%4, texts%l qmaxtext%," dgheader%l("Vinitvar& skey$(lf&:UULp@yres%pB yres%pL> coordspr quitpr snapp>F snp%pr gtsize%p r 0gteff%pF2H& *** Default Prescribe Parameters ***2@ &pzpat2%v zdpat1%xf>Vendmenu Vinfod*FILLf Vwaitzero$Pbutton%j$Vfindposbutton%ph&jlstxfill%h&jlstyfill%@Vrevr&l&lrlstxfill%p&rlstyfill%p&rVassemd v&l&l&frVrev  Vinfod*f  Vdecodepat& 6 ,pressprVgetmouse, 4 xbut%thxbut%nhybut%thybut%n @Vinvertdxbut%lybut%f>&pdxbut%xfzvybut%x>.pat1%p&`v.$pat2%p&b$fpat1%phpat2%p @pat1%prpat2%pffpat1%phpat2%p@pat1%prpat2%pfVclearbuf  8Vfillbuttondxb%lyb%f8(&lt1%lt2%(.&pd&xfzv&x."t1%p&`""t2%p&b"( lrfc3%(`Vrctdxb%lyb%lxb%vbxs%lyb%vbys%f`2 t1%vlt2%r2.&p&@ l..&p'@ l.Vrctdxb%vbsw%lyb%vbsh%lxb%vbxs%xbsw%lyb%vbys%xbsh%f  VenterH4lalign%r.gtsize%r0gteff%H Vinfod*TEXTf Vrev6Tllscrwid%lscrhgt%6text$p>&4P&j hbutton%p4vka%phtext$t@text$ptext$ltext$xfv>Vgmousrsnap@Vsnap>\&jxtemp%f&jytemp%fka%tx@\JVllrVhorid&frVvertd&fJ&,&l&ltext$&   df@ Zkp%pdfr&pkp%h.rka%pkp%^ZB(&prka%px(  Vspecial"4lalign%"T&nh&t@text$ptext$v>&T  VllXbutton%j@,&l&ltext$rVassemtextXVrevVwaitzeroZoldx%p&roldy%p&rxtemp%p&rytemp%p&ZVinfod*f. r0  Vdraw Vinfod*LINEf .oldx%p&roldy%p&.Vwaitzero6oldx%loldy%&l&6$Pbutton%j$Vfindpos"Rbutton%"$TrVfix$\Troldx%loldy%xtemp%lytemp%\  Vxtemp%j&fytemp%j&@VswitchlineV   Vinfod*f  VswitchlineJoldx%loldy%xtemp%lytemp%J6oldx%loldy%&l&6  VfixJoldx%loldy%xtemp%lytemp%J$Pbutton%p$VfindposVrev6oldx%loldy%&l&6 r<&l& VrevVassemline.oldx%p&roldy%p&.    Vhorid&f 0&l&l jscrhgt%0P coords@"lft*000v&lftP   Vvertd&f 0l& kscrwid%l&0P coords@Ǩ"lft*000v&lftP  Vcross^&j xtemp%@0V.horid xtemp%frV.horid&f^^&j ytemp%@ȎVvertd ytemp%frVvertd&f^  VrevVvertd&fV.horid&f  VcircleVendmenu  "Vinfod*CIRCLEf"  Vfindpos button%j 6button%p@Vcirc6"button%p"Vinfod*f  Vcirc.xcen%p&rycen%p&.Vwaitzero oldradius%p lxcen%lycen%loldradius%loldradius%`yres%lll  Vmousennewradius%pdd&xxcen%f~vdyres%zd&xycen%ff~fn:newradius%joldradius%@:nxcen%lycen%loldradius%loldradius%`yres%llnnxcen%lycen%lnewradius%lnewradius%`yres%lln0oldradius%pnewradius%0Zcoords@" lftnewradius%l*DDDftZ  button%j lxcen%lycen%lnewradius%lnewradius%`yres%lllXcoords@Vrevr" lft* trVrevX>button%p@Vwaitzeror>Vrevxcen%lycen%lnewradius%lnewradius%`yres%llrVassemcircleVrev  VmoveVendmenu  dcopymode@Vinfod*COPY 1fBVinfod*MOVE 1fd  Vfindpos button%j 6button%p@Vmove266button%pfscalep6VclearbufVinfod*f  Vmove2Vgetrect,button%p@,^xs%poldx%rys%poldy%rxf%p&ryf%p&^Fxs%txf%@xs%lxf%FFys%tyf%@ys%lyf%F8scale@Vgetnewrectr8xsi%pdxf%xxs%frysi%pdys%xyf%frxsipxsi%rysipysi%  .oldx%p'roldy%p'.dcopymode@Vinfod*COPY 2fBVinfod*MOVE 2fdVwaitzero  ka%pxVfindposPbutton%p@oldx%p'roldy%p'Pjoldx%j&foldy%j&fka%pHfka%pP@jpoldx%vxsi%loldy%oldx%vxsi%loldy%vysi%ppoldx%vxsi%loldy%vysi%oldx%loldy%vysi%pNka%pHfka%pP@VpropscachNP&vxsi%l&&vxsi%l&vysi%PP&vxsi%l&vysi%&l&vysi%P.oldx%p&roldy%p&.  button%j xsi%jdxf%xxs%ffysi%jdys%xyf%f@scaleprxscalpxsi%|dxf%xxs%fryscalpysi%|dys%xyf%f(button%p@($copymode@$Vcopyup.Vmove3dno_prev%vf."Vinfod*COPY 2f"BVmove3df    :button%pfcopymodep:  VpropscachRka%pH@ad%pBad%pxR.xsi%tysi%@.xsit@xsipxsivad%rysipysizxsi|dxsixad%fBysit@ysipysivad%rxsipxsizysi|dysixad%f  :xsi%pxsirysi%pysi:  Vgetnewrect4rVfindposrbutton%p4"Vinfod*SCALE1f"  Vfindpos button%j Vinfod*f,button%p@,"Vinfod*SCALE2f"4rVfindposrbutton%p4VgetrectVinfod*f,button%p@,fxs2%poldx%rys2%poldy%rxf2%p&ryf2%p&fNxs2%txf2%@xs2%lxf2%NNys2%tyf2%@ys2%lyf2%NVxf%xxs%pfyf%xys%p@VPxscalpdxf2%xxs2%f|dxf%xxs%fPPyscalpdyf2%xys2%f|dyf%xys%fP"Vinfod*SCALE3f"4rVfindposrbutton%p4.oldx%p'roldy%p'.  VfindposPbutton%p@oldx%p'roldy%p'P>oldx%j&foldy%j&@>oldx%vxf2%xxs2%loldy%oldx%vxf2%xxs2%loldy%vys2%xyf2%oldx%vxf2%xxs2%loldy%vys2%xyf2%oldx%loldy%vys2%xyf2%z&vxf2%xxs2%l&&vxf2%xxs2%l&vys2%xyf2%zz&vxf2%xxs2%l&vys2%xyf2%&l&vys2%xyf2%z.oldx%p&roldy%p&.  button%j Vinfod*f>button%p@Vmove3df>  Vcopyup$no_prev%pno%$6lstpat1%prlstpat2%p6,&pno_prev%,Rofset2%pcodes%v&zrofset%pofset2%R2func%pofset2%h.2F&\pofset2%vr&`pofset2%vFRXP%pofset2%xrYP%pofset2%xR Rfunc% T0Xtestd&\l&`f@0<XtestdXP%lYP%f@<6VassemdlXP%lYP%f6*Vassemdl&\l&`f*B*Vassemdl&\l&`f*    T<XtestdXP%lYP%f@<0xst%p&ryst%p&0J&pXP%r&pYP%rtext$pXgettextJalign%pVassemtext0&pyst%r&pxst%0  T<XtestdXP%lYP%f@<0xst%p&ryst%p&0J&pXP%r&pYP%rtext$pXgettextJalign%pVassemtext0&pyst%r&pxst%0  T<XtestdXP%lYP%f@<6VassemdlXP%lYP%f6*Vassemdl&\l&`f*  Trxa1%pofset%x vofset%xzdofset%v| frrxa2%pofset%x vofset%xzdofset%v| frya1%pofset%xxofset%xzdofset%v| f|yres%ya2%pofset%xxofset%xzdofset%v| f|yres%xa1%rxs%hxa2%rxs%hya1%rys%hya2%rys%hxa1%lxf%hxa2%lxf%hya1%lyf%hya2%lyf%@RVassemdlofset2%x lofset2%xfR>Vassemdlofset2%xlf>*Vassemdl&\l&`f*  T\Xtestd&\l&`fhXtestdXP%lYP%f@\JVassemdofset2%xlXP%lYP%fJ8Vassemdofset2%l&\l&`f8  TXtestd&\l&`f@VassemdlXP%lYP%frVassemdofset2%l&\l&`fThpat1%p&\rpat2%p&`r&p zdpat1%xfvzpat2%hT 0Xtestd&\l&`f@0ofset2%t @Vassemdofset2%l&\l&`fBVassemd&v l&\l&`f     &Xtestd&l&f&ltestpd&rxs%h&lxf%h&rys%h&lyf%flptest&Vmove3dns%f&,&pns%no%,2ofset%pcodes%v&z22func%pofset%h.2F&\pofset%vr&`pofset%vF&func%j@& Rfunc% TTxv%pofset%xryv%pofset%xTBofset%xp@VshiftBTofset%xpxv%rofset%xpyv%Tbxv%pofset%vryv%pofset%vrVshiftbTofset%vpxv%rofset%vpyv%TTbxv%pofset%xryv%pofset%xrVshiftbTofset%xpxv%rofset%xpyv%TTbxv%pofset%xryv%pofset%xrVshiftbTofset%xpxv%rofset%xpyv%TTbxv%pofset%xryv%pofset%xrVshiftbTofset%xpxv%rofset%xpyv%T~scalehshift@ofset%vpdyscalvxscalfz&\`~Trxa1%pofset%x vofset%xzdofset%v| frrxa2%pofset%x vofset%xzdofset%v| frya1%pofset%xxofset%xzdofset%v| f|yres%ya2%pofset%xxofset%xzdofset%v| f|yres%xa1%rxs%hxa2%rxs%hya1%rys%hya2%rys%hxa1%lxf%hxa2%lxf%hya1%lyf%hya2%lyf%@Txv%pofset%x ryv%pofset%xT"scale@"xv%p&vdxv%xxs%fzxscalryv%p&vdyv%xyf%fzyscalB^xv%pxv%v&xxs%ryv%pyv%v&xyf%^  Tofset%x pxv%rofset%xpyv%Tscale@ofset%xpdyscalvxscalfzofset%x`  Tbxv%pofset%xryv%pofset%xrVshiftbTofset%xpxv%rofset%xpyv%Tbxv%pofset%vryv%pofset%vrVshiftbTofset%vpxv%rofset%vpyv%TTbxv%pofset%vryv%pofset%vrVshiftbTofset%vpxv%rofset%vpyv%Tscalehshift@&Dpofset%`r&Dpdyscalvxscalfz&D`rofset%pvz&DT bxv%pofset%vryv%pofset%vrVshiftbTofset%vpxv%rofset%vpyv%T     "VreplotrVrev"  Vshiftshiftpxv%nxs%fxv%txf%fyv%nys%fyv%tyf%@shiftpr scale@ xv%p&vdxv%xxs%fzxscalryv%p&vdyv%xyf%fzyscalB\xv%pxv%v&xxs%ryv%pyv%v&xyf%\   Vgetrect.oldx%p&roldy%p&.VwaitzeroVrevoutline  VfindposRxtemp%j&fytemp%j&@VoutlineR button%j Vrevoutline  VrectVgetrect,button%p@,Vrev$solidbox@$& pat1%lpat2%&2~oldx%loldy%l&l&2B>oldx%l&oldx%loldy%>>oldx%loldy%&loldy%>.&loldy%&l&..&l&oldx%l&.  VassemboxVrevVwaitzeroVinfod*f  Vrevoutline>oldx%l&oldx%loldy%>>oldx%loldy%&loldy%>  VoutlineHoldx%lytemp%oldx%loldy%HHoldx%loldy%xtemp%loldy%H>oldx%l&oldx%loldy%>>oldx%loldy%&loldy%>  (Vinfodinfo$f(*coords@*LVrevr"Ilftinfo$v* lftLVrev  VboxVendmenu  Vinfod*BOXf  Vfindpos button%j 6button%p@Vrect6 button%p VclearbufVinfod*f  VarcclockwisepVendmenu  Vinfod*ARCf  Vfindpos button%j Jbutton%p@VarcsketrVwaitzeroJ button%p Vinfod*f  VarcsketVwaitzero*x1%p&ry1%p&*snap@x1%psnp%zdd&vsnp2%f`snp%fry1%psnp%zdd&vsnp2%f`snp%fLx1%ly1%ll`yres%llL  Vfindpos button%j Lx1%ly1%ll`yres%llL,button%p@,Lx1%ly1%ll`yres%llL@&l&ll`yres%ll@*x2%p&ry2%p&*snap@x2%psnp%zdd&vsnp2%f`snp%fry2%psnp%zdd&vsnp2%f`snp%fPxtemp%px rytemp%px rrdiustemp%pPVwaitzerostarsp6oldang1%proldang2%p6  Vmouserka%pxrVinkeyrka%p@x1%lx2%ry1%ly2%VanglesX&jxtemp%f&jytemp%fka%p@Xstarsp@x1%ly1%ll`yres%llrx2%ly2%ll`yres%llrstarsp€xtemp%lytemp%lrdiustemp%lrdiustemp%`yres%loldang1%loldang2%d&l&lrdius%lrdius%`yres%lang1%lang2%dxtemp%p&rytemp%p&rrdiustemp%prdius%roldang1%pang1%roldang2%pang2%4coords@Vangprint4  button%j xxtemp%lytemp%lrdius%lrdius%`yres%lang1%lang2%xVwipeang,button%p@,Vrevd&l&lrdius%lrdius%`yres%lang1%lang2%d(Vassemdl&l&f(2Vassemdlrdius%lf28Vassemdlang1%lang2%f8Vrev  Vangleslrdius%pdd&xx1%f~vdyres%zd&xy1%ff~fvlrang1%pXangledx1%ly1%frang2%pXangledx2%ly2%fr  Vangprintx" lftdang1%| fl*DDD.Dft"lftdang2%| fl*DDD.Dftx  Vwipeang^coords@Vrevr" lf* trVrev^  2Xangledxt%lyt%f2xt%p&@angle%pXbodgedxt%lyt%fBangle%pXrealdxt%lyt%fpangle%2Xbodgedxt%lyt%f2Tyt%t&@ang%p Bang%pTpang%2Xrealdxt%lyt%f2:operat1pd&xyt%fzyres%:,operat2pdxt%x&f,Lyt%t&@operat1poperat1zxLLxt%n&@operat2poperat2zxLFang%p zddoperat1|operat2ffFFxt%n&@ang%pxang%FFyt%t&@ang%pxang%Fpang%VpaintVendmenu,Vinfod*PaintfrVrev,2 pat1%lpat2%rr2N rrd%prka%pxrnewrdval%pN  L&l&lrd%lrd%`yres%llL  VgmousDVinkeyrka%t@VchangeradD&jxtemp%f&jytemp%@xtemp%lytemp%lrd%lrd%`yres%llr&l&lrd%lrd%`yres%ll button%j L&l&lrd%lrd%`yres%llL:rpat1%p@:6oldxp%pxroldyp%px6$Pbutton%p$L&l&lrd%lrd%`yres%llL&joldxp%f&joldyp%@Vassemdlpat1%lpat2%frVassemdvrd%zl&l&froldxp%p&roldyp%p&ԀVgmousLsnap@rVgmousrbutton%pL   button%p VrevVinfod*f  Vchangerad^ka%pHhrd%n@newrdval%prd%v^^ka%pPhrd%t@newrdval%prd%x^xtemp%lytemp%lrd%lrd%`yres%llrrd%pnewrdval%rxtemp%lytemp%lrd%lrd%`yres%ll؀ka%px  2J&-------Misc Menu Funcs--------------2VchsnapPsnapp@snappBsnappP~snapp@ skey$(lfp*SNAP OFFB skey$(lfp*SNAP ON~  Vchcoords&coordsp@&coordsp"Bcoordsp"  Vendmenucoordsp@ skey$(lfp*FreehandB skey$(lfp*COORDSr"lf* t  Verase0eraseprsureflagp0<oldno%jno%@Vsure<$Rsureflag$"TrVsave"&Trerasep&  (erasep@(Vendmenu<windexistsp@Vcreatwind<Vinitvar 8  Vquit quitp2 oldno%p no%@2Vsure$Rsureflag$$TrVsave$(Trquitp(   Vsure 6 sureflagp*[3][|This will erase all data.|Only click on 'OK' if you do|not mind losing the drawing.][OK|SAVE PIC|CANCEL]lf 4  4J(------------File Handling-------------4,Vselfiledmyext$f, 6 Dpmypath$rmypath$pv**vmyext$D<mypath$lmyfile$lbutstat%<.Pmypath$lfj*\.Fmypath$pmypath$ldmypath$fxfF  pmypath$ 4  (H Save Screen in IMG format(VgemsaveVendmenuZj@alrt%p*[3][Only in Hi-Res !][SORRY]lfrZ"Vinfod*GEMIMGf"  Vfindpos button%j (button%p@(Vgetrect(button%p@("VoutlinerVrev">oldx%t&@oldx%l&>>oldy%t&@oldy%l&>zVgemssavedoldx%loldy%l&xoldx%vl&xoldy%vlmyfile$fzFsavegemprsavedegasprsavequickpFJsavefile$pmyfile$rsavepath$pmypath$JVrev    Vinfod*f  BVgemssaved&\l&`l&Xl&lF$fBBlb%lrb%lnb%limg%l&B"lb%p&\`",rb%pd&\v&Xf`,*nb%prb%xlb%*nb%zn&Xflb%j&\|@nb%pnb%vr&Xp&Xvd&\bfPXtestdiscd&zdvnb%fvfp@PF$$img%pF$$VwputdfVwputdfVwputdfVwputdfVwputdfVwputdfVwputd&XfVwputd&f*&p&`d&`v&f*img%l."img%lnb%"BXimg%lnb%ldjv&zPvlb%fB&img%  *H Save Screen in DEGAS format*VdegasaveVendmenu4Xtestdiscdfp@4Vrev(img%pmyfile$(.Ximg%l"ldgheader%. Ximg%l}lj img%FsavegemprsavedegasprsavequickpFJsavepath$pmypath$rsavefile$pmyfile$JVrev   Vwputd$lf &img%l$l`&&img%l$lb&  Vsave myext$p*.QUI Jmypath$psavepath$rmyfile$psavefile$J<savegem@myext$p*.IMG<@savedegas@myext$pXdpi@(Vselfiledmyext$f(,butstat%p@,Jmyfile$l*.IMGft@VgemsaverJJmyfile$l*.PIft@VdegasaverJjmyfile$l*.QUIfn@Vsavequiralrt%p@jFsavegemprsavedegasprsavequickpF"oldno%pno%"rXtestdiscdzdno%vfvvtextptr%xtexts%fp@rmyfile$&hanpmyfile$&"hanlno%"<hanldtextptr%xtexts%f<BXhanlzdno%vflcodes%BHXhanltextptr%xtexts%ltexts%H&hanlgtsize%&hanJsavefile$pmyfile$rsavepath$pmypath$J  Vsavequialrt%p`myfile$l*.fn@myfile$pmyfile$v*.QUIr`Tmyfile$pmyfile$lmyfile$l*.fxfv*.QUIT 6 talrt%p*[2][| Shall I save picture as | vmyfile$v* ?][YES PLEASE|NO THANKS]lft 4  .Xtestdiscdbytes%f.diskOKp0dxfnbytes%@0Palrt%p*[1][ Not enough free disk space ! ][OH DEAR]lfPdiskOKp  pdiskOKXdpiTp@dext$p*.PI2Bdext$p*.PI3Tpdext$Vloadloadp.oldno%jno%@.Vsure$Rsureflag$TjVinvertdxbut%lybut%frVinvertdxbut%lybut%xfjxVsaverVinvertdxbut%lybut%xfrVinvertdxbut%lybut%fx(Trloadp(    (loadp@(bloaddegas@myext$pXdpiBmyext$p*.QUIbJmyfile$ploadfile$rmypath$ploadpath$J(Vselfiledmyext$f(,butstat%p@,&hanpmyfile$&hann@alrt%p*[3][ | | Can't find vmyfile$v* ][WHOOPS !]lfrhanrJmyfile$l*.PIft@VdegasloadrJ|myfile$l*.QUIfn@alrt%p*[3][Not a valid picture type][SORRY]lfr|loaddegasp"hanlno%"0hanlno_of_textbytes%0BVhanlzdno%vflcodes%B@Vhanlno_of_textbytes%ltexts%@hhanp@hanlgtsize$rgtsize%pdgtsize$fhhan>gtsize%p@gtsize%p >Btextptr%ptexts%vno_of_textbytes%B"oldno%pno%"VreplotJloadfile$pmyfile$rloadpath$pmypath$JZsavefile$l*.QUIft@savefile$pmyfile$Z  Vdegasloadloaddegasp2no%pxroldno%px2.pat1%prpat2%p.(textptr%ptexts%(6lastx%pxrlasty%px6"&pxr&px"8myfile$lXdpift@8(img%pmyfile$(.Vimg%l"ldgheader%. Vimg%l}lj img%Jloadfile$pmyfile$rloadpath$pmypath$JB^alrt%p*[3][Wrong type of Degas file|for this screen mode][WHOOPS]lf^ 8   6Tllscrwid%lscrhgt%6  4J(-----------Menu Items-----------------4(Vinvertd&l&f(" xb%l yb%"B xb%p&zVx5r yb%p&zvB  lr `Vrctd xb%l yb%l xb%v bxs%l yb%v bys%f`  8Vdrawbuttond xb%l yb%f8 l`Vrctd xb%l yb%l xb%v bxs%l yb%v bys%f` lVrctd xb%v bsw%l yb%v .bsh%l xb%v bxs%x bsw%l yb%v bys%x .bsh%f|V,gtxd xb%vv bxs%`l yb%v bys%`xl skey$(&l&ff|  6 buttondat@L4*QUITl*SAVEl*LOADl*ERASEl*Redraw@DL8*BOX/BLKl*Circlel*Arcl*PAINTl*MakeTEXTDDL8*COORDSl*SNAP ONl*OPTIONSl*EDITl*DUMPD@L4*PATTERNl*FILLl*MOVEl*COPYl*SCALE@Vdecode 6 , TpressprVUgetmouse, 4  bxbut%th bxbut%nh pybut%th pybut%n@VEinvertd bxbut%l pybut%f RKK4 bxbut% &TKZrVLydecode1&&TKrVydecode2&&TrVNydecode3&&TrVydecode4&  VZclearbuf  Vydecode1 RML< pybut% "TrV&Zquit""TrVsave".TrVloadrVrev."TrVerase"0TrVreplotrVrev0   Vydecode2 Rybut% hTrpressp@solidboxpBsolidboxphVbox$TrVcircle$ TrVarc "TrVpaint"&TrVmaketext&   Vydecode3 RON pybut% &TNrVchcoords&$TOrVchsnap$$TrVpparams$"TrVedit"HTrphdf@VdumpH   Vydecode4 Rybut% $TrVpattern$"TrVfill"JTrscaleprcopymodeprVmoveJJTrscaleprcopymodeprVmoveJJTrscaleprcopymodeprVmoveJ   Vmenu|l6Tll kscrwid%l jscrhgt%6 ( lr fc2%(,Vrctdlllf,  lr ,Vrctdllxlf, fc3%4l00. rp@R.0 &p &p @VG$drawbuttond&zVx5l&zvf@   VZclearbuf FfinmenupVT&tsizeVJ0decode6 Ffinmenup@VTendmenu6VT&tsize  VtsizeRTD(TTlrHr.((TTrHr.((TrHr. (   Vendmenu FfinmenupVll  4J(--------Mouse and Key Actions---------4Vgetmouse"PV Tpressp": bxbut%pd qNxpmous%v5f`V:: pybut%pd q^ypmous%xf`:Vp@Vybut%pdzypmous%xf`V0 Tpressp qnbumous%h0   Vgmousxtemp%p&ytemp%p& &pxpmous% &pypmous% 2button%pbumous%h2  Vfindpos xtemp%p& ytemp%p& &p qNxpmous% &p q^ypmous% 2 button%p qnbumous%h2. snap@XVsnap.VYinkeyVcross  VsnapF&psnp%zdd&vsnp2%f`snp%fFF&psnp%zdd&vsnp2%f`snp%fF  VinkeyPZdfpkp%pdf8&pkp%h.rH k%=ASCII val8>ka%pkp%^rH ka%=internal val>R&th&nhmainp@VenterRVspecial   Vclearbuf 6ka%pP[Vdfp$ka%pdf^$   VspecialRka%,TKralign%p,,TMralign%p,BTGrmainp@VmenuBTbrRtextfree%pmaxtext%xdtextptr%vxtexts%fRalrt$p*[2][QuickCAD Free Memory : vdfv*|Points Used : vdno%vfv*|Points Free : vdmaxpoints%xno%xfdalrt$palrt$v*|Free Text Bytes : vdtextfree%fv*][ OK ]d,alrt%palrt$lf,   Vmousextemp%p&ytemp%p& &pxpmous% &pypmous% 2button%pbumous%h2Vcross  Vwaitzero  Vmouse button%p  Vgetkeykp%pdf&ka%pkp%^&  Vbutton6 button%p@`"Vdraw66 button%p@`XVQ8menu6  Vfindkey  df^  2J&-----------Drawing Storage-----------24Vassemdfunc%l&l&f4Fno%pno%vrofset%pzno%F8codes%vofset%pfunc%86codes%vofset%vp&66codes%vofset%vp&6  Vassemtext*text$p*@*(Vassemdl&l&f(VtextputFno%pno%vrofset%pzno%Falign%p@codes%vofset%pBcodes%vofset%p< textofset&ptextptr%xtexts%<Dcodes%vofset%vp textofset&D@codes%vofset%vpgtsize%@@codes%vofset%vpgteff%@@textptr%ptextptr%vtext$v@  Vtextput*textptr%ptext$*  VassemlineB&poldx%h&poldy%@Boldx%jlastx%foldy%jlasty%@Vassemdloldx%loldy%f(Vassemdl&l&f(2lastx%p&rlasty%p&2  Vassemcircle8Vassemdlxcen%lycen%f86Vassemdlnewradius%lf6  Vassembox>&noldx%@&loldx%>>&noldy%@&loldy%>(solidboxp@(8Vassemdloldx%loldy%f8(Vassemdl&l&f(B:pat2%p@pat2%pc:LVassemdvzpat1%loldx%loldy%fL<Vassemdvzpat2%l&l&f<:pat2%pc@pat2%p:   4J(-------Edit/Plot Routines--------------4Vreplot<windexistsp@Vcreatwind< 8 editmodep.pat1%prpat2%p.Vdrawmode&&pno%&Vinterpd&f  finmenup  Vedit 6 jeditflagp*[2][|Click on the position to|begin editing.][START|FINISH|CANCEL]lfj 4 .editflagp@.$Reditflag$TH8rpos%prpat1%prpat2%pHT2Vreplotrpos%pno%2  2motion%preditmodep2$fineditpr$  VgetkeyRka%(THrVnextpoint((TPrVlastpoint(&TSrVdelete&*Trfineditp*  fineditpVminimise"VreplotrVrev"  Vdelete,motion%j@,Hpos%t@pos%ppos%xHVundrawmode&Vinterpdpos%f&:ofset%pcodes%vpos%z:Xfunc%p@VdelpatBofset%pX  Vdelpat 6 alrt%p*[3][|Do you want to delete pattern|v&\v*,v&`v* at this time ?][YES|NOT REALLY]lf 4 @alrt%p@ofset%p@  Vplotto 8 0tpos%ppos%0&Vinterpdtpos%f&   Vnextpoint.doneprmotion%p.>Pdonephpos%lno%>Vdrawmode&Vinterpdpos%f&(pos%ppos%v(   Vdrawmoder  lr  r2  Vlastpoint0doneprmotion%px08Pdonephpos%t8Vundrawmode&Vinterpdpos%f&(pos%ppos%x(   Vundrawmoderr2  lr   "Vinterpd&f".gtsize%2ofset%pcodes%v&z22func%pofset%h.2*func%p@*donepF&\pofset%vr&`pofset%vF Rfunc% TPofset%xlofset%x&\l&`PT`4lr,ofset%xlofset%xlXgettext`T`4lr,ofset%xlofset%xlXgettext`Tjofset%xlofset%xl&\l&\`yres%lljTofset%x lofset%xlofset%xlofset%x`yres%l&\l&`TRpat1%pofset%xrpat2%pofset%RBpat1%phpat2%jc@BLofset%xlofset%xl&\l&`LB<pat2%pc@pat2%p<2 pat1%lpat2%r2L~ofset%xlofset%xl&\l&`LVr lrpat2%pc@pat2%pV  TXpat1%pofset%xrpat2%pofset%xX( pat1%lpat2%(2pat1%p@2 r&\l&`lofset%`lofset%`dzyres%fllr lr T0pat1%p&\rpat2%p&`0&editmode@&8Tllscrwid%lscrhgt%88"lf*PATTERN :- &\*,&`8Vll  T &editmode@&8Tllscrwid%lscrhgt%8&\l&`l:"lf*FLOOD FILL @ &\*,&`:VllB,&pofset%`,f&j@pat1%pvd&` frpat2%p&b fN pat1%lpat2%r&\l&`lr lN   .   6Vreassemdfunc%l&l&f6hofset2%pfunc%rofset2%vp&rofset2%vp&hNofset2%pofset2%vrntal%pntal%vN  Vminimise(textptr2%ptexts%(2&profset2%pcodes%2ntal%px   &p&v2ofset%pcodes%v&z2(func%pofset%(4func%jf&tno%4$&lno%@$F&\pofset%vr&`pofset%vF.Rdfunc%h.f.Tofset%xp@Vreassemdlofset%xlofset%xf,Vreassemdl&\l&`f,T4VreassemtextdlXgettextf4T4VreassemtextdlXgettextf4TTVreassemdlofset%xlofset%xfT,Vreassemdl&\l&`f,TTVreassemdlofset%x lofset%xfTTVreassemdlofset%xlofset%xfT,Vreassemdl&\l&`f,ThVreassemdofset%xlofset%xlofset%xfh4Vreassemdfunc%l&\l&`f4TTVreassemdlofset%xlofset%xfT4Vreassemdfunc%l&\l&`f4T4Vreassemdfunc%l&\l&`f4T 4Vreassemdfunc%l&\l&`f4    &tno%*textptr%ptextptr2%* no%pntal%  :Vreassemtextdfunc%ls$f:RVreassemdlofset%xlofset%xfR(textptr2%ps$(ofset2%pfunc%rofset2%vpgteff%rofset2%vpgtsize%rofset2%vptextptr2%xtexts%,ofset2%pofset2%v,>textptr2%ptextptr2%vs$v>(ntal%pntal%v(  Xgettext2ofset%vt@2Dgtsize%pofset%vr.gtsize%DDgteff%pofset%vr0gteff%D  Dtextofset%ptexts%vofset%vD,text$ptextofset%,ptext$4J(-------PRESCRIBE Creation-------------4Vmaketext 6 naction%p*[2][|Click on the type of|file you wish to create.][ASCII|COMMAND|CANCEL]lfn 4 ,action%p@,(filetype%paction%( 6 action%p*[2][|Click on 'MARK' if you|wish to define a reference|point on the diagram.][MARK|TOP LEFT]lf 4 vaction%p@VmarkBxref%pryref%prVendmenuvbutstat%p&dev$p*D@& 6 *myfile2$p*QUICKPIC.PRS*<pmypath2$rmypath2$pv**.PRS<@mypath2$lmyfile2$lbutstat%@0Pmypath2$lfj*\0Lmypath2$pmypath2$ldmypath2$fxfL  pmypath2$lmyfile2$l*.fp@myfile2$pmyfile2$lfv*.PRSl 4   6butstat%@Vmakefile62Vreplotr&pxr&px2  6 portrait$Llll$6 landscape$Lll"l$$VmarkVendmenuVwaitzero2rVmouserbutton%j2.xref%p&ryref%p&.  Xfontfdor$p*P@NportraitBNlandscapeffont%:xscale%n@font%::xscale%n@font%::xscale%n,@font%:pfont%Vmakefile Rdev$ T*Dmyfile2$,file%pmyfile2$,T*S"file%pr8"T*Rfile%pT*Pfile%p  6fpat1%pxrfpat2%px66oldfpat1%proldfpat2%p6Lfiletype%p@file%l*command / tLfile%l*!R!RES;UNIT P;FONT vdXfontfv*;SPD vspdv*;STM vtpmarv*;SLM vlfmarv*;v> v> t&&pxrcn%p&   &p&v2ofset%pcodes%v&z2(func%pofset%(4func%jf&rno%4$&lno%@$F&\pofset%vr&`pofset%vFBdfunc%h.fj@VcomchB.Rdfunc%h.f.Tofset%xp@file%l*MAP vXsxdofset%xxxref%fv*,vXsydofset%xxyref%fv*;tȀtfile%l*DAP vXsxd&\xxref%fv*,vXsyd&`xyref%fv*;ttTfile%l*MAP vXsxdofset%xxxref%fv*,vXsydofset%xxyref%fv*;tJfile%l*TEXT v>"vXgettextv>"v*;tJTfile%l*MAP vXsxdofset%xxxref%fv*,vXsydofset%xxyref%fv*;tJfile%l*RTXT v>"vXgettextv>"v*;tJTfile%l*MAP vXsxdofset%xxxref%fv*,vXsydofset%xxyref%fv*;t>file%l*CIR vXsxd&\fv*;t>T4fpat2%prfpat1%p4~Xpatchk@file%l*FPAT 255,255,255,255,255,255,255,255;v> v> trVcomch~file%l*MAP vXsxdofset%x xxref%fv*,vXsydofset%xxyref%fv*;tfile%l*ARC vXinraddofset%xfv*,vXoutraddofset%xfv*,vXkangd&`fv*,vXkangd&\fv*;tTVfpat1%pofset%xrfpat2%pofset%VDfpat1%phfpat2%jc@DNfpat1%poldfpat1%rfpat2%poldfpat2%Nfile%l*MAP vXsxdofset%xxxref%fv*,vXsydofset%xxyref%fv*;tfile%l*BOX vXsxd&\xofset%xfv*,vXsyd&`xofset%xfv*;tB@fpat2%pc@fpat2%p@RXpatchk@file%lXfpattrVcomchRfile%l*MAP vXsxdofset%xxxref%fv*,vXsydofset%xxyref%fv*;tfile%l*BLK vXsxd&\xofset%xfv*,vXsyd&`xofset%xfv*;t  T\fpat1%pofset%xrfpat2%pofset%x\RXpatchk@file%lXfpattrVcomchRfile%l*MAP vXsxd&\xxref%fv*,vXsyd&`xyref%fv*;ARC 0,vXsxdfunc%`fv*,0,360;t  Vdfunc%h.fj@file%l> v> tVJoldfpat1%pfpat1%roldfpat2%pfpat2%Jdev$p*S@cn%pcn%vrcn%p @cn%prdummypB  &rno%Hfiletype%p@file%l*RES;tHLfiletype%p@file%l*command / tL2file%l*EXIT;v> v> t2file%8dev$p*S@dummypB8  VcomchLfiletype%p@file%l*command / tL  Xfpat"&l&l$.l$0" l"~Xlll"* fpat1%lfpat2%*"~Xllll" &p &p $.p&zvX$0p&zdR$.l$0fvR$.l$0vfvR$.vl$0fvR$.vl$0vfft@<&vpl&   fptrn$p*FPAT  &p Nfptrn$pfptrn$vddjvPz&vNffv*,N  ffptrn$l*0,0,0,0,0,0,0ft@fptrn$p*FPAT 1,0,0,0,0,0,0,fRfptrn$pfptrn$vddjv~ffv*;v> v> Rpfptrn$fXpatchkpdfpat1%joldfpat1%ffpat2%joldfpat2%ff Xkangd&f "(TpZxd&| f"0(Tn@(Tp(Tvh0V$pd(TfpV$ Xinradd&f <&Tp zxscale%z&`scrwid%<*(Tp&T| xspd|*X$p(TpX$"Xoutradd&f"<&Tp zxscale%z&`scrwid%<*(Tp&T| vspd|*X$p(TpX$Xsxd&f2&Tp zxscale%z&`2(Tp&T| N(Tp&T@X$p&TBX$p(TNpX$Xsyd&f@&Tp zyscale%z&zyres%`@(Tp&T| N(Tp&T@Y$p&TBY$p(TNpY$VdumpPdor$p*Lfdor$p*l@Vdump2rPVendmenuVrev*&`p*&&p&`&`v&F2ll3ll l llZllF &p bxssp&ryssp&rstartdumpr2lpssb   .2ll3ll l .  2ll@Vrev  Vdump2VendmenuVrev.2ll@ll3l. &pO .2ll*lll.4&pXr2lr4,&px,0byte%pdjv&vPz&f02lbyte%  2l l   2ll@Vrev  Vassemcode mcodel. xssl yssl pssl( passp($G passl*W-L-$G mcode (itinG 6ptsinG  DinitG. RgtpixG.0 dstartdump@blpss0A Dinit Bitin(GflG  "Bptsin(GflG "AxsslGAysslGA RgtpixAvblGGbn0@Ublpss pn0AblGAUGlyssAysslGAxsslGA RgtpixAvblGGbn1@Ub@lpss |n1AblGAUGlyssAysslGAxsslGA RgtpixAvblGGbn2@Ub lpss n2AblGAUGlyssAysslGAxsslGA RgtpixAvblGGbn3@Ublpss n3AblGAUGlyssAysslGAxsslGA RgtpixAvblGGbn4@Ublpss n4AblGAUGlyssAysslGAxsslGA RgtpixAvblGGbn5@Ublpss n5AblGAUGlyssAysslGAxsslGA RgtpixAvblGGbn6@Ublpss n6AblGAUGlyssAysslGAxsslGA RgtpixAvblGGbn7@Ublpss n7 G   4  ,PROG1.BSCPROG2.BSCPROG3.BSCPROG4.BSCPROG5.BSCPROG6.BSCPROG7.BSCPROG8.BSCPROG9.BSCPROG10.BSC<<<<<<<<<<A:\*.BSCab Hz/:NuH z0(2(@g4"P&1::g*g2g:ftgl`2g\`NgL`g<`.E\@f#`@Y@j0(Y@1@`,E0Y@j0(Y@XBhmBBhf1@LNu,X.6H*2( 6^VjTzVb&$N Hf($*  n| 60X2 `\V"8"&Z,NNN  $ L& " J, 2^nP ZV 4n  $ rT* l 0D>L  " >: RR8N".$B.d Dbn^jX2 8*  v2`ll|:D.D&|"(8BBBP&&LHJHNLHJH$., THJH*&.ZR PFHH@ (0\HxT0&TDL R$6.* $`K&|`Nqz8<6<v><4<|(o*lNN55~N+| <*~N:*><H+G><}H+G*><=A .vAN><=A .vAN><=A .vAN><=A .vAN* ><=A .v!N><=A .v!N* N4*N"N*N"Np- ********************************************N=>-NJGf`,Nq>- RGNv;G >- =A .vANt-.-$ ^ * .-$ G>=>-NJGf`,Nq>-"RGNv;G">-"=A .vANt-.-$ ^ *!A$N`\Nq*#~NNJGg`Nq*%N"NpF Please move mouse to another random stationary position on screen andN-0=~A2N`lNq*.~NN;G*/~=>- =~A8N`~Nq*0>-8=A .vANt G. G>=>-NJGf`6Nq>-8=A .v!Nt->-8=A .v!Nt G>RGNv ^0*1A8N`Nq*2~NN;G*3~=>-"=~A8N`~Nq*4>-8=A .vANt G. G>=>-NJGf`6Nq>-8=A .v!Nt->-8=A .v!Nt G>RGNv ^0*5A8N`Nq*6A2N`Nq*8;m0>*9~=>- =~A8N`|Nq*:>-8=A .v!Nt G>=>->NJGf`8Nq>-8=A .v!Nt G>;G>>-8=A .vANt G.+G@*;A8N`Nq*<N"N*>;m0D*?~=>-"=~A8N`|Nq*@>-8=A .v!Nt G>=>-DNJGf`8Nq>-8=A .v!Nt G>;GD>-8=A .vANt G.+GF*AA8N`Nq*CN"Np/ Please press and hold down both mouse buttons.N-JNJGf`,Nq>-LRGNv;GL>-L=A .vANt-.-$ ^ *JA$N`Nq*LN"Np THANKSN-L=~A8N`Nq*S>-8=A .vANt G. G~=~^=>-JNJGf`>Nq>-NRGNv;GN>-N=A .vANt->-8=A .vANt G. ^ *TA8N`zNq*VN"Np THANKSN-N=~A8N`Nq*_>-8=A .vANt G. G~=~^=>-JNJGf`NqN"Np QuickCAD button address : N<>-8=A .vANt G.NNTNpHex N<>-8=A .vANt G.NTNNN<N@*y~N +GT*z~N*|.-T-~H&Nf-~HޞNv-A .v!N*~~=A .v!Nt+GX*Np QUICKCAD.ACC-.-XNn*.-X-.-TޞNv+G\Np2< N*.-X-.-\-~HA$N`FNq*.-$ G~;G2* mx2g` NqN`*A$N`Nq*A .-NpNJGf` NqNt*N*Np2<N*.-$-.-$-~HޞNv-~HA`N`DNq*A.-.-` G~NNN2<N*A`N`Nq*A.-Npxpmous%=NJJGf` NqN*Nu*.-$+Gl*.-l-~1HޞNv+Gp*Np2< N*.-l-.-p-~HA`N`DNq*A .-.-` G~NNN2< N*A`N`Nq*N"Np --->-A .N-Np<--- Old ValuesNN-A .N-Np<--- New ValuesNN-tRGNv;Gt*.-`-A .->-tNNN ^*A`N`Nq*Np QUICKCAD.ACC-.-X-.-TN*Nu*~N O/0C0<HЈ",Іd䒆 Ь `H`// Bg?<JNAO JfLEA@,A0,Hp!!!.HA 0D"MBQ;@+F +LfSE;ED;D CaHNHz+_>2Ho8 ^("hajSoRgSe(`x"Dp!aT.Nua<H ^Jk ga^c R--`.Nua`a G("hapψa h`H *-JcaVJgbS/ Ř*bSS H@J@f2 H@J@f*SWfJkSH` VLfˉ`pH@SWgd`JkSH` VLfږd`aHafXgXSeTaaVf>d`8<ae <{dNuafgSetHB Vfd`z`z Ga ^.`aJfgSetHB Vf֘d`ac`ad`a e`ab`aSe Se gNuJNu G&$P(<Ƅ VȐ"hNu Gan("P~gNuaRxa.Nu H@g(Jg$HAJ@gJAfHA`JAgH@HAJAf ށeNu~NuDNu$JnDJnDai JkJjDNuJgF //JjDJjDp"~ҁU@D@އeRQ jD jDNuNu^_HNu^]HNu^WHNu^fNu^\HNu^^HNu~Nu_HNu]HNuWHNufNu\HNu^HNu~Nu Gad4)k2BHҁC. Nuv!`:FBH*6HÖk&n"UDk>HǞkn"aևQ"`L` Ga JgH<fZxCiff4)C k2BCHUDk0BAҀQ8. NuHxCSDt =QaL`aj3ad a^ aX aR FBH*&k趙nUDk.k־n"aևQ"` GaFJgV<fxCift4)C kJ^f2BCHUDkJ^fx0BAҀQ8. NuHxCSDt -QaL` GJf.4-4/ x$Nr6ASAHDJDfHD0BkR@Q/ pgapC2 AA ?H؁a6222"8B2HR2 UAk0B22R@Q2prHASCd2`"Qd&_Nu2 4BSAA M BC p0 !Q&_ GJfb4-4/ H/~$Nz6ESE"kJRabQ( pgaC2 AA?H؁an222FY"."R: UEk"""Ra Q(*`0 Gan<f()avB`P,a(B_HNu,a(6]HNuWHNuVHNu,a(\HNu,a(^HNu H@GA6a G@VGa GUU|vGa"`$(*`A"a"Jvg mvNJga"`A a""a"JUgAa"~r2a"NuSe<dAa"bAJg"XJfS`LIBRARYSTARTUPOPENPEEK/POKEBLOAD/SAVESOUNDLOCATEINKEY$GEMDOSDIMARRAYBLITREDIMCVsMID$==MID$RIGHT$ASCINSTRPALETTEMALLOCMENUSCREENSQRTWINDOWJOYSTICKTIMEDATEMOUSELOG Y8 Runtime error at line in module on #A+HvNuA g<PdJfSfNuRETURN without GOSUBOut of DATAIllegal function callArithmetic overflowOut of memorySubscript out of rangeRedimensioned arrayDivision by zeroType mismatchString formula too complexRESUME without errorLine buffer overflowWrong number of dimensionsFIELD overflowInternal errorBad channel numberFile not foundBad file modeDevice I/O errorDisk fullInput past endBad record numberBad file nameToo many filesDevice unavailableDisk write protectedPath/file access errorPath not foundBREAK pressedFatal bus errorFatal address errorApa+@0Apa+@(Apa+@,NuaHm|9|rPJ-6fr(A|a>ra(rwa"Q"B,#`H Lpa#L (IL)HNu l p`>&_|dVA``&FLLn0kN0SN0kNp*JgHP0SNL fS`NuzpgH P0SNL f < gR`"NupJgH P0kNL fS``<daTa@pNupDNu`aHz<d̰<g a"Ra`-5f -5fNuH?<?<NMXJ@gN/<NMX-5g<g,-5g*<f$/<NMX<g-5g<faM+@LNuJ,"gHrazrfatLNuHradrf,"aZLJNu<dA`HL.6H>HHHHd Q"aapNuP"pNuQ"pNur,#pNupDNuB,B,#rarE`pNu|dp,@dAB#A B H`rarYaL8a`/ Jikrarba"W2)a2A av"WJikrahrcab"_2)aA `RXpNuAAJ-6g -6gA0Nu    H @rareaLx*&I/ at&_< gT< gN<g <g< eںgHR/ a|&_`JgSJ,gS,/ rar ara&_`r ar a"p@Nu?,?<NMX<f lf -5frpNu?r aFr ax2< gp< g4R,,g,e lf< d<g<d<dp`0,<f< f ,#dR,#A???<NM\Jlg pNuB,`Rgp9Nu0,??<NMXrJfrpNuSgSgUg|SgpDNu&fvRBg/?<=NAJkb8>N?|NAJfPP0(<(؃Aa:)mV)C)C$)C |||9@p)@@)@NuPH`t9+@8lAgf LNuF5LCKKBg/?<NAXapNu`8,<d$ gA @N.T@(eа|dA``tp<gJf",gaBf atrpNur)ApNuHl(/, ??<?NAO Jk)@gB$Nup>Nua ,$e agp>)@NuA(r0R<gR$pNua",g$S)AS$dBg?/?<BNAO JkavpNua|pDNuat?(,$gA($e(٬a8)l$Jg$/ /??<?NA"/O Jk$ѬfLpNua$< g4< g2R,,g(,d"B O | ApB,aXNuB,I? OpaTNuJg&//??<@NA$/O "Jkpgp=Nup"Nua  IJ,f6,Sev H x ggRQdAL0`r`Jg, I,< g< gReSf C`Zv`SH @vapAaBLgNu fXp6Nufp6XNuaB$BSt QdBg?/?<BNA"/O f Hl(/,??<?NAO Jkgr)ApNuaB$Bg?/?<BNA"/O Jl |fZ/?<?B?<BNAO "Jk@g(*HEJEgpH@ @ajf(SE`HE  |aVf ,B$A(aDfNu` f$Jj", R $,Ga"GA( ,NuXp6Nu?<?B?<BNAO /?<?B?<BNAO "&Bg?/?<BNAff$, `$/`$,"O pNua Tp6Nu< g,< gR,,g,e&,$d 8(R$pNuB,`?r ar a2`p2Nu",pNuPRT:AUX:MID:KBD:LST:H@b0HCAa+mj+mnNuBm;| Ap 0Q0BmpNBT@g$pMa;@p-6T@;@0<da0-f:pMa;@;|0<da0-faHCannot open workstation;@;@BX+m^\BmBmp&at;mTpm;@VBm;|Bm;|p'aJBm;|;|pa4Bm;|Bmpa NuQ7a -gBm+@paBBm;|pzaa,BmBmpeapa`2pD`p4ONu/ H0@az0/|bCHI o f"+|phaADC1111/HC2"X"\pda|k(<6A"a9@;@&|B,B,#9m "o B2B.Jo g& Iaa R/ a)H."_HaB"l.;l;|+IpiaRmA+HpiaL 8A0P0000pea;|phaL@ASBSCHHJJ-7fa|p0,lT@C$"V#zV3zTapNu;|;|A+H+H;|A"    A"Nu0,2,l4,6mVA`6420ll@AH";|Bm;|p aXpNup;|;|;@LCBllH" H@+@p apNup fpBm`0j 0,(RBg0,&/aLL a$0,(Bm;|;@papNuLCBBm;|llllH"papNu;|;|;|llH"pgatpNup,@d$ATRBV0lld HpNupNuA$C p2!k0TQC$/ (IBm;|;\0<a;\0<a;\0<a;\0<a;\0<a(_pNu;l;|A1111pia;|phaL@ASBSCHJ-7fa2lfLHJajpNu0a:8ABX0 BL\R@RAHplabCFA33330Dp!`ZahpaP2)NuHJ-7f"A<+H+|;|0pagLNu40. a "N nM4vaf;H.Nuv`|d@0@Nua^0a`np@gJGjS@DG??NMX.Nua@fHGNuJGk|dV;GpNa|4`:B-4`|d4BmBmԾ|gp|aDG0;p>5Nu0<a0>-^Nu^agR/?<HNA\Jgf @Nu/?<INA\Jgaߒ3aߌa0|JgB0A4</va`, Compiled with Power BASIC 0<rtva0f;H$;H.A0<rtvafNuaDLST:4H>a6 Va2"0 I0af ^`v` naSfXv<Igv<Ogv<Rgv<Af2HCt4>.ab6 Va"0HC Iaf ^aАT ^`Јa~6v`ޖa.paf fzpra`n0|aSH0fNuJGo |d0GNu0Gp4`;m.$Nua;G$Nu;|$Nu GaB$0m$pa G`p0m$atHA86HBrBDHAJAgHAJCgAcVB8SDpr aDQNuJGo8SD0m$`JGkg.p0m$a gJBgHGJGgHBRBBdBSGHzCt0m$p` H"Ck^g2k8<d,&B<ރeNuRid~S<Nu.NuJNu<oD&B<ރeNukgvgPk<<d&B꫞kBSbHGއ[kgNu~Nu<oD&.<`DgjD`Jj Jjf NufNuMC68343 FLOATING POINT FIRMWARE (C) COPYRIGHT 1981 BY MOTOROLA INC.D<147 45 6((KXKXbb66KXK666K(KOOmmhmrmm,h"m,rmcm"   6r6J@J67<(GnnW   %2-`vv/ / $r B1 M=[  K]}i eCY7}s9jlvGfjG17IoRbU} O   t  z Ow r R @Q |P !O ${ 'afg1234567891011121314311.513 .  S..  SKMR_D060PRG S KMR_XXXXPRG S KMR_XXXXS S l7`n*O.|j*m - ЭЭ// ??<JNA B?< NA\#(|6*|."U Qg"?</NAT#/<?<NA\?<7/<?<NNAPJfrB |Ak"<b3333BB |g$<.g0k < l G`Jg` <d#/9?<NA\ 93t "ҹ2l|#r#v#~ |"U~"Q yN" #r"2#v"#~ U2093/9?< NA\BgNA ofpNu of 9.Nu of y."or2/ p 0/ $ f(/fI2< QSfNu/fI2<?QSfNuNNN\AUTO\KMR_*.PRG8$ @* Z`n*O.|j*m - ЭЭ// ??<JNA B?< NA\#(|6*|."U Qg"?</NAT#/<?<NA\?<7/<?<NNAPJfrB |Ak"<b3333BB |g$<.g0k < l G`Jg` <]#/9?<NA\ 93t &"ҹ2l|#r#v#~ |"U~"Q yN" #r"2#v"#~ U2093/9?< NA\BgNA $ ofpNu of 9.Nu of y."or2/ p 0/ $ f(/fI2< QSfNu/fI2<?QSfNuNNN\AUTO\KMR_*.PRG8$ @* Z* KMR_XXXX.PRG * Reset survivable RAM DISK with filename configuration. * Modified by Kevin Millican - October 1989 * This program is in the public domain and may be freely copied. * This Program is a modification of the Public Domain Program ETERNAL, * and was adapted from the ERAMXXXX.PRG variant. The only difference * between this and the ERAMXXXX.PRG program is that the cluster size is * 512 bytes instead of 1024 bytes; particularly useful if you have a lot of * small files held in a ram disk (e.g. help files). * What this modified version does is to READ what drive number and size * the ram disk should be from its own filename. * The search string used by the sfirst gemdos call is "\AUTO\KMR_*.PRG". * For a ram disk 'D' of size 100K you would rename this program to * KMR_D100.PRG, put it in the AUTO folder and cold boot (switch on). * The sfirst search attribute is $37, which searches for files and folders, * so you could rename this program to anything you like and create a * folder or file with and acceptable file name as above. * If an incorrect filename is found or sfirst returns an error or a 0 * size, the program defaults to drive 'D' of size 349K. * Do not forget to install the drive on the desktop and then save the * desktop. * Absolute Default Values default_device equ 3 Default device number ( 3 = D ) default_size equ 349 Default ramdisk size ( 1K units ) magic equ $200 Used to detect restart * Absolute Memory Locations reset_vector equ $004 membot equ $432 memtop equ $436 phystop equ $42E hdv_bpb equ $472 hdv_rw equ $476 hdv_mediach equ $47E drivebits equ $4C4 * DOS Codes Mshrink equ $4A Super equ $20 Fopen equ $3D Fclose equ $3E Fread equ $3F ************************************************************************** program_start movea.l a7,a5 save old stack ptr movea.l #stack,a7 new stack movea.l 4(a5),a5 get address of base page move.l 12(a5),d0 compute length of program add.l 20(a5),d0 add.l 28(a5),d0 add.l #$100,d0 move.l d0,-(a7) size move.l a5,-(a7) mem move.w d0,-(a7) zero move.w #Mshrink,-(a7) return unused memory trap #1 DOS adda.l #12,a7 pop stack clr.l -(a7) set supervisor mode move.w #Super,-(a7) Super trap #1 DOS addq.l #6,a7 pop stack move.l d0,old_ssp save old SSP movea.l #memtop,a4 movea.l #phystop,a5 movea.l (a5),a1 cmpi.w #magic,(a1) beq restart move.w #$2F,-(sp) get current dta trap #1 addq.l #2,sp move.l d0,current_dta save current dta move.l #my_dta,-(sp) set up my dta move.w #$1a,-(sp) trap #1 addq.l #6,sp move.w #$37,-(sp) find this programs own filename move.l #filename,-(sp) move.w #$4e,-(sp) sfirst trap #1 addq.l #8,sp tst.l d0 bne size_error error use default size and device find_device_letter clr.l d0 move.l #my_dta+34,a0 point to device letter in dta move.b (a0),d0 get drive letter from filename sub.b #$41,d0 convert letter to a number bmi get_size if < 0 (A) use default device D cmp.b #15,d0 bhi get_size if > 15 (P) use default device D move.w d0,device_no save device number move.w d0,rd_mediach+2 modify this code move.w d0,rd_bpb+2 with the device number move.w d0,rd_rw+2 *** auto size this program from its own filename * using the 6th, 7th, and 8th, letters only, * but they do not all have to be there * zeroes and leading zeroes are accepted get_size clr.l d7 d7 = letter to convert clr.l d0 d0 = number result move.l #my_dta+35,a0 point to first letter auto_size_loop move.b (a0)+,d7 get first letter from filename beq got_size finish if 0 (end of filename) cmp.b #$2e,d7 compare with "." beq got_size branch if end of filename sub.b #$30,d7 convert letter to number bmi size_error branch if < 0 to error cmp.b #$0a,d7 test for > 9 bge size_error branch if > 9 to error mulu #$000a,d0 multiply by 10 add.w d7,d0 add new result to previous result bra auto_size_loop loop and do other letters got_size asl.l #1,d0 multiply by 2 (smaller clusters) tst.l d0 beq size_error if size = 0 use default 349k bra restore_dta size_error move.l #default_size,d0 file not found, default size restore_dta move.l d0,save_size save the size number move.l current_dta,-(sp) reset current dta move.w #$1a,-(sp) set dta trap #1 addq.l #6,sp move.l save_size,d0 move.w d0,numcl put number of clusters in bpb moveq.l #9,d2 multiplier = 512 not 1024 lsl.l d2,d0 d0 = ramd size in bytes add.l #9216+512,d0 leave space for boot sector * + FAT + root dir + BPB + driver move.l d0,d1 leave at least 128K for user add.l membot,d1 add.l #$20000,d1 cmp.l (a4),d1 bge.s exit sub.l d0,(a4) okay, so reserve memory sub.l d0,(a5) move.l hdv_bpb,old_bpb+2 save hdv_bpb vector move.l hdv_rw,old_rw+2 save hdv_rw vector move.l hdv_mediach,old_mediach+2 save hdv_mediach movea.l #driver,a0 copy drivers to reserved memory movea.l (a5),a1 moveq.l #127,d7 move 512 bytes L4 move.l (a0)+,(a1)+ dbf d7,L4 movea.l reset_vector,a0 force a reset jmp (a0) restart move.l (a5),d1 add.l #rd_bpb-driver,d1 move.l d1,hdv_bpb set hdv_bpb vector move.l (a5),d1 add.l #rd_rw-driver,d1 move.l d1,hdv_rw set hdv_rw vector move.l (a5),d1 add.l #rd_mediach-driver,d1 move.l d1,hdv_mediach set hdv_mediach vector movea.l (a5),a0 mark ramdisk as present adda.l #device_no-driver,a0 move.w (a0),d1 move.w drivebits,d0 bset d1,d0 move.w d0,drivebits exit move.l old_ssp,-(a7) leave supervisor mode move.w #Super,-(a7) trap #1 addq.l #6,a7 clr.w -(a7) exit using Pterm0 trap #1 * Following bytes moved into high memory * ramdisk bios parameter block even driver: recsiz dc.w 512 physical sector size in bytes clsiz dc.w 1 cluster size in sectors clsizb dc.w 512 cluster size in bytes rdlen dc.w 14 root dir length in sectors fsiz dc.w 10 FAT size in sectors fatrec dc.w 12 sector # 2nd FAT start datrec dc.w 36 sector # data start numcl dc.w $01EC number of clusters (filled in above) bflags dc.w 0 rd_mediach cmpi #default_device,4(a7) mediach handler bne old_mediach moveq.l #0,d0 rts rd_bpb cmpi #default_device,4(a7) bpb handler bne old_bpb move.l phystop,d0 rts rd_rw cmpi #default_device,14(a7) rw handler bne old_rw movea.l phystop,a0 adda.l #512,a0 start of ramdisk data area movea.l 6(a7),a1 buffer address moveq.l #0,d1 move.w 12(a7),d1 logical record number moveq.l #9,d0 2^9 asl.l d0,d1 adda.l d1,a0 + ramdisk base = sector address move.w 10(a7),d0 sector count move.l a1,d2 is buffer address odd? btst #0,d2 bne.s L8 yes, then branch btst #0,5(a7) check mode bne.s L6 branch if write exg a1,a0 read, so copy other way round L6 move.w #15,d1 loop 16 times L7 move.l (a1)+,(a0)+ move 32 bytes quickly move.l (a1)+,(a0)+ move.l (a1)+,(a0)+ move.l (a1)+,(a0)+ move.l (a1)+,(a0)+ move.l (a1)+,(a0)+ move.l (a1)+,(a0)+ move.l (a1)+,(a0)+ dbf d1,L7 subq.l #1,d0 decrement count bne.s L6 loop if more sectors to move rts L8 btst #0,5(a7) odd address buffer, use slow move bne.s L9 branch if write exg a1,a0 read, so copy other way round L9 move.w #63,d1 loop 64 times L10 move.b (a1)+,(a0)+ move 8 bytes move.b (a1)+,(a0)+ move.b (a1)+,(a0)+ move.b (a1)+,(a0)+ move.b (a1)+,(a0)+ move.b (a1)+,(a0)+ move.b (a1)+,(a0)+ move.b (a1)+,(a0)+ dbf d1,L10 subq.l #1,d0 decrement count bne.s L9 loop if more sectors to move rts old_bpb jmp 0 vector to old bpb handler old_mediach jmp 0 vector to old mediach handler old_rw jmp 0 vector to old rw handle even device_no dc.w default_device current_dta ds.l 1 save_size ds.l 1 filename dc.b "\AUTO\KMR_*.PRG",0 even my_dta ds.b 44 old_ssp ds.l 1 * saved system stack pointer ds.w 200 * stack stack ds.l 1 end ************************************************************************** .  S..  STOS_DOS TOS S :+TOS2DOS DOC S !`+&|`Nqz8< 6< ><4<|(o*lNN55N+| <*Bm *><p=A .v!N*~=A .v!N+G *NpA2< NNp3.32< N*;|4 * NF* N(N* N(Np' TOS --> DOS v1.00 by Kevin MillicanNBN*N(Np' --------------------------------------NBN*N(N*N(Np' This program converts a standard ATARINBN*N(Np% ST disk so that it can be read by anNBN*N(Np' IBM-Compatible PC. It is Public DomainNBN*N(Np and may be freely copied.NBN*N(N*N(Np Options :-NBN*N(N*N(Np (A) Drive ANBN*N(Np (B) Drive BNBN*N(Np (2) DOS 2.0NBN*N(Np (3) DOS 3.3NBN*N(Np (G) GO !NBN*N(Np (Q) QuitNBN*N(N*N(N*N(Np$ Press 'G' to convert disk in drive -A .N-Np soNNBN* N(Np" that it can be recognised by DOS -A .NNBN*"~HN(NN2< N*$A .-NpANJGf`NqBm NpA2< N*%A .-NpBNJGf`Nq;| NpB2< N*&A .-Np2NJGf`NqNp2.02< N;|, *'A .-Np3NJGf`NqNp3.32< N;|4 *(A .-NpGNJGf` NqN**A .-NpQNJGf`Nq*,N*/.- />- ?~?~?~?~?N O*/;G *0>- JGf`NqN*1.- -><N ^*2.- -~HޞNv->- N ^*3.- -~HޞNv-><N ^*4.- -~HޞNv G~;G *5.- -><HޞNv->- N ^*6.- />- ?~?~?~?~?NO*6;G *7>- JGf`NqN*8Nu*9~N O/0C0<HЈ",Іd䒆 Ь `H`// Bg?<JNAO JfLE>A@,A0,Hp!!!.HA 0D"MBQ;@+F +LfSE;ED;D CaHNHz+_>d`8<ae <{dNuafgSetHB Vfd`z`z Ga ^.`aJfgSetHB Vf֘d`ac`ad`a e`ab`aSe Se gNuJNu G&$P(<Ƅ VȐ"hNu("hNu/ a@ _` H@g(Jg$HAJ@gJAfHA`JAgH@HAJAf ށeNu~NuDNu$JnDJnDai JkJjDNu GaV4)k2BHҁC. Nuv!`:FBH*6HÖk&n"UDk>HǞkn"a^ևQ"`L` GaJgH<fZxCiff4)C k2BCHUDk0BAҀQ8. NuHxCSDt =QaL`a3az at an ah FBH*&k趙nUDk.k־n"aևQ"` Ga8JgV<fxCift4)C kJ^f2BCHUDkJ^fx0BAҀQ8. NuHxCSDt -QaL` GJf.4-4/ x$Nr6ASAHDJDfHD0BkR@Q/ pgabC2 AA ?H؁a(222"8B2HR2 UAk0B22R@Q2prHASCd2`"Qd&_Nu2 4BSAA M BC p0 !Q&_ GJfb4-4/ H/~$Nz6ESE"kJRaQ( pgaC2 AA?H؁a`222FY"."R: UEk"""RaQ(*`0 Ga`<f()ahB`B?aBJg0if$Ip0Nua a H@GA6a G@VGa GUU|vGa`(*`A"abJvg mvNJgaN`A aD"arJUgAa2r2a^NuSe<dAaAJg JfS`LIBRARYSTARTUPOPENPEEK/POKEBLOAD/SAVESOUNDLOCATEINKEY$GEMDOSDIMARRAYBLITREDIMCVsMID$==MID$RIGHT$ASCINSTRPALETTEMALLOCMENUSCREENSQRTWINDOWJOYSTICKTIMEDATEMOUSELOG Y8 Runtime error at line in module on #A+HvNuA g<PdJfSfNuRETURN without GOSUBOut of DATAIllegal function callArithmetic overflowOut of memorySubscript out of rangeRedimensioned arrayDivision by zeroType mismatchString formula too complexRESUME without errorLine buffer overflowWrong number of dimensionsFIELD overflowInternal errorBad channel numberFile not foundBad file modeDevice I/O errorDisk fullInput past endBad record numberBad file nameToo many filesDevice unavailableDisk write protectedPath/file access errorPath not foundBREAK pressedFatal bus errorFatal address errorApa+@0Apa+@(Apa+@,NuaHm|9|rPJ-6fr(A|a>ra(rwa"Q"B,#`H Lpa#L (IL)HNu l p`&_|dVA``&FLLn0kN0SN0kNp*JgHP0SNL fS`NuzpgH P0SNL f < gR`"NupJgH P0kNL fS``<daTa@pNupDNu`aHz<d̰<g a"Ra`-5f -5fNuH?<?<NMXJ@gN/<NMX-5g<g,-5g*<f$/<NMX<g-5g<faM+@LNuJ,"gHrazrfatLNuHradrf,"aZLJNu<dA`HL.6H>HHHHd Q"aapNuP"pNuQ"pNur,#pNupDNuB,B,#rarE`pNu|dp,@dAB#A B H`rarYaL8a`/ Jikrarba"W2)a2A av"WJikrahrcab"_2)aA `RXpNuAAJ-6g -6gA0Nu    H @rareaLx*&I/ at&_< gT< gN<g <g< eںgHR/ a|&_`JgSJ,gS,/ rar ara&_`r ar a"p@Nu?,?<NMX<f lf -5frpNu?r aFr ax2< gp< g4R,,g,e lf< d<g<d<dp`0,<f< f ,#dR,#A???<NM\Jlg pNuB,`Rgp9Nu0,??<NMXrJfrpNuSgSgUg|SgpDNu&fvRBg/?<=NAJkb8>N?|NAJfPP0(<(؃Aa:)mV)C)C$)C |||9@p)@@)@NuPH`t9+@8lAgf LNuF5LCKKBg/?<NAXapNu`8,<d$ gA @N.T@(eа|dA``tp<gJf",gaBf atrpNur)ApNuHl(/, ??<?NAO Jk)@gB$Nup>Nua ,$e agp>)@NuA(r0R<gR$pNua",g$S)AS$dBg?/?<BNAO JkavpNua|pDNuat?(,$gA($e(٬a8)l$Jg$/ /??<?NA"/O Jk$ѬfLpNua$< g4< g2R,,g(,d"B O | ApB,aXNuB,I? OpaTNuJg&//??<@NA$/O "Jkpgp=Nup"Nua  IJ,f6,Sev H x ggRQdAL0`r`Jg, I,< g< gReSf C`Zv`SH @vapAaBLgNu fXp6Nufp6XNuaB$BSt QdBg?/?<BNA"/O f Hl(/,??<?NAO Jkgr)ApNuaB$Bg?/?<BNA"/O Jl |fZ/?<?B?<BNAO "Jk@g(*HEJEgpH@ @ajf(SE`HE  |aVf ,B$A(aDfNu` f$Jj", R $,Gat"GA( ,NuXp6Nu?<?B?<BNAO /?<?B?<BNAO "&Bg?/?<BNAff$, `$/`$,"O pNua Tp6Nu< g,< gR,,g,e&,$d 8(R$pNuB,`?r ar a2`p2Nu",pNuPRT:AUX:MID:KBD:LST:H@b0HCAag (IpLNuLp4Nu8<0DaQNuH@af Hp0a L LJNu lN -f ?Nur`r ?/?/?/ ?/?/B//?NNO>Nu?Nu oaB/ 0/ S@??< NNPNu//?/ ?< NNPNur`Nur`r`r` oa|/ 0/ S@??<NNPNur`r`?/?/?<NN\>Nur`hr`d//?/ ?/?/?<NNO Nur `Rr!`@r"`2?/?/?<#NN\>Nu//?<$NN\Nur%` r&` r'`r@` ?NNT.Nu?/?NNX.Nu//?NN\.NuBfTOS_DOS.TOS - Program to convert most Atari format disks to a form readable by both ST and IBM compatibles. by Kevin Millican Really simple and quick to use but take care with unusual format disks and make a backup first - I can't take any responsibility for any errors and you use the program at your own risk. NEVER USE THIS ON AN AUTOBOOTING DISK UNLESS YOU ARE CERTAIN THAT THE DISK MERELY RUNS A PROGRAM IN THE \AUTO FOLDER. Most commercial games disks will be ruined by TOS_DOS.TOS If you use this program with a single sided disk you will find that it is necessary to use it again after writing any new information to the disk using the ST. The program works by substituting the boot jump address and by copying the media descriptor byte up into the first FAT table as required by MSDOS. This byte is not copied into the 2nd FAT table in case you wish to reconvert the disk using a sector editor so ignore FAT 1<>FAT 2 messages with disk analysis programs such as DLII. If you want to reconvert the disk copy FAT 2 to FAT 1 and zero bytes 0 to 2 on sector 0. If you don't understand this then I suggest you don't bother ! THIS PROGRAM IS PUBLIC DOMAIN - ENJOY ! #a000010 #b001100 #c7770007000600070055200505552220770557075055507703111103 #d #E BB 02 #W 00 00 16 01 1E 17 09 A:\*.*@ #W 00 07 36 02 15 0A 09 A:\*.*@ #W 00 00 0E 09 2A 0B 00 @ #W 00 00 0F 0A 2A 0B 00 @ #M 00 02 00 FF D RAM DISK@ `@ #M 00 00 00 FF A FLOPPY DISK@ @ #M 00 01 00 FF B FLOPPY DISK@ @ #C 01 03 00 FF c CARTRIDGE@ @ #T 00 03 02 FF TRASH@ @ #F FF 04 @ *.*@ #D FF 01 @ *.*@ #G 03 FF *.APP@ @ #G 03 FF *.PRG@ @ #F 03 04 *.TOS@ @ #P 03 04 *.TTP@ @ A selection of utilities by Kevin Millican. Each folder contains all files relevant to that particular utility. A dummy ASSIGN.SYS file is present in the root directory for use with G_SYS_ED.PRX which is in the \AUTO folder and can be activated by renaming to G_SYS_ED.PRG and rebooting. QuickCAD.ACC is in the root directory so that it boots up also. ----------------------------------------------------------- 0493 782176 (Evenings) .  S%..  SCAR1 TN1t &C*LUKE1 TN1t 1ROLLS3 TN1t 9^MATTY1 TN1t Q5COVENANTIMGt _I@DSLIDE PRGt pw3IMG_PIC DOC}wfUD3"ppw@pW:   &#/       & '   #;  7 15)ML(N$R! 5"413 85 9: =EE9F %[O>9 >8N3O6O=N&R"  7$ 638;7';<<=@0H0IMIK_???x~p/~g~~P~X>_@?`ċVVOWoܹwl#[-@ rc???~?s?\~26?3|?p@OYb#iA,ücá?=?skSWO________OOOosr`A?????y_/qm5+ w ;vΝ?  !?>?3? @?<??? ~|VdT֙Z+FВ x8?3?03kmu}~|~xd~Hl?  $5wژ~ ΍8cgGg'?___<~6 wx#s?*4,^s9+pa02wq@ @![>0 >??\^\XXXlNnO//'gGEEDTҼN!/'  (Wdd hK;-X~QZsnLsÜ8?=1e !Pf`@r?~|~ 9y<~#:~c^1 @xdv?@p0:@CD2~rN bD1`G~??; .8?<>/p00x`?`8LO'  d3A?w0D`ζΓ:O(@AZ;O#~cp`<T WDZ>@O!R8?@ 0 b0  {=>cp?0pt(e[l&-?*&,SZy#8? p3s2 <> ?1t5%]s .R8` @y@8@ & xOn޾o13?a L @}bx&a<}?`G?9H??|3>L & cszD3PC  x"`f>Ĕj l  4 D:L  ,ms}-pV}Mߠ> @>~33|'Ng! ͌P po0(0,  .-E]\Wpp;?::!dEU&(&?  qg|=??qy\G?+ ~]ècp"NM((9 FP0$>p`9g>X~kTI]? Q !ѽǹK9I™3N gbPt]=<p8@` 093#??????3?a?>Ph(8L'20 gќH8TyUGOo_^G@⠈loBAr 8  3''O??9~y~scG?a@<p  }f:G:C4100S c?e綹 1pJ@"WJ@ A?P( f_KMYYޣ* 7 @0??9?c|'?v>/9?1K^?q6ځc&Px IOCp߀0 P!vc7ZB?g#w? 9_0xF#??@ @@< 00p8  x ?('$0 $@???|?f `cGWC g2G;sx??~)*T@7p~ayxpx|x?>!x`| 0!e`S'@??p d@ Hȸ @H;Ξx?4!!av!{/?gcs|~|ppP 2AYNO????y>? c6" X`@y??;9998` `|0@N0 ~Q{s<810c AC?<|?=x?@_r>="0`??;@? & r?<? gPKx KDx گ ?p?{xA0|>??Ϗ{"6Q1bs,Rxy0????LA~ <`x0<  xpd2 0? H{HE332~0>8~!~C?0gpp ͰA0'p9<g~ 8?BG@O/)6 ?0??80v À80 x>qo ! a``Vv w  ?|<Ca0?`03s0?p8〣7}}30<xGccc~ pAq" , ( 6bE?68<? `@??0`_O_/7/o?|??@8@8c8<83 @!??|~G+ 1`@?fp? @ >&?~`~'wCG<x?8>??z<`????`| gb@@?@?0?|G%P< ??<?ΏӬ ? ~0p@@`~ |<?8 ?3?|??? ?   ?#??Î 88axpߟ|$???|>???>>81?>  ? @: ?????'???? `????d?? wfUD3"pwpwa D z"p -,< 0 *  %?8~#z& p7-,!+  $ "      :8| #& p7.,!G  8 3   ( E:   /zApN-X,\+!S$ER"z %+:W8M|:    0 @/??>  P@ >p P @  @ @ x?py???xy8`??0``@@Ch < ?i!?= 8?<`@0~<<x@ pppO0@pp19q0<?p#ݹ/_oN9`h sh#Tl ;.Gv~?27080Y8Cl,?hY:::$0bd`@0`lp@xZ5|4l똋Ss>s<?|<08p;oݎŻaAA'g=;ȟ0_^_#{q30~ n@M@>Xt< x@xo``<@`0<8<8xp€ƀx}2s+G'GN d|πG@` `0p8x<@@`h`< @@@@/ ///  /_?  /_?y??0H~? p 7w3=}???8?ߏ~~?x??`y??<`8???8?`@G :=y???|?? 40x??>~<<ppp>p?0???G8w?><<|O㿓~|c???:??;80 ????@@@ @@ 0 0000` ``@0`@0 0`??w `d" 88x?`@p>???p~|>???x> 00p??0<?| '?p|x~ x  ???9??88??|?`@ <?`??8~<<ppp0?c|??p?p<?f@0?~><8??0` ???|||>< 8`0 p0@0  `0 yp?`????~>??>p8??? ??C?????????wgfVUED43#"+ !#          !'       ( 0"2             )    V  >69L+ $   -     +  )    $   *  )  -ើ60=Ӏm07=>}9X@_80<c WO?aeW}?4{~||  #l='?9e3Dy#F}`kMoR3rv`xhat84 Ϗ =`x|Oob 8  @ I N)=p l5ayl ??əS'8-??_?> ;$~|y__Y?_GCvn/1;w kwO&n\N?O?bK^3LDp:;#G"C"{..>e|I?,< O(>WĘ> S Bc?jgZ/_ xox3y7 M ~мx砅Iv|ociſ~Ƀ 0cy? "0Cqp~"pgp@'Ã`~\C?$X7}y{dtSy$<@b? @C@g`?x XJ'4y>HIa#ݼ8o?{oφ_gn_.ޛa wߍC;/:8>? d27vyY#'>g }c4>7LC0OOR_K9i͈c(Z_b0qS*57&i0 7m=K]Oؿs?~)g O?x1}q# Ҵ vr7: Y>3 nd_o+<|1w 'S"x p(i?A7z77GZ7Ӏ0 ?'h]WudkmE:}eZ&8˷3N?W$?ݼk't*t87;w >I?7`nfߏj?C1A+4`;p;A6i \+ #H|o0ysE1C>&/.GA}s_Z>:"_-_| oB7XP=| #==G9|g3/V%+KϿpoؽ?5O$??<0?g_? fDx80#,]Mϧ?B! #\W, ^0}섐˷zAq5%Ӿqyڗ<$lO}qNʥ)O-}7}R y"s4wIz/$c_4HfLw&LeVT'ٝšSTկq OTB]ϺT?2c߆c|-lz?&t>q;cLύ>](I)KUʧv\Àmw٣Ǧ20,L$MW 2}]-z,s!S/ g j/]C_<Ҥo$< HT}Sӡg;]e'U~OU>o>zl]TW맾l*6%l"\O7;NA(t#p"pb϶m["fdOwءSK;.M?EDjg7Qυý@XH6pp~5QRS}sR-b<\?[ׄ5> kF4<7~?Co`C?#f O#y\\ִ>y?3vĔ^ݷ.j }]{#C(g8?D\pj|4彛AuXL ;|7 '?\ ?7gU\ &tvr'J2>ުv_'yt[ߌD'4Po]??.?tqI17҉O7̚"_O[{Mh@_/~b' 7o1<'`S5ǂvذg L( ;,tʀ$3'o•c ZۤCKѦGs/1 Uа?<58}y~Cn9|#>?4MG?u^7@}a:{J|?Y13̢t[=Rz("YOg .Ox>4˄SƿgvDKܪVϴ Tߔq vAVqY5x8],{7Q3_|gߩ̻?@}0n=E en`8} o 3viI4(vwַFf F.jJYXD~ szq{dGvy@ϫwOk{۹3[e/}7?GQ^i9wj`avn"Y)?Y֡a8>~!k_^xr^ߜ1Z܀XTkR'& 8|~([0=Úʆ7ϲqN0NS`=ݼm~q}>@`~m޾V`/aW6VtBt"S#i k)x-*MVs4swh#܏/_L ppÿ2|C3吇;@8;Q؋gMN?4(<_ھP?x?)G60ϫsK?  ? (D\?7ɾge 29X?7:^v/g!1pߴ+W13ah$l| )Oz\ן7mKBE{s(eFM.b1,?\O/0V7omgw3 ߃}kW_ -巽BWfdbھD;h ߛ?i#@=:U $4Qs߂]-S0-\=. $XFǹ\ 4]eo?/?_χ?J/{t?7!5$˟;"E`0Pװ?6gtgh{6q_Wj~iqq><џoݱ/#hlY(ѹ a硬w2CN޸A5|qFxs! Ӥq>; |1z8??ǡ~EZ2*øU_BrdPm,6jvz8  @;C/Ӯ>&"SӔz[g, W_)ԕ8Fw3< s O}܀X|jR6Q[KT9s|8'Fypw{D>/l)ԩ$2#駧g-?8E=3gO [H](cxLs Sx`@)j`lݷhc <[ozġXؠ$?;Oqot<4wdԹx'k&ސO?."V!/~gOx/J^+i$ lZx "@gXCOΨ+1)9rVFq'f3ݸ8V?-|>@<&/?w3Uy*JRygw/7?/Ͽ޲(N@J?e?v@???~{;8~> !9 X;.ҟ%ϷJp,r@󲈒zLyV}E~?< >w7} 'pȑO56Ro( |F8?0qH{dƄĺ4ZxO}SBy >1qPᝠvA` _~ L>/~?z1Gv?O>  GCs|>m/7vd N  a0z}0}9}|}>~~>C?8@ə8͸+X @`0 Pp}>??????_GG/OWgWWGW PGi%%$) 5m>m?>~g~x:?~:~=1= 3AC~WQW(όc0 ??@@@zx8^x xx@|^<8? !~? |?[d|~pcsp`<<@p0xπ/*O!C_^  #> 4~>q|G3 gp?C>~;{#_1p` `@  0pooȧ? ( pe02> 37?gOL xy>8`xx8 `?7X? 'u   (P?"pG@AC>?7?aG8wpsx0)oOgogǟ'??3y0<@|811pCppc8 5[o49ZNX\aB b8)&&X 0 H?\, L/g,&4"0'P'08/x0 s# :28>uz~\ImI]^#?_gC7'# c?8f2R*$Nv88<<9d͖???3?G~,KsN O6twD;_??oO7SK)R[,mm7v7Z{^Y3LL><̭ׄ?2\Y8q_{+Xw8['{^Qy=rkof@@0 x<5~Q#'GKlP?g7U[V|P~_^࿛ӧOOGO?' 93 = AP^\FGF89@?O7wdvH;WoR5p !`l@BGf\?WScdDŽuDa}\ Y 00?<ߖ_\hc0(,@`e[L0C2vH_$ Pry?ӟ xLJ?Ïσ<?+<EYxh_g!ٱ# @`` 8<n~{8a7?=:07 sA.Ͱ54]!w򜝪l@@CI~=$q3nh/P>r9"/n's18O0Dēy70O{&@Xx ߶0gpG0-% wQf9 o_>>;_|e5t%)fp8 `19 yȇ 6?C?ݜΰW|_g{|7C?`蘳`oGO?'?|?p0q8+{y,:9)8/o9vg#XtƄi9XYo [:e ($ +ĊIEc7m0 0ϊG^~077?ǜ̒- #k.#Vx7 |tIZ 2z1s/>}|3@ |ۿ>??8.6G~a?8?l?a0>@ ?>go pS?5`eC`~TAEǏ `= s̰sq?#~@}>L/?\ ?> ^ϾOn^)^:ߎ>~y4N4V;\8:{?o`;g?_??߀O?w?o{ǣ</ F,x>s8?d~谐?? ?0 |3 aI;0w0k ?A@~0x`.>|<:#'x'gы (%? |-7!?F p CO?|=CY}C1 9cNf.Njad ?aøO`/{ N ~,_Y!OrKwRf&*,E.nza@0($"J{{K%ch09 >7@<{?? ǀ-`81Gx>  `c c~~|;'Ɵ?-O->`K0@qx CX t;ǂ˯=' '`lXDs]wCӓ맏áY&~/auME wW>AsJD0g$8pցW4>p ?>p @!??u;f<|!? %c8G~C|ax A,iO#8`8Á@ }W__]Ξ~Z.oML.N.l=/gϧLJUʂ@iXO+EM\?%?QW_? n;<pKs_a_x0ppOGeOW HC@;};0g '?Oph(38×xhH$@X>8H'_?G,aʃ Q?9?c<B aɂ!Dp?NlEw`r~A"^_?S`ȇO?TCχ?8x@?qC|x |`8\q< 6?|<<8 pybhp1?S9kf|cpc||?xpf???7w<~`wEY}\_߰_6Oǰ?_8.lnaO~ <?+0?y?< `~`?>{09??!?B8v=> > p?s }<};zCx0>>?`bF'}qO> ? ?zt>(s{>9 /7/o?㿍c`?3 x??  ???~>>>ə@0>`@@???s;cs3s31  ~> 9 |}}}9s?`ϰo_?,?@? |d|xxp?`px `@??6????7?<`~?p?! 7p ?>? ? 8` =?~|`4x?c?{;! ?0)/g<1?r"?x> ``???=p~?@`<s8F;?y33|؀;?[@ 664? wxG$hX`@_?`$'#j?q絑E!??=ݟ?3??0<H08>?!þi|(ώ~;a7~ p,"p">O| ??09? /!='G/<_q>Ϗ1};?>~@xq?|> ?~ ?``G??$x Ѕ$x|j8o 8<><<8y}7 7  ?cg߽A_pg}~w};@ 0?|~ !) Fs7? Ϗ gwog`i#m>>.8O;x|ym>A` L` '{||rph@_R&r Me gn@n5~ 33񁳑;[;;?w?>=<|? 0C?|~???3~c~~2a~~>a&a7aAvA~ABBBFEm{w7/_?<πop@> pssw~{7txX__7XP7g #cp~@p~@f(x<@<pWC?Gz 78tdl`w7v8f`{@;ȡOIp7???0u>p~|?ax?<l?xƀ  s?xx??X.x=p11!111083{ۿ;?{Ew~v??<?3 | @hG_>!|.A|Cc?a{_A>=???~|@???? x?x} ~???0 `y``! `@`p@?`@`?80p??Iw`?>  =<`@ ?~????3?`@? 6f>??????@p???{?_?s'???<C0!p????? ;9x3x0?'##?@ y7<xpCcC!?c?`O0|~/>??}0><9@1s#??'x8'7????{x?~<x|~??@~qGߏ?oqA@0  @\?8@ p?/??߇{{؇?ǀA?C9aC8?`?~???o@???};zpyhp>p3 py0<.yx ???p0x ?_po{<  ??????~???<߀πO????p008@?o??'?9?`???p ? aaaaCCG>~?}?0???@??><?`0?@ wwffUUDD33""0   r     (  '5       $ '+ 2 n  ( : (%-  2  ) *$+ , #"(#$9 XY/%  ????_????????????????????/????????????????$kwW_/՟_O@P9V)L&`҉gҿ?)?<<(9E?R_?g\|?<>0s@pp00pqa*y3ϱcPQ;ޟ||pysrgEE,?ћ˞M7&&=l<8|<|?x@` |vCO|O|003x?>P8z229}~q~}~"~>8F̀x|2h bf;}@N_5Rڐ3IYJ+,T|;C !]#pO/#O|^r2+~ߢ4ٌFвKO>~|6`x!8|`9 ?1< p?p FϜ r3>!7؃!/moP/RWUd$}1T8<!,LyMă찄7sFx~᱐n25ml3rv:$9V 'GOc~gH\|_ Gz;?? G> 8?3xxbM&(r ͏X^~>p}yx``xy q@g_qsa}[xCy@>y눼au2T`\~ag>~ ccE2{K"d3 QX0#/aZ]a"ylL+;'gUj>py~:Xj#2?|:pDy?l?x`L@pp1`Ɂ?fey2..}( ?0//9;4O)*y{7>X|ZOG& ??a9 v2@rdr%5;0z` Oa\`ėh&)ψGgr†{xO;cp0~ ,w~RQ'CVCPQ.L͚}M3'=B.r޲GĀ,"|~~Nz7dFx!9xP1PQ`$IŸCBac$H_Xq">||w8t80?? 󏕟^/b~?pOILvl` ??W/_?#af_O_?/9x?`dp`p`2@ǀ03gF3zg/'`/N#lMpGcxoSUVS7ќ^ +*>8;y0> T8Q3AQ^!g!a@7/wWG?o?;+9=͟~w~~_  ?_kieW__?|q!~??c f=q-<ĀwlN_Ooc[qeGNϕoO6TwBK9KE;M?o?O?_?//o/oOg/O/Oo_OwOoO_o/O_?O/_o_o_O/O/__OO_/_o//O/_?_??_?__?mn+G0 `рpx@8(8<$`` ~W1n38=`=+o0?/? ` 1= '9331$,08A_p[0<|88X\,&anS` mZ0l/O0 !>8x??????/??_'PO`~A`_>aÀ~??@ q{L?/g珳YLo,GˡSsw_# ?`>fU)z?8?𑛋q?>????`?>`?J cdځ83>2| 37n 0s?d/___/'p? ??>??8%pπqqE@0`fg5K9|A>a??~`p?x ?>? s|ǯ47oOO\N08<?3g0m95l>p?dD✉8X 8< px<13qp?`?sq?G7G;?cc0Ax|{!#? p>C||3=a1}_GC !ι!'GOgOxǝ?<#`{[}z{vd??9?```08L0???8p ?pg? C3~O?~ |s??x??}8'3p??? ? s?7??`p??`wx ||>? À??G;? ~?Oǀo?p?0 ?///' @p` 8< 1??????~~~>??syya000@ /_ /_O@@x?x| 3Sldl?~~|}}w8o00o~dސ3 @@sOB`@/o; ??o/98<|_>/|'`?>? p>|>px<?????0 88?  ??G????3?c{;=ぃ?<?x??????3'''`'`'p'x0''''?'?'?'>'>'>''z'v'?'?'c'c' <'0>'@0E'@8̀'@'@' ' '`!?' `!?' ' ''8'?' ''' 8'w ' x0'x0'p?`'?`'?`'?8`'?8'?8'x?q'x?q'8?'0?'p@?'`?' '8 '>v?'>?'?'?';0';0w'| '| ;'{'{'=?'9'''?|'?' ''8~'P|'?'@?'@'@'''' 'p 'p'{''''''3'3'?0?'?x?'???'???'x'x'''''?'?'''''''''<#'<#'pc'pc8''0' 8' 8''''''@''?'?'' ' '0' 8'''''8?'8'8?'8?'<?'8?'8'8'~'~'?'?'`'`'@'@'p'p'Î'' c'? 'p'8x'''?'?'?bÀ'?c'a'`'B''''9'1'<'<~' '0'x`?'x`?'x0`'p`' `'0`'?'?'?'?'0`'0`'''8' 8'8''98'98'8x?'8p'<{xp`'yxp`'<p'='??'>|}''x'?>?'>?|'|'||'z?'x'xx?>8'|?x'x?'px'{'p{À'ps'p{'s8'`s8'`c'`cp' a' aÀ'@ '`c 'p`'0'0'8''''''@'''p8p'p`'1'1'9`'9`'''''3'3'#'#' 3' 3'''''''??'??'''''''g'w'g''g'w''''g'{'sÀ'g'sÀ'{'s's's'{?'s?'C?`'c0`'A?'C?`'p'`'@8'`@0'?@8'? 0'?8x'x'?`'?`p'p?`'p?'88'88'?'?'?'?'''''?'''?'''''?'?'??'??'8x<'~p<'??'??'?|'?x'?<'?8'?~/'?'?'?'??|'? |'???'??'''?}'?''`'?0'? '?'?'8~'8~'?'?''' '0'`?'@?'''?'?'?L'? '#&?'#'?' 'p'p ''<<'|8<'x'|'?'0?'~''|'|'@'`''''' `,. .*O.|5:*m - ЭЭм// ??<JNA NJ/<NA"/0<NBNuNV.N(zN l.`/b/d/fN( 3_Bn`0n5^0Rn n m35r.7b/<_/<5^N*,P>N+3W,Bn`*0nV/?N,=@0.|A.:>_N*BWBg?<N+X>?<?<N,X>E?<?<N,X>?9W,/<.a\> ?9W,/<.a\> ?9W,/<.a\.z?<HN,T#VJVfj>?9W,/<.ab\>?9W,/</aL\>?<?<N,X>N,>_N)RN N(BWN,#VB| 9B|м~м#5Z 95Zм~м#7^.V/<!?9_N)|\.A/<W(/<!H?9_N) N$` >N,> N,gB@3An=@x=@z.A/<V>N)0X>/<V>/<Aa.P.V>aJ@gD.W\/<9j/<V>a$P.9jaJ@g=|x.W\a~J@g=|z` yW,f0BW/<.?<NN,\=@V>/<_/<.a^P`.BW/<-?<NN,\=@V>/<_/<-a.PJnVg.BW/<.&?<NN,\=@V>/<_/<.&aPJnVfhBW/<_?<=N,\=@rmL=nrh./<FN#$X.F/<?.h?<?N,PJo>h?<>N,T./1/<V/<FaP-@R./7/<V/<FaP-@N./=/<V/<FaP-@J./C/<V/<FaP-@F .RFc nRSB .NFc nNSB .JFc nJSB .FFc nFSBJRg>/Q/.RZaPJNgfZN>P0.xQм9j//.NaP-@N0.xQм9j @ #f0.xQм9j @.:JNgRnx0.x|mJJglZJ>P//.JajP-@J0.zмW\.//a \P0.zмW\ @B(JJgRnz0.z|dmJFg@>//.FZaP .1g .Yg .yf 3An`ByAnJ.f>/Q/</Ia rPJnxf>/<9j/<.:a VP=|xJnzf>/<W\/</Ka 4P=|z.}/95ZN#$X.}/97^N#$X>N+-@B>/N,-@6/</Qa X?/Qa \/N+ P-@2B@=@|H-@:=@=@~B@=@v=@t`0.tQм9j.a dS@=@0.tQм9j2.HЁ @P .\g .:f...:0.vмW\/0.tQм9j/a P`&>/<.:0.tQм9j/a P=nzvBW/<.:?<NN,\=@V`D>/<_/.6a P=|._a Hм_-@R./O/.R/<_a PJgBn``./T/.R/<_a PJg =|`<./Y/.R/<_a PJg =|`./^/.R/<_a PJg =|`./c/.R/<_a rPJg =|`./h/.R/<_a NPJg =|`./m/.R/<_a *PJg =|`./r/.R/<_a PJg=|`d./w/.R/<_a PJg=|`B./|/.R/<_a PJg=| ` .//.R/<_a PJg=| Jnmx.Ap/<_0.tQм9j/aPJ:m .>5Zf -y7^>`-y5Z>>/.>/<Apa P-@:J:mJnfNyAp 9:Aqf: .cm .po .Cm" .PnB/<BgBg?<aP `.2a=@|fByWZ._/<Br/.>a(PJnf.}/.BN#$XJyAng, yW,l Bn09_|@29_|pAA29_|A=@JyBrf=|`=|=n`z0.2n_2|A4n_4|pBB4n_4|BA=@Jnl0.D@`0.=@0.no =n=nSnJnf>?<?<N,X>b?<?<N,X>?<?<N,X>?9Br/<_a8\ yW,l3WZ yWZg09AH//.2N+`P#VRn~Rn>ON,=@VJnVgJnVgRnv0.vnzmBnvRnt0.tnxmBntJn~fL>?<?<N,X>?9W,/</a\>?9W,/</al\>N,`4 n~f .B?<Bg?< a ` Bn~Jn|gLN$.V?9W,/.Bap\>?<?<N,X>E?<?<N,X yW,lZ>?<?<N,X>b?<?<N,XJyW,f>?<?<N,X`>?<?<N,X>?9_N*T./R/9W(?9_N) .R/9V?9_N)|\.V?<IN,T>_N)RN N(N^NuNV-|B@=@=@=|`h./.?<Bg?.aZ =@-|.g=|`.`&.g0.|=@ n fJnf=|n``` n f=|`` ngJnf0.|@=@ naf =|``` nbfJyAngB@`p3An`B n;m: nDn2/./<0n"|-00H/N+ P _ -@`Jnf<`6.g.gn`` `.g.gn```0.N^NuNVBn. g& g09AH//.N+`P#V`. gJyW.fn. gJVfn. g09W n fn. g09W&n fn. g\> N,fJ`>N,-@> N,g < ."."n2nJng60.N^NuNV n Pfn yW,ld n 0 n(g. /./<-aP`. /./<-aP.N". n ?/.aH\` n Pl yW,f n =P n 0. //.aP. /./<-aP.B|/.N#JX.}/.N#$X. n ?/.a\Jnf././9B|a ~P`././9B|a PP`. n ?/.ah\N^NuNV.a=@Jn fp(nH=@`pPnH=@>?<?<N,X>Y?<?<N,X>W ?<?<N,X>W ?<?<N,X.?< N,TN^NuNV>/./.aP=@`SnJng n2n \g n2n :f> .2.HЁ/R/. aP=@0.R@n0.N^NuNV.ap=@`SnJnm n2n \g n2n :f>/. .2.HЁ/RaHP>/. /.a8P n 2nB(N^NuNVBn`Rn0n"nJ0f0.N^NuNVBn` n "nRR Rn nJfJng n B0.N^NuNVH (n*n ..`SJfJL0N^NuNVH*n(n &nBG`RG K2GgH5pHAgJgR bֻfB`` JL8N^NuNVB-|0. S@HѮBn`Z nPS .0m .9n.0``0/..HH/N+ PѮ/< /.N+ P-@Rn0.n m .N^NuNV`R nPg . o` n "nRR Sn n  oJnf n BJ.g .``BN^NuNV-|f-|L-|`>N+-@.?<N+T>/./.?<N+ B?< N,T-@0. |"n n-P n g0. |"n.?< N,T> N .N^NuNVH z nl8<`xP=D*yBtI`.Jm RSDSf`HEgHD@RSDSfJDn>/9Bx/aP#Bt0.HѹBxJL0N^NuNVJnf-n .м(-@ .мP-@ .мx-@Bn`L n "n0TT n "n0TT n "n0TT n "n0TT Rn nm`z nfL-n .мP-@Bn`( n "n0TT n "n0TT Rn n(m`$Bn` n "n0TT Rn n(mN^NuNVLB@H-@x3AlBnv`@0nvWRBP0nv_00nv_00nv9bBPRnv nvmBnrBW/.?<=N,\-@`J`m .`=@tJnf-|\=|p`2 nl-|"\=|p`-|%\=|p=|!n=|#l.|/.\?.t?<?N,P-@`J`lBnr`j nm.|H|=@v`&./v 2.pHЁ/zaPJnf./d/aP0.d|g0.d|@3WR0.d|3_./d/aP0.d|@0.d|f,3_J.l.HD@39b` .H39b`FJ.lBy_.HD@39b`*J.f3_By9b`3_.H39b./<Al/aPJno& nl0.v|g0.v|X@=@nv nm nvo Ю\.|/<?.t?<?N,P-@`J`lBnr`WnvXnpXnnXnl.}H@|3WR.}H|3_J.~lBy_.~HD@39b`3_.~H39b./<Al/aPJnvm nvo>t?<>N,Tp`&3vBr. /<_ 2.pHЁ/|aP.} /. N#$X nlJ. /<} ?.t?<?N,P-@`J`lBnrJno } `f . м}-@x`x nl.}/9B|N#$X.B|/<}?.t?<?N,P-@`J`lBnr`^=yBrv nvl=|f`=|f#B|Bt# Bx>vaSnff 9B|Ю`мహBtf-yBtx`.}/9B|N#$X.B|R/<}?.t?<?N,P-@`J`lBnr`./j 2.nHЁ/|a8P./h 2.lHЁ/|aP 9B|R-@T0.jHйB|R-@P>j/. /.P/.TN!f JxgBnv`(.0.v@HмWR//.xaPRnvTx nvmBnv`(.0.v@Hм_//.xatPRnvTx nvmBnv`(.0.v@Hм_//.xa>PRnvTx nvmBnv`J.0.v@Hм9b//.xaP0<2nv9b2A2nv9b2RnvTx nvm>t?<>N,TJnrf .`N^NuNV. N#$. //.aPBn`=|Bn`` N2nJhmL0n06|@2n26|pAA2n26|A=@0.nl =n=nRn nm N2n1n N2n1|Rn nm`./. /.N#|PN^NuNV. N#$. //.aPBn`=|Bn`` N2nJhmL0n06|@2n26|pAA2n26|A=@0.nl =n=nRn nm N2n1n N2n1|Rn nm`./. /.N$2PN^NuNVH>30(JL8xN^NuNVH>1y0(JL8xN^NuNVH>0.J@fr4<6<?8<z'|`*|fr4<6<8<zO|`rtP6<8<zO|1A1B1C1D1E1FJL8xN^Nu3W yW 3W&W&yW&#V/N/JVgSV#W(/N/NVH>&n(n *n>.BBaBJFjDFSFrh;PaVQGm`SFrh;Pa<********QJL0N^NuNVH?$n&n *nA0BB~*<,<?B@2g2*g2*g2*g05HgX@gR@B0$婆B0婈Sj~P'DP&BBSjPSj|JL8N^NuNVH?$n&n *nA1*BCBD~*<,<B@2g2*g05HgR@BA0iABA0iASj~X7DP6BCBDSjPSjJL8N^Nu/<$?<&NN\Nu/<$?<&NN\Nu#p/#%pNu#/pNuH?/JyWZg yWZf\ |WR3/303030 |_303030 30 |_30303030 |9b30303030300300 300"300$3AlW.3WZ09/290490690y0o30y0o30y0 o30y0 o30(|@A0*C0JE0jG0p0246Q`4 y0gNSy0lF300JyW.gSyW.09/290A0*Jy0fa` y0fa y0g@Sy0 l8300 090290A0JJy0fa` y0fa y0g@Sy0"l8300"090290 A0jJy0faf` y0fa y0gB@09WN^NuNV#VAT#V AX#VA\#WA`#WJAd#_Ah#ATW"> aF3WW0pN^NuNV>a*pN^NuNV>MN( n0W n 0W n0W n0WB@09WN^NuNV#WJ# WN>xN(N^NuNV3eW2ByW4ByW83W>N*N^NuNV. N*3}W2ByW4ByW83W>N*.N*N^NuNV. N*3vW2ByW4ByW83W>N*.N* n07bN^NuNV3{W2ByW4ByW83W>N*N^NuNV#5B#5J .мZ#5N3dW2ByW43 W8 n 3W>N* n 0W>#5^5B#7b5J#D5N#B5FN^NuNV3 5^3zW2ByW43W83W>N*N^Nu#W@Nu o WDNu#W25>"<5>psNBNuNVBBJlDRBJ lD RB0. -@0.2. An=@ .gDN^NuNVH?BCB..,. f#5R <`hlDRCJlDRCn8fzB`0l :HGH`xe`Jge`|fD#5R D`#5R JLN^Nu#5VNN/95VNu#5VNM/95VNu#5VNA/95VNu DDwwDD<xslidec.lstslidem.lstslide.lst#:- Deluxe SlideShow v1.1 -by John Brochu1987 Advanced SoftwareNot enough memory to run DSLIDE!Press a key to exit.TIME:PATH:FILE:NAME:0*.*.NEO.PI1.PI2.PI3.PC1.PC2.PC3.TNY.TN1.TN2.TN3No files found!Press a key to exit.NNN.&             @F&X (6$              X   *V  T <   ,vV&,< .j6D ,B 4"x: p6  * ("Hf(666 lƶ|       ` &       zf IMG_SCAN Pics Some people may wonder just how good is the fibre-optic scanner by Ladbrokes. I certainly don't regret purchasing one; the results are quite pleasing even if it does take a fair while to set up and use. The pictures in this directory are largely untouched images produced with IMG SCAN and I think they are pretty representative of the quality. COVENANT.IMG has been extracted from the original scanned NEO picture into *.IMG format using QuickCAD. USEFUL TIP : If you own IMG SCAN you may have had difficulty mounting the fibre optic on the printer head; I use an old printer ribbon shell, drilled to take the device and secured with just a dab of Blu Tack - much better than the clip supplied. Kevin Millican - May 1991