NNNNNNp NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNN@`  @`! #@%-/1 3@5`79;?A C@E`GIKMOQ S@U`WY[]_a c@e`gikmoq s@u`wy{} @` @ ` @ ` @ ` @ ` ǀ ɠ  @ ` ׀  @`O`!Oa   !Aa!!#A%a')+-/1!3A5a79;=A!CAEaGIKMOQ!SAUaWY[]_a!cAeagikmoq!sAuawy{}!Aa!Aa!Aa!Aa!Aaǁɡ!Aaׁ١!Aa!Aa " B b  !"!B!b!!!!!"!""#B"%b"'")"+"-"/#1"#3B#5b#7#9##=#?$A"$CB$Eb$G$I$K$M$O%Q"%SB%Ub%W%Y%%]%_&a"&cB&eb&g&i&k&m&o'q"'sB'ub'w'y'''"(B(b((((()")B)b)))))b*****+"+B+b+++++,`  @`! #@%-/1 3@5`79;?A C@E`GIKMOQ S@U`WY[]_a c@e`gikmoq s@u`wy{} @` @ ` @ ` @ ` @ ` ǀ ɠ  @ ` ׀  @`O`!Oa   !Aa!!#A%a')+-/1!3A5a79;=A!CAEaGIKMOQ!SAUaWY[]_a!cAeagikmoq!sAuawy{}!Aa!Aa!Aa!Aa!Aaǁɡ!Aaׁ١!Aa!Aa " B b  !"!B!b!!!!!"!""#B"%b"'")"+"-"/#1"#3B#5b#7#9##=#?$A"$CB$Eb$G$I$K$M$O%Q"%SB%Ub%W%Y%%]%_&a"&cB&eb&g&i&k&m&o'q"'sB'ub'w'y'''"(B(b((((()")B)b)))))b*****+"+B+b+++++,NEW_AGE PDLPUNCHER 2 =BOOTSAVR !CTIPQ  =DESKTOP INF  =AUTOVIEWPD `!. =.. CARDS =PICPRINT =&CONTROL ACC ,Y<PUNCHER2INF <0PUNCHER2PRG =3GPUNCHER2RSC  *PUNCHER2TXT PREAD_ME TXT  . =.. =MONALISACRD `-SHIRE CRD ,EYE CRD p$           d               d                    d                    d                    d                     d                      e                            e                             d                           d                       d                        d                          d                      d                           d                    d                    d                          d                     e                          d                          h                          d                        e                            i                        k                   j                 j                   k                    l                    l                               g                         h                          d                      d                         d                            d                            d                            d                     d                          d                            d                          d                            d                      d                       d                               d                               d                             d                            d                                   d                           d                          d                            d                      d                        d                       d                        d                        d                   d              d                 nP;;;;;Y;;Y;YYYYY<dWhiteBlack Chocolate Nut BrownMinkCinnamonRustSlateSilverAnemone Gold SudanDoveLemonPrimroseSunset Baby Pink9    d8     d5     d5     d %  d  #   d             d           d              d               d               d           d   d   d     d        d      d    d    d    dd  dddd d7d dd   d  ed d d  d  l  d   e d  e e    g     d  d i f  e  f  d      d    d   d   d   d     d    e      e   h   d   g       f      d     f     e      d   d      d        d    d       d          e           d                e             o               d                d              d             d            d            d           d     d         d         d       d       d    d        g        h         d       d>     d>        d>       d5          d5        d6       d6       d5           d5         d5     N;Y;;Y;YddWhiteBlackRedGreenBlue Dark BlueBrown Dark GreenGrey Dark GreyCyan Dark CyanMagenta Dark Magenta Dark YellowYellow              d            d                  d                       d                    d                           d                           d                         d                          d                            d                              d                            d                          d                       d                            d                                 d                          d                       d                         d                             d                          d                               d                         d                       d                       d                    d                d                    d                      d                     d             d             d              d              d        d            d                d         d        d             d          d          d         d          d               d             d              d         d      d      d     d    d        d       d       d          d          d      d         d        d        nP;Y;Y<dWhiteBlackRedGreenBlue Dark BlueBrown Dark GreenGrey Dark GreyCyan Dark CyanMagenta Dark Magenta Dark YellowYellow. =&.. =DESKTOP INF 'PICPRINTDOC (yPICPRINTS )PICPRINTTTP +[#a000000 #b000000 #c???000?000<00NAX?<NNTHzR?<NN\?9/CT?9C?9C?9C?< N%P3C|BWBg/<8C~?9??9??9??9C|N%P>C~?9??9??9??<$?<$09C~H?09?W09?H?09?WN# N^NuNV.Q/]/Y/U?< ?9C|N&@=n =n =n=n`=n=n=n=n./N'`XJ@g*>?.?.?.?<?./<-N$v.Q/]/Y/U?< ?9C|N&@JngJnfp3B~C:3BC<09B~yAS@3C>09By?S@3C@.C:?<?9?NXN^NuNVN .>n/<A/<B/<CzN$ 3?3pA yBoB=|`,0.м3 @0.м3 @Rn nmA3A3.8L?9CVN$TT3<.8\?9CVN$TT3A.CT/<C/<C/<C?<BgN&@3C|#.VA#.?#.?3BByCaJy?faaaa aaD>?NaaN^NuNV`\.CR/<?p/<CR/<CR/<?/<?Bg?N&.CR/<CR/<CR/<B?< ?9C|N&@.gaa409C|yBff>??9A?9B?9B~?<?</<-N$v>??9A?9B?9B~?<?</<-N$v`n yC|gd>0?90?9009BW?9009B~W?<aP>0?90?9009BW?9009B~W?<aP.gn09?`L09?yC|f >??9??9??9?BgaP`209?yC|fBWBgBgBg?< ?9C|N& `09?y?N3C|`09?yC|fa>C|N& >??9A?9B?9B~?9>n?9A09?H?09BW09AH?09B~WN#\>C|N&&>?N3C|`.09?yC|fp>??9??9??9??<?9C|N& .?/<A/<B/<B~?<?9C|N&@3B~-3B-`09?y?.?.?.?<$?<$BgBgBgN"f>?.?.?.?<$?<$BgBg?<N"f>?.?.?.?<Bg/<3N$vBW/<3N"DX|fLBn`60.P@м3 @( gB@`p"|A4nRn nmaa >?.?.?.?<$?<$BgBg?<N"f>?.?.?.?<$?<$BgBg?<N"f``||b@0@6* PN.g09C|yBfJyBg>??9??<Bg/<-N$ =@`..\/9A?<?<aPa *`../9??<?<aPa `r../9??< ?<aPa`P>b/<.\/9A?<Bg yAH?WN'X?a aByB`>b/<.\/9A?<?< yAH?WN(X?a| aZByB`>b/<./9??<Bg y?H?WN'X?a4 aByB`v>b/<./9??<?< y?H?WN(X?a aByB`,>b/<./9??<Bg y?H?WN'X?a aByB`>b/<./9??<?< y?H?WN(X?aX a6ByB`>>j/<1/<1?<+?<*?<(aH?RWaT`^.2/<2J?</?<.?<,aX H2>RW?9>hajT`"=|6`R0.м- @( g6>Bg?9??9A?9B?9B~Bg?./<-N$Rn n:o>?<?9??9A?9B?9B~Bg?./<-N$0.|3>b>?.WN""TByB`\BW?<?./<-N#PJ@g>/<-N"DX>Bg?9??9A?9B?9B~Bg?</<-N$>Bg?9??9A?9B?9B~Bg?</<-N$a*a a>??9A?9B?9B~?<?</<-N$v>??9A?9B?9B~?<?</<-N$v`L y>fa~>??9A?9B?9B~?<?<1/<-N$vByB` y>da6>??9A?9B?9B~?<?<3/<-N$vByB`BW?<?./<-N#PJ@g*a By2>??9A?9B?9B~BgaP`r0.|3C.B?<?9C?9?N2\>b/<.\/9A?<09BH?a >b/<./9??<09BH?a >b/<./9??<09BH?ar =|`h0.м- @( fL <2.Ҽ-"A >??9A?9B?9B~?<?./<-N$vRn no09/y/2f </>??9A?9B?9B~?<?< /<-N$vVy/Vy/]y/]y/ />??9A?9B?9B~?<?< /<-N$vJyCg <2.Ҽ-"A `(3/2/3/L/3/6/3/8/ >??9A?9B?9B~?<?./<-N$vByB` ByB``S@|9b@0@6 PN`3B.g409?p|| f$a>??9A?9B?9B~BgaPBWN&`N^NuNV./. ?.?<?<?. ?./<-N# ?0<_H}?N(X?aPN^NuNV0.|0"n >?<Vpn?N 6X? n0>??9A?9B?9B~?<?. /<-N$vN^NuNVBW?. ?. /<-N#P=@/.?<?<m?.N 6\ _0"n2>??9A?9B?9B~?<?./<-N$v0.N^NuNV yAH|}|>3B y?H|}|>3B y?H|}|>3B.B?9C?9?NXBn`,09Cn0@=2nB1QjRn nmN^NuNV> ?.?<#N(.X3>h3 >jN^NuNV.)a=@ nPl 0.|`0.|=@0.Hr-@.)a=@ 9P)f n ln 9A)f n fBn.)aHr㠁.)aHr㠁0.Hr 㠁.)alH뀁.?<N(.T.)aL@>/<)a@XW0.r `W?<+N(NT.)a@>0.r `W?<-N(NTN^NuNV n  fB@` nH| =@R nHn|N^NuNV>N(.-@ .?3Cp .r 3B .r3B .r3? .r|PHdH@3AN^NuNV>,N(N=@0.@|?3Cp0.r `|3B>*N(N=@0.|3B0.@|3?0.r `||PHdH@3AN^NuNVBW?9A/<)a\>?9?/<)a\>?9B/<)av\BW?9Cp/<)ab\JyBg,> y Bo ?9BW`?9B/<)a0\`>?< /<)a\ y BlpA`pP)N^NuNVJng0. H fp `0. H |0"nR0. H H@|0"nN^NuNV>/<AN%TX-|A n #@RDf n b@RDfBn` nH|2nARRn nm n #@RDf n c@RDfBn`* nH|}|>2n=2RRn n0m=|0`" nH|2n=2RRn n3m.a3=T.a3>N^NuNV>/<AN%TX-|ABn`j.B?<?.?9?N2\Bn`<0n"|B00H}|>2.n2A=3@jRn nmRn0.y?mBn` 0n=2n=0jRn n5m n #@RDf n c@RDfBn`,0n"|=00j|H}|0"nRnR n0m=|0`"0n"|=00j|0"nRnR n3mBW?9>h/.a,\TBW?9>j/.a\>/<AN%vXN^NuNV>/<AN%TX-|A n #@RDf n b@RDfBn`"0n"|A0H|0"nRnR nm>/<AN%vXN^NuNVBn` 0n=2n=1QjRn n5mBn`*0.@Hм=.?.?9?NXRn nm09C0@"|=00|H}=@0.|0"yA>?<Vpn?N 6X3.\09CR@0@"|=00|H}=@0.|0"y?>?<Vpn?N 6X3.09CT@0@"|=00|H}=@0.|0"y?>?<Vpn?N 6X3.a=|6`0.м- @Bh Rn n:o09=|6м- @1| >?<m09=S@?N 6X3131>?<m09>S@2?N 6X3232J>>?9=a TN^NuNV>>d?9>fNPTJy>fg <-` <-#2Jy>dg <-` <-#2N^NuNV9AH@>9AH@W9AH@W9AH@W9AH@W9AHW?<!N(.TN^NuB?< NA\#p<#@<#?r n1y>t n1y>vN^NuNV# <3 <3CZ3C\3C`3CfN P#? aF3BCVpN^NuNV>a*pN^NuNV3B3 B3 B3B3B3B3B3B3B3B3B3B3 B3"B#$Cr3(B3*B>N f n,0B n00B n40B n80B n<0B n@0BB@09BN^NuNV3B3 B>N fN^NuNV#Cr3 B>2N fN^NuNV3B3 B3 B3B3B3B3B3B3B>3N fN^NuNV#Cr>6N f n 0B n0B n0B n0BB@09BN^NuNV3B3 B3 B3B3B3B3B3B>IN fN^NuNV3B3 B3 B3B3B3B3B3B>JN fN^NuNV#Cr3 B3B3B>KN fN^NuNV#Cr3 B3B3B>LN fN^NuNV>MN f n0B n 0B n0B n0BB@09BN^NuNV3B# Cr>#N fN^NuNV#Cr3 B3B3B3B3B3B>*N fN^NuNV#Cr3 B3B3B3B>+N fN^NuNV#Cr3 B3B3B3B3B3B3B3B>/N fN^NuNV#Cr3 B>zN fN^NuNV#Cr3 B>{N fN^NuNV3B3 B3 B3B3B>dN fN^NuNV3B3 B3 B3B3B>eN fN^NuNV3B>fN fN^NuNV3B>gN fN^NuNV3B3 B>hN f n 0B n0B n0B n0BB@09BN^NuNV3B3 B3 B3B3B3B>iN fN^NuNV3B>kN fN^NuNV3B3 B3 B3B3B3B>lN f n0B n0B n0B n 0BB@09BN^NuNVH *n(n >0-W?0,WN(T:>0-W?,0,WN(T8>?N'T>>?,N'T<89F0G9@0F9@GoFnB@`pJL0N^NuNV0.n o0.`0. N^NuNV0.n l0.`0. N^Nu#87>97>:7>;7><-pL> -~>(p7h7 ,`7Dh7PX7< 07,8@  p 7@7h@ p  7@ 7h@p,7@ 7h@p87@8h@pD8@8h@pP8@8h@8"Xx82P`8'85`80 ` ` ` ` `40 ` ` ` ` ` ` ` ` ` `` ^ D D D  :  DDDDDDDDDD D D D DDDb D D D D D__:__ _M9999F__/__/__999999Cancel01234Printer Type:Pixels/Line:Printer Port:Paper Type:Color:Quality:DotDaisyB/WColor1280960DraftFinalPrinterModemFeedSingleINSTALL PRINTEROKCancel CONTROL PANEL Control Panel Install Printer*     (P$                      ": $,""B,       0&               (     .8 * :" R     ^B\2 ( F<&6* (        $ $                        *prRH0000`x00000000 <d*.NEO A:\CARDS\A:\녆;d\H;`D6&` AN 4MJy f2*O*m-M - ЭЭ// Bg?<JNAO JkO a0a.A=X=P=| N6Jf`BnBnBNaa p N1JngAV-H=n0<#N1a>"< <NJg-H<-H@aNN/N/a/N.zLNuH0<?N.zLNuB@=@AD-HpNN1Nu0<`0<`H=n =|A-Hp!N1LNuA$ k"X"`Nu=|BnphN1LHH=|p3N1Nu=|A-HpN1NuJngA-HpN1 n(fpaa0. |g |ga>Jnf`&AL @!@!@C!I!I-I-I"Bh Bh"=h$B,B0B:BNu n,n^A@Rh0<(AQAh AhA@ShAPUhAPhQhAThZh*PhBNuH2IA!2I naL?NuH=@R2IA-p na,L?NuH0.RA pa0.RaLNuI8.L(t@0,$AaNu?:MGNI&K&PPJ4Pg RR`TTR| m.BDCJQgBQ:MG7PRDTT| m8.RL0.Ra0.RAH1NuBngPa=@HA1aJf -nv`H0.aaJf6 nv .r".za28.LGH/3@?<INA\L'v@0.2IK;aa@nRf-nv0.Ra 0.a a .BnNung` Nua>N^JgH?<NNT/?NAXJzfBra .r".z nvNua$Jg?AQ-H=|p4N10NuH@P nv"CXf"(fBLNu=@B.Ad-HCB<.:<PQA-HpZN1JngaJf&=|Aj-Hp4N1 nf`t0.a a8Jfb nv .r".za8.LGH/3@?<INA\L'v@0.2IK;-nv nv0.Ra0.0.Nu=n =|phN1Lnbf=|phN1LHH=|/=|plN1LHLH=n =|piN1NuLaB8.HĈDl4B8.nLDl68Bno0.B8Cnno 2.CnNuaL aaBn=|-LHplN1-n-n=n=|piN1LH$H$fNrL$NJ`,Ha(?A?C26/:/>/ a>?CLNuAnEG0C@n2E6@n6NuvNu=n=| piN1Nuaa=n=| phN1JngJngLL aZJBgdJCg^JgNH@0HB4Ԁ-@ -B -@ -B A-H A-H =| 0<1N.z` BDN0=n=| `ba`H=|=|)HplN1-n-nnnLNuBn=|phN1-n-nLB(C KCJBP@CTAUACCB@axNu=|--n-npdN1=nNunnBn=|--n-nplN1-n-n=npeN1Nu=npfN1=npgN1NuA-H=n=|piN1Nu Output Id?<NATA:Bg/ ?<GNAPJfS\*.BSCBNuAdC0<BAA|mRRQNuLBDN0IAN"<SAf"O /NuNPJ  !z!n!n"1n$NuJng"a$p=@RaAL-H-Ha`J/<?<HNA\Jg-@-@"-A" @@2<CSAf-H @aj></<?<HNA\JgJE%p-@"-A" @@2<CHSAf-H @aXG|(mB@Nu<NuJf.-n-n-n B/<?<HNA\-@-@Nu nJg2< BAfNuI8< H/?<INA\LSDfNuJg/.?<INA\NuH~T.,/?<HNA\JfnB` @ L~NuH?<NNT-@?<NNT|f=|=|=| `2|f=|=|=| `=|@=|=| 0.H=@LNuHA-H -H =| JDjD`D@ASBSCJDjH DDH `H DDH 0<1N.zLNu  02 46@ N f ~   {  "$&,. &%x7'6&H(8*G,.467YIXH@jXZZi\^dfY { k z   j p |   { &Z-H\JgB@BABBJg6 [fRAR@ ]fSA |fRB|g |fPNu|nJAfJ@g|nJf/< ?<HNA\JfpNu-@ n0<r:< n^n:<1A!|1|1EBB BBhRAQ nC0|g 21`0<1|. nn 0< 1| .1n1n,1n1n!n2<F4<1Q"n\ n-H"n\$n [g JfPNuRJfPNu ]g`B%nD-H$n`&nBG [g Jf`` nR ]g$ \g |g`B%n `B<F '`G-H ]f`AR"n#H\A[#HT"n80<a><0<?a>Q"nH0<$i gBAJgPA`3AQ"n$IHB@2<i3@5@Q nh1@D1hL41h$ 1h1hT<1h1hl1h  1h 0<"n a><"n0<?a>Q"n0)bh24<@3AQ"nH0<J f Q n4<2.A0(h@l 6h1CQ nh0<BhQ-n=|pN1B@Nu$I8< n^l8<BEJ g5EDQ3ENuBB$I2BC&i gBDJgPD`Dn6Q5CQNu-------------------- Desk Jg/.?<INA\A-HBnpN1B@Nu` 0 00}    0 @ P`p8ppp p0p@pPp`ppp}T ,(<22 2 F m@ d z    $x  $<Z< n00P<%P< D @ @(@8@X@hd@xxd@xd @xd @ @h `  "" Desk File About Runner-------------------- Load Program Run Program-------------- Show Info Dump Output QuitFast BasicRun-Time InterpreterComputer ConceptsProgram execution stoppeddue to:OKProgram InformationCANCELRUNNERFast ST BASICRun-time InterpreterRUNNER bits: Phil MartinInterpreter: Jeremy RustonGavin TheobaldPhil Martinand Nigel, who doesn't like to be mentioned!Version Number: 1.05c/00 Computer Concepts 1986Gaddesden Place, Hemel Hempstead,Herts. HP2 6EX EnglandTelephone: (0442) 63937PROG1 .BSC32___FFFFFFFFFFF99999Name:________.___Kbytes of Workspace :_____XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX_________________________________________________________________________________[3][A loading error has occurred. |you may try again or cancel.][ Cancel | Retry ][3][The file you tried to run|was not in Fast Basic format.][ OK ][3][The file you were trying|to access cannot be found.][ OK ][3][The pathname chosen could|not be found.][ OK ][3][Access not possible.][ OK ][3][Invalid drive letter.][ OK ][3][An error has occured.][ OK ]?p``p?%t%z,%t%% L% d% |% % % % % %!<%!T&"%%%%% % $!)$& "&:"%"&B"&E#&B#&Y#$#%#L'$'%'$'%'$'% &`#&g#&u$ &$$&$<&$T&$l'$'$% ",%<"D%X"\'8% 'Z%<'t%X(4%$(V%@(p%\'%((%D(%`$$aؼ-H/=@JAgp6N1L`LH pHHBnp3N1L pH=|Bn-Wp*N1=n-_p2N1=nL pHH=|p3N1`(Nu?(|ff6<UT`<If,C$g|<(xaf6SCUT``\<.f"C$gF<(xahf86UT`<Af P6; Ja6.gr)a(F|fr+a`~ApNuDodgy assembler token!BWLSRD--SCYf<` TQDNuDNuhWfd~VBCDDDADDIDDQDDXDDNDINDSLSRTSTTSRHILSCCCSNEEQVCVSPLMIGELTGTLELOHSRACHGCLRSETHKLRMPAMPIMPMMPCRBTBFBHIBLSBCCBCSBNEBEQBVCBVSBPLBMIBGEBLTBGTBLEBLOBHSBRACSIVSIVUORIORVENQUXGXTNCLUDEMPSREAINKSLSROVEAOVEMOVEPOVEQOVEULSULUBCDEGXEGOPOTPTRGRIRESETOLOROXLOXRSTETRTSBCDTOPUBAUBIUBQUBXUBWAPTFHILSCCCSNEEQVCVSPLMIGELTGTLELOHSPRASRAPVRAPSTNLKSPP $Zlqxڏ(9D bB.Bn A$$<2<`=| < gX< gb< gr<"g<$g<%g"`F p`8`b. p`pANux<0fRD`v`0m <n`SHCJCg 0<8a0a 0aHC0a`\0<:a0`vJ.g<ae <zb 0m<n< o < m鋆`SHCJCg0<,a0aHC0a`0<.`0<*a<"g< g2Sgt`<"gSSg`B0gBSgL`pANu0<a0 A$Nu0<  fR@`Sa`r0<  fR@`Sa`ZC ¼<ae <zb )<ae <zb f0HR$LJ.g<ae <zb g` gJ)fa(JS|@g\|BgV|gV|gP|Dgl|RgZ|Tg`|PgZ|FgN|Hgΰ|Jgư|Lg$|Ng2|Vg`|XgZ``"`B@a`rB@aB@aB@aa`XS|cBS0g@BS`8B@aa<0eμ<9c<Ae¼<Zc <_e<zbSg`TfJfJ)f`.B@a|< gSgt`<.f<0m<9n`<9n<0mH`NbS<g><g^L&H@J@g0<a H@aH@a`b0<a0a`PNZL&0<a H@aH@a`*N(&L0<4a H@aH@a`ȼ<AmL<znD<Zo<_m6&L<0m<9o<Am<Zo<_m<zox <|g$x <&gx<%gx<#g x<$gxS (fRD |gf|g|g| g| g0aB@aa`Ja( VDDmSgS`BS8DgBSNuJn f :f0<6aB@aR` fp(aB@A@av`* <fnp&a`RB@A@aP`* <fHp$a:RB@A@a*`* <f"p"aRB@Aa`fUg0NuXpAgNuDodgy token-K -H *H b-H <k|:o2|Fo`pANur |lr FFaVQ`C`NLbZrpnljhfdb`^\ 0D2*TJTga`2 A<:a`V|<`,r%az0aQ`.8|<`8,r%a`2<0aQzJk Q`0aQ`|<`,r$alzfSEj2<0aT`A;aBQ`0123456789ABCDEFr"a"ga<"fa`r"a2 gjR`d< a Mp&n Nu|<`,C6BC(kBARAj܄SAfJCg0av`JCfr0a`;B@'d H NANLEgaR`HLNANLEga&`r#a`2AAar|a `r2AAAar&a`\2AAAar%a`F2AAAa`6Xga`2 A`C`fga`|@gV|BgP|DgJ|PgD|Rg:|Tg8|Fg0|Hg2|Jg,|Lg|Ng|Vg2|Xg,`T`TTX`Tga6`2 A`X`No entry in DeTokKeyTab!!#(-379>FLSX]kmoqsz-137;?Y_w| &/8@JRWak} ",6:?INimqw !$(+.02579;=?AFKQW_fp     % . 6 ? G O U ] f n s   >    $ + 5 7 = C E J H P X ` h n w { "  CI #,4<D    $ . 7 : G N U h r { 7>   X   # ( - 2 7 < B G L P T Y ] c h m r x %   $ ) 3 : B I@gNuXB@ANu@THENBELSEDGOTOFGOSUBHREMJ\LDATANRESTOREPWHILERSWITCHTCASEVPROCXFNINKEY$INKEY`!b#d(f)hSNDREGjLOGBASEl,nPHYSBASEpHELPr:t;vERRORxERR$zERR|SETMOUSE~RECTSCREENWIDTH?@[]SCREENHEIGHT>ENDUPDATEENDIFENDSWITCH{~CALLCHAINCLEARGRAFRECTCLOSE#DIMENDPROCDEFAULTDEF|ABSENDRUNTXTRECTPRINT#INPUT#PRINTVDU(TIME12$*TIME24$TIMEESCAPEHEX$READAPPLREADPOLYGONNOTONOFFLENRESERVESCREENFREESCREENFREEACSASNATNDEGEXPINTLOGLNPIEPIRAD%TANCOSSINSQRREPEATUNTILFORMAT$(\DOFORM^SETWINDTITLE`SETWINDINFObGETWINDWORKdGETWINDCOORDSfSETWINDCOORDShGETWINDPREVjGETWINDFULLlHSLIDEnVSLIDEpTOPrGETFIRSTtGETNEXTvSETDESKxHSLSIZEzVSLSIZETOSTEPNEXTIFRETURNINPSTATOUTSTAT&INPUTINPFORRS232LINEENDSGRAFMODELINETYPELINEPATLINEWIDTHLINECOLLINE FILLPERIM FILLSTYLEFILLCOLFILLPATFILLCIRCLEMOUSERESERVETXTXBASETXTYBASETXTWIDTHTXTHEIGHT GRAFXBASE"GRAFYBASE$GRAFWIDTH&GRAFHEIGHT(OUTXBASE*OUTYBASE,OUTWIDTH.OUTHEIGHT0OUTDUMPDOUTHANDLE2OUT4HIDEMOUSE6SHOWMOUSE8CLS:HOMECHR$@GET$RGETREC#VGETBYTES#BGETDINKFPAPERHTXTSIZEJTXTEFFECTSLTXTXPOSNTXTYPOSPPALETTERPOINT(TGRABTPUTREC#XPUTBYTES#VPUTWAITBUTTONWAITEVENTWAITTIMERWAITMESSAGEWAITMOUSEXWAITZPC\<<^>>`DIVbMODdEORfORhANDj<>l<=n<p=r>=t>v+x-z*|/~^EOF#EXT#BPUT#BGET#MAKEDIRDELDIRLISTFILE$PATH$DRIVEMAPDRIVEDISKFREEDISCFREERENAMEDELFILEFSELECTOPENINOPENOUTOPENUPPTR#FILEATTSFILETIMEFILEDATEBLOADBSAVEMENUTAKEMOUSERELEASEMOUSEDSQRPOLYMARKMARKTYPEMARKSIZEMARKCOLPOLYLINEINSTALLPERFORMTRASHSEGFREESEGNAME$SEGMENTBLIT{something}WENDSETCOLLEFT$(RIGHT$(MID$(ASCINSTR(EVALEXEC}|}&}%}#}$$}$}DUMPVARSDUMPPROGLOCALCURSONCURSOFFCURSCOLCURSLEFTCURSRIGHT CURSUP CURSDOWNDUPDEV#REDIRECT#LAUNCHMEDIACHANGEVARCOUNTFIELD '"TAB($SPC,DATEUK$.DATEUS$0SYSTIME2SYSDATE4TRACE6TRACKING8KEY:ALTTRANSBLIT@SYSVARBMANDEL(DJULIA(FSEARCHLISTJeremyHy-_$-L =@ Jng|g |+g|f.n!vNu=@ V.n F|g|+g|g |gJn Pf&NT/ .$a` .$a`NX aNu(n R` NuNuT4T@TLTVT`TjTtPHyU`8:@R8..,$" @>N"  B\B\BNuXNuTNu\NuPNuBJf0 @NuT La"L1INuTY9JNuP Hx P` Ha Hb Hc Hd He Hf Hg Hh Hi Hj Hk Hl Hm Hn Ho H   @AB &  b P2Q2R2S2T2U2V2W2X2Y2Z2[2\2]2^2_2 d j p  ؀ ± xNH.N N A NW BB HGA !! Lp ?1 d  H @ D Nw :F x PHB 0Nw Nw Nw 2Nw 6Nw XQ HHA |P Q R S T U V W X Y Z [ \ ] ^ _   J Nw @NG J NW p+`Ba n$} gaT$O͵@eRn ~Dn ~aBn B B. B a.| J.g ?.!za=_!za gB. z<FC_4h(gJ. f@g"4BBPBA<FC4hJ. g(4(. g . f4(. fp*aJfzJhk. . J. gE h. N=F faaxۮ ۮ `Dn ~Sn ~J. g p aNBn Jn ~fXJ gaP(n -L 0. =@ H`J. gJ. gtaB fBn jzaJ. f . -@ -n z n $}gaSJaJNuDeep and crisp and, J. g*H瀀E taQp aNT. aNLTn LNuQ 4. J. fn aH (n UA 0<a| p< gfJ. f<\W ɰ<"fn ɰ<:fJ. g@< gJ. g2.$nn$xn$jl&aMRn `4. n RB n a`L0NuP :fp/ara/ac . faaNZr`f . f*abBNzJ. g E f$$aۮ ۮ `8Jg& f n >x8SDp. a2Q`aa. aa nl!zgt _NuP :fp/a. °<W ´. ga B z nl!zgzNua`6|kAC xangZRQa J. gtJ. gn nl!zfta_=@ xJ. gTJ. jN n ~fFJ. gtaG f6`& Bz aFG f& Bza6G fBBB[z a&. Nu nl!zf`_dNup-`P :fp/ara_F-@ -@ -@ |lfa_0-@ zNuP :afp/arJ. gtaN . zJg R-@ zJ. gH(n Uap<~ . zanL@J. g p[aJE ztaQp]aJTn a^. aѮ zNu:fp/a@r<<V$O͵eDn ~/. /. HN{XL-_ -_ Dn ~B P Nu:fp/arJ. fJ. f,a. NuJ. gBB. ZB. Nup*aNuk::.fp/ar . fJgJ. gJ. faB`TaF`F . f,?a Nu0 . g@|> Nu . f @|> Nu . gj<Nu j<Nu:fp/aragp.aX@`:hfp/araJ. fJ. fa. NuJ. ga|. Nuk:&fp/ar` . f |> Nu . f2J g:fp/adra`4:fp/aNra`:fp/a8ra`J. fP:fp/ar4FZBBaJ. f. ZB. Nuagp.aX@. Nu:^fp/ar . f S gp.a`kj:5fp/ar . a U . g 6@f:4NugHH°f(Nu/ Ea $_< Nu0<`` 0<_`0<[Sn Բ<fzNuzNuJ. f4BB. ZBJ. f:fp/ar`:fp/ar` F . a|4`:lfp/ara`k:Pfp/ar` . f-n p-@ G a0<|> Nuk:fp/araP`P . f 0<s|> Nu . f 0<t|> Nu:fp/aHr<fa` . f2J g:fp/ara`:fp/ara`:|fp/arax`:ffp/araa. Nuk@:Hfp/ar . a  a ,4. Nu0<}` 0<|`0<yzNuk:fp/apr` . f 0<|> Nu:fp/aJrJ. g J. gH` J. f@a. Nu. `ڌ. `:fp/a ra@. Nu:rfp/a r`:`fp/a ra`:Qfp/a r`:8fp/a r. . a ,4Nuk< . jv . j: fp/a nr . fp*a ^` . f Jfp/a J|G a0>|G a$4F^B8JBG<jrfrYANu . g"J. fp*a : fp/a r<<@` . gp*a : cfp/a ra F< NuBBBNuG `G ` G ` G `+ +<kgj<gj<n/ E a v$_<g@`:< j < k0g6g< kg8` . g.a ,`( . f$`a ,4`a @4` a *4+4t+B+BNu . a . k$Nu4Nu: fp/a Nr`kp: fp/a 8r<f . g . ff . 4` . gN . . g4`x4pXZdQ4` . g" . g . o . n 0<|> Nu: 2fp/a r<fJ. fJ. ga<. . 4NuJ. fa2. . 4Nu: fp/a Lr . a` Bn pn p` Bn pn p4. pBBNu: fp/a ra`: fp/a ra`: tfp/a r`0: \fp/a raF` 751`6: 6fp/a rB. Nu: "fp/a ra . a=@ h2Nu: fp/a nr. Nu: fp/a Zr`40<Nu0<Nu: fp/a JBn B n Q ` F;j*J fP -L P ad ~ . ab`pI` J f-L FJgNu`p@f(fa rNu<kR. ra&_'A| . f|r A||`0@|@gC x`<JFk@|Jg|@k8razfl<f^Aa\|rAA`8|gd|lg\|rgT|df<|Zf| |||` raf|||F`Ua`r||`r||A|`|!jN|kFF / 2"g )(fSS`" Id" IdR<|Zf| |||`L|@kF|k,F|Pj |(kF(<m||F|Ja|fgl|lf<kBAaf0k|ffƲ<g <gr:.fp/arSF + fR+`+R++`r+`j$_?Z XJf|(" Id2`¼|;k2`a`2Ƽ|*g*| k |,kf|g22`|"k2Nu"f, NdNuE ֳf p'@`2P / I HpaOL'@(_`F|jp/aB+z <wgR+<g z <f||E`rxQ p2|xfP p`&||g UHDJDgJp@|HD'D`4<ra@f2<j*~HDRDHDJ. pgfkRQQ p2`?F|@f8<FJk2I` |dp/a<Pd<(k(J_?<Nu<<NuH$g EtaL$Nu/ Eta$_NuJ. g/ Eta$_aBn n |. NuH pg$< gJ. g2.$nn$xn$jl a8Rn `LNuERROR: WARNING: Privileged instruction Odd-byte address Absolute reference Null branch Tn a@0<:ka86Nu<gj$$g$Ff*Nu$HBJBgFBfNuHH°fNu4H°fNup.aBNuJ.g H`aLaJ. gE f4<gj`$a ۮ ۮ NuJ. g0E f&S0. U@n fp a7Bn tanpaQJ. g&HHn f/?. x?<@NA JkadLNuJ. fNuE f"n &SQNuA; EHNun k*g(n S/J. g0.$x n$jl p a6Q Nu$n >B4UBWf +g -f <,<Nu<NuWLDHMFC_H J. gl??. a .! g8Jn g p a6|Bn Eta|! n $Harp a6VBn 4J. ga6J. f4J f-L =B LpNu.n FNu 7aJaKaB0Cd (:gBH?<NATJk_A@d|:eBgHnf?<GNAPJk_|LJf|\f !\fR$IAf*.*BLNu-_ p?<NATJk_2?R@?Hn ?<GNAPJk_A Jf|\BA p'?Q/. pNu-_ pA!&p'1Q?<NAXHn ?<;NA\Jk^/. pNuaIXa$O͵@e^/ L 6H`2II(t"l@-L 6-I :XL/. bB b?.!z?. P/. RBn P/. LA$,r ?Q |W-H L?.=@a,/.!vRna:Sn-_!v=_A$Bp 1Q-_ L-_ R=_ P=_!z-_ bLH 6(_Nu-O!v`݀aHa0H N LL0NuaHpaA@JPfp~Nup~NuSk nNup3`٤aH>a n >C&@p0CQ0Dn ~/ . /. /. ?/ N *_0aV0/ N L*_0-_ -_ _ Dn ~(_P B zNup4`a7`a7`aGba6=@$a6NuHy`Hy`Hy`Hypa Sk?a6 oNa60QXNu<k|rg|Bg|gUaFNu=F!zNu<kJ.f$O͵,e|FbA`jNa`޼|Gg|Gg|Ge|GbFNA!|Hp``zp#`p2`pH`<k=F!zNuT=|r!zNu=|r!zNu"D"b\%J%*~|zxtrp48xj8Ftb^\? :pV|RNLPpFLB|<\|>)2:>;x"># B[8888888"9~9D9j99:,;f;x;~;;;;;B>H77Rzxvtrpnljhfdb`^\ZXVT\P]2]DJ^_ DB_D__:86[`0.ab>jj&j."=>R>b>v=@ >x >j6 bXbzj dFdriijkkTkkleRdrggJ7Dv lVlzlm.mn no,opoopqq@q]>Vr99:rzsHJHFtFtttvvvFvvv0wxw|xHx&$zyyz gh8Tb~ >,>@?"?6?@@>?z<tV@Z@@f@@@AA0AdAB &<k|pfaC _ NuHn z`<k|pfaB=@!NuNRNNARpra`HaB@@?a4aB@??<NN\NuaB@?Bg?<NN\~Nup`0. JaQ.n B(n 6`<kaSH<k|pfaC$L@`RPps`Әp`Ӓ<k|pfaB(ab"9at-@!Nu<k|g|f`t<k|gb|f`Pp ` aAa- nl!zgNu<k|pflaA-@ -@ NuaRH<k|lfaAЁa+ L@BGaQtNup%`Һp&`Ҵp'`Ү<k|mؼ| b2;`HtX L0T@fvHpaALRCXR/H0aOi/ nl!zg nf!zfL"L(HaRg(I ЂЁ/ a+,$_$LB00@f00@"H`#QR`BXQ<k|lgB=F!zNua@|H //L?!|D!,_N,_@!H?!|L0Nu=\!zNua@HH@J@fH@|eaOz/ (n 6NX(_Nup9`zaQrH(n b f (n 6a`<|lg|Lg>|fTaa@|lg|fU-L bL@aO<k|lg=F!zNuT` g/ (@aXY-L b(_` AT<k|rg.|Bg(|g"a*E0DP/ (IaY-L b(_`U"n 6X `<k|Lg@|g|`la`T<j(f`X<k|Lg |`la`TNup<`Xa>`PpA`Ja?/ ?.!z(n > N9J@kr2$O͵e&OBgBgUA?0JAf(O/ a<.!z|rg|fӤ.W=_!z(_Nu<k|g|g|8fӂ`<k|g|g|8g|:f``pq`Ϧa>F/?< NN\NuBga>4?a0`a>*?@?<#NN\Nua>/a0Da> _a Fa \Nua= @a 4pa HBGNu?<?<NAXJkSD`Z<kaO,Ha/<kaOLGf=FE`N$"4`002`  "`L !iH`gg`f`f`(n 0. `Ζp>0.!Nup>0.!Nu<k|pfa==@!Nu/.$A-H$`B:.!BD<k|rg|g|Bg|g|lg|tg| gּ|"g|$gUH a=|L0|ga26@kg?0< SCa'Q02p n >`a'Q<.!z`l=F!z0< a' g-@$Nux`LJn!g>r2.!g4!HADAg(n!0< `a'jQ`<k|rg|g|BgBDBE`=F!z`0< a'4`H a;2L00< `a'Q`H a;L0|lg$|ff|2n!gd?0< a&2`?H a;|L0|ffL20a,R`nH JDf.|ga;" n >a{ n >pR@JfL0Nu n >aw`a;.aL0Nu.$}?P$}a*Bn#aQ,.ga@< gJ<g*<cְ<g2.#|ga&$A!Rn#`Jn#g0<a&Sn#`a%2.#A!B0a*0@$}Nu<kzx|f<k|*g| g|"g6|$g|lg|tgؼ|rg^|gV|BgNH aKL0f|fg0<?a%^HaLpxp"n >E!g Rf`N| g<"gRg <,g`x`,( E!Ƙ`"Rg<"g` "ggز<,f`~H |b Ha L@aIL0`pga$`0 @x`0< a$`a9820< `a$Q`a9(|lg$|ff2n!gd?0< a$V2`?a8|ff20a)`=F!zNu<k|FbA`NNм|Gg$|Gg&|Ge*|Gb$FNA!| 0`BGNu . zBGNup0.!BGNup8`p`(.4`xLdRj6**~|.tr.nhjhfdb`^\Z 8TRPNHDB><2<BNZfr~" M@MXMj.&.*...2.B.F.J.N.R.V.Z.^M>MT. ..T~|NxNvO.rpOPQ"QJQHdb`MvMMN0RSS|PNLJH0DB@><:86Dt.,*(&$(bF LL TjU U .6UUxUVV`V\]]axabcc~|cxvtrpef2f8hfdb`^\ZXVipRPNLkxkFDB@><:862fr|(&$" m^j  ,X|6d@*2l3f  N NNaJ$`DaH`DzaGJ`DaI`DaH`DzaG4`DxaI`DpaI`DhaH`D`zaG`DVaIR`DNaH$`DFzaG`Dp0. Jg S@fp`2 gRn JD@~NuT ~NuTp>0Nu an~NuLan~Nua5|ffNup`|a4F~Nua6JGg|g|f4ANuBNuDNu`a& 9a8Ю!BGNu . BGNuA$ BGNuH/B?< NA\,_-@#L?NuH/.#?< NA\OLNuaa3BGNu BGNua3FN~Nua38N~Nua3*N<~Nua3N~Nua3N~NuaXJGg|f N ~Nu|f30N ~Nua2N *~Nua2N :~NuN \~Nua2N v~Nua2N n~Nua2N ~Nua2N ~Nua2vNt~Nua2N~Nua2 n >p~Nup>0. VNu0. Va"n >p0. J`WD@n JS@~NuaC ~Nua2> n >CrfQ0p~NuB1 Q > ~Nua2a$0|g>?a2,Ha2a$",L>a2.C "$$n >Np0~.WNua2 a1a#a2C"/ W (P$n >N.W.Wp0~Nua1a#a1a1ta#$a1c ~Nua1|~Jg 0 n >NupNua1ja#ra1a18a#r$a1.c., n >"H`Q ~Nup~Nua1(a#0a1Pa0JgS@|fg<|lf/a0a#&$a1Teb , n >"H`Q~Nu$a1.e`pA`a0/ (n > =| N9J@kr2$O͵eņ&OUA?0JAf(O/ a14.W(_Nu?<NNTHBGNua0NuaNJGg"|g|f02N~NuN&~NuNGNua0,N&~Nua0N~Nua0N~Nua0N~Nua/N~Nua/zN~Nua/N ~Nua/N ~Nua/N ~Nua/N ~NuN f~Nua/N ~Nu<k|dg UN ~Nua/:|ffN GNuaF|g|gJGf/*NuN l~NuN ~Nua/.N ~Nua/ N~Nua/N$~Nua|g|gJGf.Nua{~Nua{~NuaȾ|g|gJGf.JjDNuNuNua|g2|gJGf.Jgjp~Nup~Nup>Nufg`fg`aT|ga- n >an  >~Nu n >aj  >~Nua./ (n >B4< g<+gD<-g4a(_Nu< g<.g <9b<0e alGNu~pNua(_`a(_Nua-?aa-|ff`2gtJ@gn4HBJBf:HHBn Jb:>SAgSA n >"H$n >ڳfQ  >~Nua-84 | b8r Bg `a-/|lgXt fSBf|ff n >`g1`0Q  >f n >0p~Nua,a-aa,~|lfa-a,.gSa-(|ffvJf.Wp~NuA"d."H&n >d$n >f/ggg _`X.Wp>Nu _S AR~.WNua+Ha`a+|ff$& .$afl @"Aanx$& .%"afXan H#LanV$& .%af:amH#,.%BB#B#B#B#B#B#B#B#L#anRAL #amH#L#CamL #amH#Rd>L#NH#L#NH#L #amT$<vNpk-G% ~Nua*HaRa*|ff$& .$ae^ @"Aamj$& .%"aeJalH#NH#Lam<$& .%ae alH#NH#,.%B .%adH# .$adH#`<k|rg|fJlg\/ <kJ.f6|g"a<.!z|rg|fVJlgT\`a*"f(W`XNuaJ`p`a;x0k|pf|g|g"|g*p`Va`\O.a) W |fa)/@|g /|`a)/@|rg|fJlg\/L <kJ.f|g"a<.!z|rg|fJlg\`<kafa:¼|f <k$Og p:`$O Z "Ё Jkn `m(Z`O|lg =F!zNup`n _CgCgCgp;`Ja`dO.a(ac W n!zfa(H |g <r`a(vH|rg|fJlg\/L<kJ.f|g"a<.!z|rg|ftJlgr\`<kafa9|f<kf` WU abLaj0$&abD W L Jk auDg k`au:gj(o`fO<|lg=F!zNua`jO.a(ab: WH n!zfa'H|g <rt`a'H|rg|fJlg\/L<kJ.f|g"a<.!z|rg|f^Jlg\\`<kafa8|f<kf` WULaaLab8&(*aat WHLJ k atrg k`athgj(o``O <|lg=F!zNup"`a&|@fJgX<k|g|g|g`<k|Dg|g|g N|pg a߂<.!z|rgμ|g0|BfX L g (@=|!zNu<k|g |`la` =F!zNu L <k|gJg\(@<k|Dg(|gv|g ʼ|pg J|g|ga<.!z|rg|f=F!zNu<k|g|Bg|`la>` U=F!zNuX `Jlg\<k|g&|Bgaތ<.!z|rg|g`f L g(@`ad|f `p>`JlgD\Jg:(@ \gިX<k|gޚa.<.!z|rg|f Jlg\`aU `Bn#<k|g*|Bg0|g6|g |`la^`Jlg\`Jn#gSn#`Jn#gX`Nu<k|@g|gƼ|`la`X<k|ga`Rn#`C`Nrplfhjhfdb`^\ZXVTJHFDLD>@:0*06640.," NuPNu\NuTNuXNuXJf> GNu g (@=|r!zNuAal(I=|r!zNu gB/ (@<k|g,aܼ<.!z|rg|fJlg\`Cf(_`ATa/ E0DP(I`<k|g|gT|dgp`0a Nu/a$ _|ff|g a#a^XNu/ (n >B4B4a(_XNuXa Nu"n 6 i6gJQfp@`*, . C0Yf@fNu"F(G`"n 6 igJQfp$`ifPINu<k|pg|vgUa"tJgdb|Dg||Ffb LI?a0S@g<k|lfA`0g /(I`z/ UA<k|rg|Bg|g|lf a`UE0DP / (@`8 LI?a0S@g<k|lfA`(I=|r!zNupt` <k|fBn P`$U-L R=| P`-L LNq<k|g |`la`=F!zNu|bG` JSNu<Nua`./ /a gGCpNHN0HNYO/NLHN&_`&_L>GCpN N0N NHN&_GCpN "/BgNaQB/?<NaQH?<N. aV$G?<N&_N_FC`N8<HTXdpr~ N aPacNLaQDacN 0N aPac`0NLaQ ac|0N N aPac> NLaPacZ N aXaPb N NLaPaWaPJ N aQaPHN aP`aQaPrHNLHN. ,/1Fpc dЁ/a$$H _ 1@C._`Q$GNB$bNuJ$bg\C$b QCrtvg.e6"H(( DfJg8 A"BeE#J$%hNu#h Nu(d"$ &`"b MNup`zE$bJgN"RE&Iѱg $I")"Af` %i IАE$bJg""RE&Hg $I")"Af`Б%i"Hf*HNu!n$b-H$b Nu/.$NuHa | mRn!J.$|gaJ.$~fd|g0.$nn$xn$joaa0/|m@=@ Bn =| 0.$nn$f=@ 0.$pn$h=@ pN.raaaLNuJ.$~f| g| fBn!aJ.$~g|V$~|f@AN2LR@6&2.$pa`vL$nn$xn$jm(B@n$z4n$zn$lmn$zH$nBD:.$zDE`"H$nNuJ.$|gaNu|W$|`A-H$B.$|B.$}B.$~=|$LH$faPBn$r=|$t=| pN.rBn =| p'N.rBn p.N.rpaJnfaaNuaH =| pEN.r?<NNT-@$?<NNT<f2<4<6<`&<f2<4<6<`2<@4<6<=A$=B$=C$I=A$Bn$B$Bn$Nu<.$rL$fHaL?a~A$-H -H =| H H JDk"n n >?A?@?Coo`n n >?A?B?CWWJEk$n n ?@?A ?B ?Aoo`"n n ?@?C ?B ?Co o p1N.rL@m Am8/adL@mAmaTaNua=@ Bn p N.r-n$xaNua `a`avL$f8.$ra anB$nNuaPH?=| p N.r=| pN.r=_ pN.rBn p,N.rLH p6N.rNu@SBASCNup?N.rNu=| p>N.rNuJ.$}gHp%N.r?.=n$ pN.r=| pN.rBn p,N.r=| p N.r .$nЮ$f"Ү$xH p6N.r=_ p N.rLNu|W$}`J.$}fP$}afNuJ.$}gaZQ$}NuL$nn$xj4.$jH„$xSB$x0aBH$nn$fn$hL $x8.$ra`ta`la8`da:`\a`T2.$pn$zj:.$zBDa$L$nNu=A$pNuL$n`L$nn$xj4.$jH„$xSB$x0=B$naH$nNua$x$z=@$n=A$p`?<?<NAX`-n$$A -H$`/=@$A -H$ _NuH-n$$20.$aLNuP$~`-n$$A -H$`zJ.$|ga-n$$NuRn!İ| fBn!H| fa 0< aLNu>G?n$=@ =_ =_ =_ p6N.j`arHa@afHa4aZHa(aNHpON1p0.BGL@ap0.BGL@a0.n$HBGL@a0.n$HBGL@a`$]a n$f>aa n$h?@aa z?@aa n6LaH =| pEN.r]a Jn$>ara E S@k4n$44n$4Q0N.j`aP=@ pN.jNua>Bn =@ pN.jNua(=@ pN.jNua/><?a/Qa` =@ LGH -_ L=@ S@k r4QBRNuaj=@ pN.jNuaX=@ Bn p N.jNuaB=@ p.N.jNua0=@ pN.jNua|lgBn =@ p'N.jNu?a=@ 0`a=@ p N.jNua=@ p9N.j?.pGN.j0._BGNuNan$?aan$?aa?aa?aa?aa=_ =_ =_ =_ =_ Bn E aTn =| =| p N.jNNa4n$?a\a&n$=@ =_ =| Bn 0<N.jNNa/a"a?aa?aa?aa?aa/aa?aa?aa?aa?aa=@ =_ =_ >=G <=F -_ 6:4820@ASBSCH FGSDSEH0 -_ p=N.jNa`aV|fNuJGgA|gA`2aaJNup`da(`aJGfNu|gM|gLp`>a`a|fNua`a|fNuJGg;b|f$rNu"PgR$O͵e$_"O O "n >`QN$_ O.X 2"n >`QNҼ|~b:E\e:;PNuzNuaH<k|~b:E\ea`=F!zNu|~b:E\eEGEAPN h b ` tnlJ VJ L J F J (< 2 . | | 0 2 taZ/at<ka|b aB"~Nua.`a0/aJ<ka|b a~Nua`a/a"<ka|b a~Nua`/a<kap|bJGfVHH~Nua`޾|g |g"p` @"A a?\$& aJVHH~Nu @"A$B a9$&( * aJVHH~NuHaĂ<ka|b|gaL aJzVHH~Nua,`&(*L$raJVHH~NuHa.<ka|ba4L8aJvVHH~Nua`/a<kap|bJGf\HH~Nua`޾|g |g(p` @"A a>\$& aIgkp>Nup~Nu @"A$B a8&( * aIgk`Haz<ka|b|gaL aIrgj`a"`&(*L$raIgk`|Ha"<ka|ba(L8aIjg\jX`Na`/a<kab|bJGf^HH~Nua`޾|g |g$p` @"A a=N$& aHgk` @"A$B a7&( * aHgk`Hap<ka|b|gaL aHhgj`a`&(*L$raHgzk|`rHa<ka|baL8aH`gLjN`Da`/a<kaX|bJGfWHH~Nua`޾|g |g"p` @"A a$& Ca8|<~Nu @"A$B ?a2&( * Ea1|<~NuHab<kaԺ|b|gaL ?Aa8&<~Nua `&(*L?a1Ea1$<~NuHa <ka||baL8B?a0<~Nua`/a<kaJ|bJGf"aCGNua`޾|g|g"pNS @"A ?a72$& a7<~Nu @"A$B ?a0&( * a1@<~NuHa^<kaк|b|gaL ?a7<~Nua `&(*L?a0a0<~NuHa<ka|baL8?a0<~Nua`a6Ha<kaL|b|ganL ?a7r<~Nua` @"A$BL?a0&(* " $ a0<~NuHa~<ka|baL8?a0<~Nua0`a5HaJ<ka|bF|g*|gJGf *La7\~NuL?a7<<~Nu _"|$_?a7<~Nua`Ha<kaZ|b*JGgaL?a7X<~Nu&L?a7^<~Nua`a/a<ka|ban"Jg ~NuaT`aV/ap<ka|ba>"Jg ~Nua$`pNSa/a8<ka|b a"aAJNua`a/a<ka|ba"aA <g Nup>Nua`aa<kaJ|bJ|f O.X"$ԀHBJBfhHBn Jb^4"n >$I`!Q4"n >`QЁNuaT`aar<ka|b|fRaJVHH~Nua"`ava@<ka|b|f aSHH~Nua`aDa<ka|b|faUHH~Nua`aa<kaN|b|faWHH~Nua`aa<ka|b|faTHH~NuaZ`aax<ka|b|fXaPRHH~Nua(`4&HCHCJCf((HDHDJDfH@J@gHAJAf"҃e ҄e<Nu<Nu$_a.WN&_ n >C"/gJgfSAgS@f`S@@NH@B@H@=@ J*n > 0 @ Bd0<9A'@C$BBQNuFC`N(.44Lp NS~ `*~L`*pBGNu0HBGNu BGNup0(2 P"n >`Q~Nup0. J"n >W|gn JD@~Nup NSFGCpN8:<>HPV\bhpv|Nu0Nu Nua1`a) Nua+:a)HNua`QNu1G$n >"P`QNu"n >`QBNu<kzgz|bC`NpNSj$>4~|zxtrpnl"&LB@@E&< g$@A0\f@fNu(K`pNu|`|`|` |`|`| g" @0@f0k|`g|gULNuCaf"`JEgJn ~j^p1a Q |B pA p`;`NHHIpT2AfЇH`aצLI$B00@f""H`BQ`rpNSa|0k|`g:|gVULNuaҁ|0k|`g|g4ULNua|0k|`g|gULNua`|0k|`g԰|gULNua>|0k|`g|gULNua|0k|`g|gULNu gh @0@f4|gB1H?<v=`B?<`?<al"n >B16H?Hn((?<NA\Bg/. >?<NNAPv=J@gv?NAPHBGLpNuaa |lgNu??<>NAXJkPNuaa`?<?|pfa/?<BNA Jk Nua?<?/<?<BNA JkBGNua?<?B?<BNA*?|B>BNAW/E>BNA Jk HHBGNua:?<?B?<BNA*?|B>BNA,/E>BNA Jkr BGNuHn p/<a?aa@ p?<@NA Jk>NuHn p/<a??<?NA Jkp. pBGNua0/ ?<9NA\J@kNua/ ?<:NA\gJ@kNua"n >n Jd>B1NuaxC $n >S@kQB/. >Hn((?<NA\C ?</ ?<NNAPJkh$_"J > Jl\C(F.(=g * `  J fSg f / ?<ONATJj|f"  >~NupNSC *.*BaL"n >2SAk paQ`?<NATJk"n >A:?</ ?<GNAPJk"n >Jf|\ >~Nu<k|pfaB?"n >S@k$ :Wg"n >`)H@A??<NAX0"n >B1/ ?<;NA\Jk@Nu?<NATHBGNu<k|pf~a??<NAXNuaR?Hn((?<6NAP .(4(2(*BGNua n >B0RaHoaלa n >B0"_/. >/ Bg?<VNA JkaNua/ ?<ANA\gJkNu/ <kar&_H/ a4<ka^&_H/ a aF&_H/ (Kaaa.a"n >E -J|dS@kQBa6"n >B1-I/ pZN1*_(_0.D@HJnfpBGL@a"n >Jf >SL@.aC $n >f >S G~aTaL@~aF`aPaB/ ?<CNA JkBGNua.a|pfaTa>az"n >B1??</. >?<CNA JkNAXJkzNua??<ENAXJkdNuBgaa?a?@?<FNA\Jk@NuaBgaHoaa.Bga BBHzFHo/aa?aaH@?<KNAL@BGaaJ_aJ_`a\??< NMXBGNu?< NMTBGNua8/ n >X@| o@ J@fp a: ah ar X@| lA`PM  > ~Nua/ n >a a" a, > ~NuX@a$:NuH@?a:Nu@@aNu4H 20 A0Nuaj/ n >a@ aH aR  > ~NuaD/ n >a( a a,  > ~Nu@a/NuH@a/NuX@@BGaa bNu?<,NATBGNu<k|pfa??<-NAXJk4Nu?<*NATBGNu<k|pftaߪ??<+NAXJkNuaߔ?aaa0@/a,C>N nl!zg0Nu8@//<`//<`//<??<@NA JkNu//<`?aްn Jg"n >B1 n!zfaU>-@ pHn r/<??<@NAJkD /. >/. p`/Jf/`a޶?aaH>/E p0@CNL@aa|lg0Nu2Vxv/ /<??<?NA Jkp. pBGNu/ /<??<?NA Jkp0. pBGNu/ /<??<?NA Jkt . pBGNu/ /<??<?NA JkP . pa2~Nu/ /<??<?NA Jk( . p". ta`~NuHn p/<??<?NAJk p0. pn Jd\"n >B1/ /??<?NAJk "n >Jf >S ~Nu|"n >/ J-I p/<??<?NAJk"oJg  e`Jg pg/I` > S~Nup//a?aa/@a a/@?<?NA Jk*Nup//aܲ?aaܨ/@aaܜ/@?<@NA JkNua܀?aάaP|g(|f n >a > `a& n >a > >|g$H /. >/??<@NA JkL0` n >.Spa`Q><.!z|g |rg|Bg|lg| g|tg`p a.TNuUp a$`Rp a"LaF|rg|g(I`2|f@`H @ pHn p/<??<@NA JkL0Nup NSad?a͐aH>/|aL@|lBH (n >Bn p<-fFn p`<.g <0m<9na@L0~Jn pgaL@aaz|lgTNuBn(T=|(VNuJn(Tj=|pkN1Jn(Vk BnpkN1=|(VBn(TNua8 INJ@g|gNW@NWLNuRn(Tfp`Sn(T n(Tfp=@pkN1`Rn(Vfp`Sn(V n(VfB@`aaH?aba0?a\a&?aRatHaBahHa6a\Ha*aPHL=_=_=_HpN10.HL@BGa0.HL@BGa0.HL@BGa0.HL@BGa0.HL@BGa` aـaˮ/av-@ WCp2QpN1 _ Cp0QNup~Nup3NSa0p~Nu0.H~Nua"J@k=@pfN1Nua J@k?=@pgN10nf=|rAưpf1TA|fNuJfprNSNuaؼ?aaز|lf?aئ-@0` a-n@=@=_pN1Nuaz?aʦap|lf?ad-@0` a-n@=@=_p N1Nua8?ada.|lf?a"-@0` aH-n@=@=_p!N1Nua?a"a|lfa8a-@a\` a-n n >H@B@H@B0-H=_p"N1Nuaצ?aaל-@=_=|piN1Nua׀?aɬav-@=_=|piN1NuaZ?aɆaHavaHajaHa^aH=o =|phN10.H~L@a0.H~L@a0.H~L@a0.H~L@aTN{a?aaHaa HaaHaaH=o =|phN10.H~L@a0.H~L@ap0.H~L@a`0.H~L@aPTN{a6?aba,?aXa"?aNa?aDa=@=_=_=_=_=|piN1Nua?aa4Haa(HaaHaaH=o =|phN10.H~L@a0.H~L@a0.H~L@a~0.H~L@anTN{aT?aǀaHapaHadaHaXa~H=o =|phN10.H~L@a 0.H~L@a0.H~L@a0.H~L@aTN{a?aaԸ=@=|=_piN1NuaԖ=@=|phN10.H~Nua|?aƨar=@=| =_piN1NuaP=@=| phN10.H~Nu<k|pfa*=@=| piN1NupNS=| phN10.H~Nua?aa@Haa4Haa(HaaH=o =| phN10.H~L@a0.H~L@a0.H~L@a0.H~L@azTN{a`?aŌaHa|aHapaHadaH=o =| phN10.H~L@a0.H~L@a0.H~L@a0.H~L@aTN{=|a/aaҾ=@-_=|piN1NuaҢ?aaҘ=@=|=_piN1Nuav=@=|phN10.H~Nua\?aĈaR=@=|=_piN1Nua0=@=|phN10.H~Nua?aBa ?a8a?a.a?a$a|ff=@=_=_=_=_pdN1p>0.NuaѼ?aaѲ?aaѨ?aaў?aaє=@=_=_=_=_peN1NuHaanL@NupNSaaH炀azaaH炀ajaaH炀aZaaH炀aJa/aDa/a:a/a0a/ /4"/($/&/(/ */,/.NH~L@8a~ /L@,a~ /L@ a~ / L@a@NuaЈ/a´a~?aªat?a aj?a–a`?aŒaV?a‚aL=@=_=_=_=_=_-_p*N1NupNSa/aFa?aB0-Hp4N1Nu~?a~>?aQan=@=_=_=_=_=_=_=_=|p3N1Nu~?a6>?a`Qa&=@=_=_=_=_=_=_=_=|p3N1Nu a/aa?|lgBoBn oLHp3N1JogLH=|p3N1-oBn=|dB=n$=n$p*N1-o=Wp2N1 oLHJogLH=|p3N1=|p3N1Nu?|a?@a8a?@ a,a?@ a a?@`a/a a=@-_p2N1NuBg`?<aͶ?aaͬ?aa͢?aa͘=@=_=_=_=_p3N1Nuav/aal?aab?aaX?aaN?azaD?apa:?afa0=@=_=_=_=_=_=_Bn-_p/N1Nua-@p6N1Nua?aa?aa0a`H炀aa aPH炀=o=o / =@ =@pFN1L@~0.HaܚL@~0.Ha܈N{aj?aa`|ff4=@=_pjN1~0.HNu?<`Bga2?a^a݀aH炀aJapaH炀a:a`aH炀a*aPaH炀 =@ / =@ /=@ /$=@=o0=o2plN1L@~0.HaۺL@~0.HaۨL@~0.HaۖL@(~0.Haۄ4N{aܾaH炀aaܮaH炀axaF?ara-I|l  R`B1p N10.HBGNua/a|dԮE "n >"SkQBA NHNuaǨ/aȰ|d|E "n >"SkQBA NH"n >$I JSgg` > S~NuaVJ@kV|bN@A N BGNuDFLPV\bhntzpNS NNuANuA$NuANuA.NuATNuANuA{NuA8NuANuApNuA^NuAZNuANuANuANu nNu0nNuANuA Nu MNuA{NNuASNuAѶNuA'NuANuANuATNuA NuANupNSpNSpNSpNSp=NSpNSpNSpNSpNSJjzdRAHAfB NuJAkRj"g HBNuJj.dRdRB>GGBfABB ABBNurpNuJBk`p$g$4 BBANu&jDRBkRAk2gA lDAJjRJjD2aJk2NuE @"A$< LevaaaGNu&<ԚxK(<z`&<;)(<\za| mJjprtNua?aJk4NuG 4 @"A$Baa a aaa_NuaL8`aL8aL8`Jj4dRAB$RAk"gA lDAJjDJgJjSNupJjpNuJjdRdRBA&(RBk,g :SE؄׃QB lJDBJjDgJjSNupJjpNua$<[ةvUC`f.kJjTeRGH?a*,$<vaaEaJjRA4g @"ArpjD@H@aa`a&<[ة(<7(qzUE`t.k|JjvTeRGH?axH&<xzaxL8aG ~a0JjRB6g @"A$Btpr0jD@H@aa`2H?a @"A$BaHadRAB$RAk,gA lDA⨴fgJjRJjDNupNuJjdRdRBA&(RBkg :SE؄׃QB ljDBJffgJjRJjDNu|n$$<ڢv`j| n&NuafE~*,ada^ @"A`Aa`fafG8~H?ava @"A$B`Ba`aBRG`a:gaANug Ea @"A~ "aaQNu*,ETa$&`aRG`agaBNug&Ga @"A$B?<Laa0SWfTNuHGaL8`$k*j.BUH$B,$/7i+Z*SFe4K`+>Zu! sǵk}1ۏt=.p{?2 k( ` h&4^TmԳ1ne}I<" 6FŏŏLG`g0VGf͖tЮbⰏs=%mecV,57SF€f/-Z\*x*n{PIЋ e|! sLK:Nװ:i2)2}*)Қ ?N󈈈L?Ӿzp e%7Xx}  XÀp T%0 FF X)}/Հ ` ` vH;`[FF$;`Nu@P$ k(C@ԥ* _2ɿ/ k:#x !$'+.158;?BBBaJAfNuJAgfSANua< g<@f J@gRS@Nu<Xf `@<Nf `4<|fa`(<gθ<|faa`<CfJ@gBS@RBn Jb Nu<{fFJ@g(H@@ }gaz`J@gL`RSANuH }gaR`LRSANu<1eҸ<9bD 0e 9bSAE E` *f"RSABc8:g@DEDa^SDPQNu $fRSA`@ LfRSABcDa0SD QNu Rf,RSA:BcDaSDkPQSE PQNuH@@?aSWgL` Nu<(f )ga\`<Af J@gS@<ae<zb`<af J@gS@<Ae<Zbx `p<*f JBg``<BfVJBgSSBNuH"`H 2E)8BBBa|JAfBaLHBBBHBJk4EFgFA)8 SBf`8Hav(<<g&<xza"aRF>LxaaL0A)8BBaJAfNuaH< g<Dg(<Eg <.g<dg <Zg<zf<DRB|(bNu<^fPNu<|g<g"<|fa`<+fJj H a|LNu<-fJjNu<1eH<9b@D 0e 9bSAE E`H@@?a0SWgL` Nu<(f )ga `aN< g<Xgj<Ngn<|gr<BgB<Zg<.g<JFf>Ek$aQg 5eR 9c0`>A)8E)a 0gSRGNuJFfT0gJGkGg k S@fJEg0jD@Ec00S@f0GkgS@f0g"H !0f S@fNu0gS@f0gS@f"H0 !0f S@fD0jD@H|e0B@H@d|e0B@H@ |e0H@0DF 00`f  `RFfNuNPJ  ݠXLWRGxEb[{ϐmӐܐj@f" p*[2][Sorry. Puncher V.2 will only | work correctly in low resolution][OK]lff     lll   2J& Reserve memory for image importation2(card|(lf("xmark&(f""ymark&(f" 0tresize|p"0image%l}"  "card_width%p"$,card_length%p$&@image_type$p**.NEO&h\io_pth$p*A:\CARDS\ hlimport_pth$p*A:\ l@h_factp^ Pv_factpG "&p*PUNCHER2.INF""&t@"R&lcard_width%l,card_length%l@image_type$l\io_pth$limport_pth$l@h_factlPv_fact  &  J.J" Set up arrays for event handling.J "parm&(f""mess&(f"& col_name$(f&$N/"EventData$"&Lp""`parm&(&Lf"  6 EventDatanL`lllllllllllllllnJ*J Get rid of any open windows*J(N0linitial_names("&p"& col_name$(&f&  6initial_namesL *WhiteL *BlackL*RedL *GreenL *BlueL*Dark BlueL *BrownL*Dark GreenL *GreyL*Dark GreyL *CyanL*Dark CyanL *Magenta L*Dark Magenta L*Dark YellowL *Yellow  (style|(lf((dens%(lf(&N3$fil_styles&"&p"(Xstyle|(&lf((Xstyle|(&lf(  6 fil_stylesL lL lL lL lL lL lL lL lL lL lL lL lL lL l L l L l  FDHDF@H@"&p "FBd&fHBd&f  (image_mfdb&( f(&real_mfdb&( f&$N6pmfdb_data$"&p "(zimage_mfdb&(&f(&real_mfdb&(&f&  6 mfdb_data.L 0image%^lj^."L0image%lj"L @l@L lL lL lL lL lL lL lJ(J Get coordinates of desktop(JBjlfx%lfy%lfw%lfh%B&fh%pfh%x&"title%l2"J$J Create editing window $J2&p:ll l?lf2Bfx%lfy%lfw%lfh%vB<>sub_col1%p rJCurrent Main Colour<>Rwith_col1%prJCurrent Main Colour> dmain_col%p pwx%p|wy%pww%pwh%p first_x%p "first_y%p" bot_left%p h_mid%pv_mid%psrep%prrep%p sfile&p "buff%l  4full|p*colours&(lf*&col_count%(f&J8J, PROCassemble will set up the M/C routines8J for AES calls.JV assemble:VGrsrc_loadd*PUNCHER2.RSCl der|f:6 der|@<Dexit6  *J SETUP VARS FOR TREE INDEXES* ttr_menu%p "ˆtr_desktop%p="& tr_def_colour%pJ&&¸tr_sel_maincol%pa&$tr_version%pz$$tr_set_size%p$$tr_col_count%p$" tr_col_sub%p"$"tr_turn_card%p$&:tr_image_type%p&$Ptr_name_cols%p$$ftr_ent_fact%p$$ztr_repeat%p$"Îtr_working%p "Tàneo_def%pXErsrc_gaddrdl:tr_image_type%vfTRdg_def%pXErsrc_gaddrdl:tr_image_type%vfR2@image_type$j**.NEO@@02Fneo_def%v pneo_def%v xFBdg_def%v pdg_def%v vB   2J& Find address of Menu and install it2Fmenad%pXErsrc_gaddrdlttr_menu%fFmenad%J Replace desktopHdeskad%pXErsrc_gaddrdlˆtr_desktop%fH"vdeskad%l"^deskad%lllfx%lfy%lfw%lfh%v^  lstmes&p windopen|p &quitp>6colour%p rJCurrent contrast colour>,Jcard_name$p*DESIGN.CRD,0title%pJcard_name$0J@J4 Put tick against current contrast colour on menu.@J(J0llmenad%(JLJ@ Set up array to contain the RGB components of the 16 colours.LJ$NEcol_data$"&p""&p"*Dcolours&(&l&f*  lP&lDcolours&(&lflDcolours&(&lflDcolours&(&lfl  &col_trans&(f&"&p"&|col_trans&(&f&  &real_col&(f&"&p"&real_col&(&f&  6 col_data Lll  Lll  Lll  Lll  Lll  Lll  Lll  Lll  Lll  Lll  Lll  Lll  Lll  Lll  Lll  Lll >L0llll;llYl>nL`llllllll l l ll ll ln  &quitp first_y%p first_x%p < Bj&lfx%lfy%lfw%lfh%BB&lfx%lfy%lfw%lfh%B >   lstmes&p windopen|p  J(J Wait for an event from GEM(J  6eventBb&lpwx%l|wy%lww%lwh%B<`parm&(flmess&(f<J4J( ********** Message events ***********4J4`parm&(fh@4*RKZmess&(f*(TKrJRedraw(, windopen|p@,Vhredraw  .TLrJClose Window., windopen|p@,F& resize|p  windopen|p   *TMrJ Full window*, windopen|p@,Bj&lfx%lfy%lfw%lfh%BBf&lfx%lfy%lfw%lfh%B resize|p  $TTrJArrow$, windopen|p@,*Rmess&(f*&TrJPage Up&Dfirst_y%pfirst_y%xdwh%|fDDfirst_y%n@first_y%pD(TrJ Page Down(Dfirst_y%pfirst_y%vdwh%|fDfirst_y%tcard_length%xdwh%|f@first_y%pcard_length%xdwh%|f&TrJRow Up&2first_y%pfirst_y%x2Dfirst_y%n@first_y%pD(TrJRow Down(2first_y%pfirst_y%v2first_y%tcard_length%xdwh%|f@first_y%pcard_length%xdwh%|f(TrJ Page Left(Dfirst_x%pfirst_x%xdww%|fDDfirst_x%n@first_x%pD*TrJ Page Right*Dfirst_x%pfirst_x%vdww%|fDfirst_x%tcard_width%xdww%|f@first_x%pcard_width%xdww%|f(TrJ Col. Left(2first_x%pfirst_x%x2Dfirst_x%n@first_x%pD*TrJ Col. Right*2first_x%pfirst_x%v2first_x%tcard_width%xdww%|f@first_x%pcard_width%xdww%|f  Vredraw  *TUrJ Hor. Slider*, windopen|p@,jfirst_x%pmess&(f|d|dcard_width%xdww%|fffjVredraw  ,TVrJVert. Slider,, windopen|p@,nfirst_y%pmess&(f|d|dcard_length%xdwh%|fffnVredraw  &TWrJResize&, windopen|p@,jf&lmess&(flmess&(flmess&(flmess&(fjBb&lpwx%l|wy%lww%lwh%B 0tresize|pVhredraw  $TY:rJMoved$, windopen|p@,jf&lmess&(flmess&(flmess&(flmess&(fjBb&lwx%lwy%lww%lwh%B<wx%lwy%lww%lwh%<  *T rJ Menu option**RYmess&(f*&T[ rJVersion&Jver_def%pXrsrc_gaddrdltr_version%fJver_def%,Vrscreendver_def%f,*Vdobjdver_def%f*&\ver_def%lx&$aespb%p@df$2inout%paespb%v 2* exit&pinout%*L&pXrsrc_gaddrdltr_version%v exit&fL.&v p&v x.,Vfscreendver_def%f,$T rJQuit$`" p*[2][ Are you sure that you | want to exit this | program? ][Yes|No]lf`4" p@quitp4,TjJ rJ Import Image, lll lll <p$pimport_pth$vimage_type$<"image_name$p*"6select_load_image2p$limage_name$l"22B"2p@Dabort_load_imageB,Pp$lfj*\,@p$pp$lddp$fxff@  4f$pp$vimage_name$4(import_pth$pp$(,ihandle%pdf$f,"9p2file_length%pihandle%2zfile_length%p@"9p*[3][That file does not exist.|Select again?][Yes|No]lfznfile_length%j}hihandle%j}"hihandle%j}B@nh"9p*[3][This file is not a NEOCHROME | or DEGAS picture. Select again?][Yes|No]lfh  V"9p@ihandle%rDselect_load_imageVX"9p@ihandle%rDabort_load_imageXihandle%0file_length%p}@0" pal_offset&p"@image_mfdb&(fpimage%v@B" pal_offset&p"@image_mfdb&(fpimage%v"@  (f$limage%("&p"B&pimage%v pal_offset&v&zB0&l&^l&^l&0  limage_mfdb&(flllllreal_mfdb&(fllll  Lchange%llltx%lty%l&l&L$&h.@$jtx%lty%lcard_width%zlcard_length%llllj 4 2&pcard_length%20&pcard_width%0Xcard|(&l&fpRtx%vd&zflty%v&fX  ltx%lty%v&tx%vdcard_width%zflty%v&l  "&p"B&pimage%v pal_offset&v&zBhcolours&(real_col&(&flfpcol_trans&(d&^h.ffhhcolours&(real_col&(&flfpcol_trans&(d&^h.ffhbcolours&(real_col&(&flfpcol_trans&(d&h.ffb(col_count%(&fp(  CCNThival%phicol%p"&p">col_count%(&fthival%@>2hival%pcol_count%(&f2hicol%p&   *main_col%phicol%*B"&p"lP&lcolours&(&lflcolours&(&lflcolours&(&lfl    >menad%llllll > 6   6abort_load_image lll (Tqr rJ Save Card(.p$pio_pth$v**.CRD.2p$lcard_name$l"22"2@,Pp$lfj*\,@p$pp$lddp$fxff@  4f$pp$vcard_name$4$io_pth$pp$$,shandle%pdf$f,"9pshandle%r@"9p*[3][That card already exists|and will be replaced if|you decide to continue.][Continue|Exit]lfshandle%J IF z|=1 THENJ DELFILE f$J ENDIF0"9pf"9p@0J Perform saveVworking|l* sfile&pdf$f*svcardlerpz( full|j@(|lh" p*[2][ This disc is full and | there is no room to | save the design.][ OK ]lfhB@X sfile&llcolours&(lf@lerpz$J save card dimensions$6X sfile&llcard_width%6lerpz8X sfile&llcard_length%8lerpz J save main colour 4X sfile&llmain_col%4lerpz"&p"6T sfile&l col_name$(&f6lerpz   sfile&lerpz|l0title%pcard_name$0*Vfscreendw_def%f*     (Tw rJ Load Card(.p$pio_pth$v**.CRD.6select_load_card2p$lcard_name$l"22<"2p@Dabort_load<,Pp$lfj*\,@p$pp$lddp$fxff@  4f$pp$vcard_name$4$io_pth$pp$$* sfile&pdf$f*"9pv sfile&p@"9p*[3][That card does not exist.|Select again?][Yes|No]lfvT"9p@ sfile&rDselect_load_cardT""9p@"VworkingJ Perform load&p&p exit|p|lldcard@V sfile&llcolours&(lf@$J load card dimensions$6V sfile&llcard_width%68V sfile&llcard_length%8 J load main colour 4V sfile&llmain_col%4"&p"4R sfile&l col_name$(&f4  "&p"lP&lcolours&(&lflcolours&(&lflcolours&(&lfl   sfile&0title%pcard_name$0|l*Vfscreendw_def%f*  6 abort_loadTx^" p*[2][ Are you sure that | you want to clear | the card ?][Yes|No]lf^"" p@"clcard< windopen|p@Vredraw<  0T|lrJSet image type0Pimgtyp_def%pXrsrc_gaddrdltr_image_type%fP imgtyp_def% .Vrscreendimgtyp_def%f.,Vdobjdimgtyp_def%f,(\imgtyp_def%lx($aespb%p@df$2inout%paespb%v 2* exit&pinout%*P&pXrsrc_gaddrdltr_image_type%v exit&fP.&v p&v x.Rneobut%pXrsrc_gaddrdltr_image_type%vfRRdgbut%pXrsrc_gaddrdltr_image_type%vfRVneobut%v h.@image_type$p**.NEOVVdgbut%v h.@image_type$p**.PI1V.Vfscreendimgtyp_def%f.T" Ŷaxis_flag|p"$Plll$$Plll$"&p"*dens%(&lfp&**dens%(&lfp*"&p"^dens%(&lfpdens%(&lfvDcolours&(&l&f^   .&px."&p&"Rdens%(&lftdens%(&vlf@R4tmp1%pdens%(&lf44tmp2%pdens%(&lf4Hdens%(&lfpdens%(&vlfHHdens%(&lfpdens%(&vlfH:dens%(&vlfptmp1%::dens%(&vlfptmp2%:    lll  4 lll ."&p"(col_count%(&fp(  CCNT"&p""&n@"x1%p#of%pBx1%pof%p  "&p"6dens%(&lfp&@|6g1%p&&p   R Xstyle|(g1%lflXstyle|(g1%lfRvx1%ldd&xof%fz fv2lx1%vldd&xof%fz fv:v^,x1%vldd&xof%fz fv8l col_name$(&f^l,x1%x#ldd&xof%fz fv8lcol_count%(&fl*ZZZZZfl. (,Zll*Colour Key(cnt%p,,ZllJcard_name$,.<(p@h_fact| <llen%p(cnt%t@f(f1%p Bf1%p  Jcnt%bp@llen%pJ8cnt%b p@8llen%p 6cnt%lcard_width%@6@,(xf1%llcnt%l*zzDf@    6cnt%lcard_width%@66(l(lxllen%6  *cnt%pcnt%v*  6 d" p*[1][ Ensure that your printer | is ready to print.][ Continue | Cancel]lfd 4 :" p@Dprt_abort:scr_dumpJ REPEATJ a$=INKEY$J UNTIL a$<>""rcnt1%pscnt1%prcnt%pscnt%pxofs%pxyofs%p  6 prt_draw>&pcard|(scnt1%lrcnt1%f>"&p"6dens%(&lfp&@6g1%p&&p   P style|(g1%lflstyle|(g1%lfPJ&pdscnt1%zdh_fact| ffxxofs%JJ&pdrcnt1%zdv_fact| ffxyofs%J4x1%p&vdh_fact| f44y1%p&vdv_fact| f40~&l&lx1%ly1%0scnt1%pcard_width%xhrcnt1%pcard_length%xhx1%lhy1%l@Vprt_cardrDprt_endRx1%rfscnt1%pcard_width%x@RTy1%rfrcnt1%pcard_length%x@TVprt_card$y1%n@$ rcnt1%p rcnt%p&scnt%pscnt1%&(xofs%pxofs%v(yofs%p4(pcard_width%4 llen%pF f1pd(zdh_fact| ffxxofs%F& f2pf1x &B (bp@llen%pB0 (b p@0 llen%p 4,f2ll(l*zzDf4  B f1lf1lxllen%B  "scr_dump"J REPEAT J a$=INKEY$ "J UNTIL a$<>"""B*yofs%pyofs%v*&rcnt%prcnt1%&(scnt1%pscnt%(  B.rcnt1%prcnt1%v.&scnt1%pscnt%&  B.scnt1%pscnt1%v."Dprt_draw"6prt_end. axis_flag|p@.$x1%px1%x$&yofs%pzx&6 last_axis(yofs%pyofs%v(2(pcard_length%2llen%pFf1pd(zdv_fact| ffxyofs%F0f2%pcard_length%x(0"(p@"f3%pBf3%p  Hf2%bp@llen%pH4f2%b p@4llen%p ,t$pf2%l*zzDf,B,x1%v lf1vf3%lt$B`x1%v vddt$fzft@ axis_flag|p`  Tx1%vlf1x1%vllen%lf1T  scr_dumpJ REPEATJ a$=INKEY$J UNTIL a$<>""@f1t@Dlast_axis@  6 prt_abortlPlDcolours&(lflDcolours&(lflDcolours&(lfllPlDcolours&(lflDcolours&(lflDcolours&(lfl l>menad%llllll > 6  lll TVviewcard  *T rJ Start Edit*, windopen|p@,quitp first_y%p first_x%p < Bj&lfx%lfy%lfw%lfh%BB&lfx%lfy%lfw%lfh%B >  lstmes&p  windopen|p   TLtrc_def%pXrsrc_gaddrdltr_turn_card%fLtrc_def%,Vrscreendtrc_def%f,*Vdobjdtrc_def%f*&\trc_def%lx&$aespb%p@df$2inout%paespb%v 2* exit&pinout%*N&pXrsrc_gaddrdltr_turn_card%v exit&fN.&v p&v x.H exit&p @Dabort_turn_cardHPl2rbut%pXrsrc_gaddrdltr_turn_card%vfPPt2bbut%pXrsrc_gaddrdltr_turn_card%vfPBh_mid%pddcard_width%xf|fBDv_mid%pddcard_length%xf|fDJl2rbut%v h.@tl2rJJt2bbut%v h.@tt2bJ  6abort_turn_card,Vfscreendtrc_def%f,T!$Plll$$Plll$ lll  4 lll (l.l(,&p. ,(&l&l(  ,&p.,(&l&l(.,&p,,&t$p&l*zzDf&Hdt$fp@,&llt$HNdt$fp@,&xllt$NNdt$fp@,&xllt$N,&p ",&t$p&l*zzDf&4&vl &vl4Hdt$fp@,&l lt$HNdt$fp@,&xl lt$NNdt$fp@,&xl lt$N(2l(2l(,&p( ,(2l&(l&(  ,&p(,(2l&-l&(  ,&p ,4#l&v((l&v(4&t$p&l*ZZDf&*,l&v*lt$*.8,Fl2l*Use the horizontal rule to8:,Fl:l*measure 10 stitches from your:4,FlBl*card. This will be the40,FlJl*horizontal factor.08,FlZl*Similarly, use the vertical8:,Flbl*rule to measure 10 rows from:8,Fljl*the card. This will be the8.,Flrl*vertical factor..:,Fll*Record the two values below.:4,Mll*Horizontal Factor = ___44,Mll*Vertical Factor = ___4(Fl l(( l l(( lFl((FlFl((Fl l( 6 d" p*[1][ Ensure that your printer | is ready to print.][ Continue | Cancel]lfd 4 6" p@scr_dump6lPlcolours&(lflcolours&(lflcolours&(lfllPlcolours&(lflcolours&(lflcolours&(lfl>menad%llllll > 6  lll 2T" rJSelect Main Colour2Nsmc_def%pXrsrc_gaddrdltr_sel_maincol%fNsmc_def%fold_mainfirst_x%pXrsrc_gaddrdltr_sel_maincol%vfv f>old_mainfirst_x%pdmain_col%f>fnew_mainfirst_x%pXrsrc_gaddrdltr_sel_maincol%vfv f@new_mainfirst_x%pnew_mainfirst_x%@  ,Vrscreendsmc_def%f,6ent_new_maincol>new_mainfirst_x%pdmain_col%f>*Vdobjdsmc_def%f*$\smc_def%l$$aespb%p@df$2inout%paespb%v 2* exit&pinout%*P&pXrsrc_gaddrdltr_sel_maincol%v exit&fP.&v p&v x.J exit&p@Dabort_sel_maincolJNnew_main_col%pXcvthexdnew_mainfirst_x%fN2new_main_col%px@2P" p*[2][ Please enter a valid | colour code. ][O.K]lfPB" p  <" @Dent_new_maincol<,sub_col1%pmain_col%,2with_col1%pnew_main_col%2CHMAIN0main_col%pnew_main_col%06abort_sel_maincol,Vfscreendsmc_def%f,T#Lscz_def%pXrsrc_gaddrdltr_set_size%fLscz_def%Zwidth%pXrsrc_gaddrdltr_set_size%vfv Z,width%pwidth%,<width%pcard_width%l*zzDf<Zheight%pXrsrc_gaddrdltr_set_size%vfv Z,height%pheight%,>height%pcard_length%l*zzDf>,Vrscreendscz_def%f,6ent_card_size*Vdobjdscz_def%f*$\scz_def%l$$aespb%p@df$2inout%paespb%v 2* exit&pinout%*N&pXrsrc_gaddrdltr_set_size%v exit&fN.&v p&v x.H exit&p@Dabort_card_sizeH2new_width%pwidth%22new_height%pheight%2" pLnew_width%nfnew_width%t@L`" p*[3][ Please enter a width | in the range 1 to 200 | stitches.][OK]lf`  8" @Dent_card_size8Lnew_height%nfnew_height%t@L\" p*[3][ Please enter a height | in the range 1 to 200 | rows.][OK]lf\  8" @Dent_card_size80card_width%pnew_width%02card_length%pnew_height%26abort_card_size,Vfscreendscz_def%f,&T$ rJCounter&"&p"(col_count%(&fp(  CCNTLccn_def%pXrsrc_gaddrdltr_col_count%fLccn_def%"&p"^tmp%pXrsrc_gaddrdltr_col_count%vv&fv ^Ntmp%pcol_count%(&fl*ZZZZDfv>dfN,Vrscreendccn_def%f,*Vdobjdccn_def%f*&\ccn_def%lx&$aespb%p@df$2inout%paespb%v 2* exit&pinout%*N&pXrsrc_gaddrdltr_col_count%v exit&fN.&v p&v x.,Vfscreendccn_def%f,&T% rJCounter&"&p"(col_count%(&fp(  CCNTJcsub_def%pXrsrc_gaddrdltr_col_sub%fJcsub_def%"&p"\tmp%pXrsrc_gaddrdltr_col_sub%vv&fv \Btmp%pcol_count%(&fl*ZZZZDfB,Vrscreendcsub_def%f,6ent_sub_cols*Vdobjdcsub_def%f*$\csub_def%l#$$aespb%p@df$2inout%paespb%v 2* exit&pinout%*L&pXrsrc_gaddrdltr_col_sub%v exit&fL.&v p&v x.H exit&p'@Dabort_sub_colsHZsub_col%pXrsrc_gaddrdltr_col_sub%v#fv Z0sub_col%psub_col%0Zwith_col%pXrsrc_gaddrdltr_col_sub%v%fv Z0with_col%pwith_col%0Bsub_col1%pXcvthexdsub_col%fBDwith_col1%pXcvthexdwith_col%fD" pPsub_col1%pxfwith_col1%px@PJ" p*[1][ Please enter valid | colour codes. ][OK]lfJ  Fsub_col1%pwith_col1%@" pF<" @Dent_sub_cols<* exit&p)@*Psub_col1%lcolours&(with_col1%lflcolours&(with_col1%lflcolours&(with_col1%lfVviewcardPsub_col1%lcolours&(sub_col1%lflcolours&(sub_col1%lflcolours&(sub_col1%lf  H exit&p)@Dent_sub_colsHCHMAIN6abort_sub_cols,Vfscreendcsub_def%f,,T' rJDefine Colour,Lc_def%pXrsrc_gaddrdltr_def_colour%fLc_def%Tchar_add%pXrsrc_gaddrdltr_def_colour%vfT@char_add%v pddcolour%ff@<char_add%vpvcolour%<^old_red%pXrsrc_gaddrdltr_def_colour%v fv ^^old_grn%pXrsrc_gaddrdltr_def_colour%v fv ^^old_blu%pXrsrc_gaddrdltr_def_colour%v fv ^Told_red%pcolours&(colour%lfl*zzzDfTTold_grn%pcolours&(colour%lfl*zzzDfTTold_blu%pcolours&(colour%lfl*zzzDfT^new_red%pXrsrc_gaddrdltr_def_colour%v fv ^0new_red%pnew_red%0^new_grn%pXrsrc_gaddrdltr_def_colour%v fv ^0new_grn%pnew_grn%0^new_blu%pXrsrc_gaddrdltr_def_colour%vfv ^0new_blu%pnew_blu%0Tnew_red%pcolours&(colour%lfl*zzzDfTTnew_grn%pcolours&(colour%lfl*zzzDfTTnew_blu%pcolours&(colour%lfl*zzzDfTZname%pXrsrc_gaddrdltr_def_colour%vfv Z(name%pname%(>name%p col_name$(colour%f>*Vrscreendc_def%f*6ent_col(Vdobjdc_def%f("\c_def%l "$aespb%p@df$2inout%paespb%v 2* exit&pinout%*P&pXrsrc_gaddrdltr_def_colour%v exit&fP.&v p&v x.( exit&p@(Pcolour%lcolours&(colour%lflcolours&(colour%lflcolours&(colour%lf  ( exit&p@(pPcolour%ldnew_red%fldnew_grn%fldnew_blu%fp  ( exit&p@(Lcolours&(colour%lfpdnew_red%fLLcolours&(colour%lfpdnew_grn%fLLcolours&(colour%lfpdnew_blu%fLPcolour%lcolours&(colour%lflcolours&(colour%lflcolours&(colour%lf> col_name$(colour%fpname%>  B exit&p@Dent_colB*Vfscreendc_def%f*T(Hr_def%pXrsrc_gaddrdltr_repeat%fHr_def%Xs_text%pXrsrc_gaddrdltr_repeat%vfv X,s_text%ps_text%,6s_text%psrep%l*zzDf6Xr_text%pXrsrc_gaddrdltr_repeat%vfv X,r_text%pr_text%,6r_text%prrep%l*zzDf6*Vrscreendr_def%f*6ent_rep(Vdobjdr_def%f("\r_def%l"$aespb%p@df$2inout%paespb%v 2* exit&pinout%*L&pXrsrc_gaddrdltr_repeat%v exit&fL.&v p&v x.B exit&p@Dabort_repB2s1_rep%pds_text%f22r1_rep%pdr_text%f2" pDs1_rep%nfs1_rep%t@D\" p*[2][ Please enter a stitch repeat | in the range 1 to 199 ][OK]lf\  Dr1_rep%nfr1_rep%t@DZ" p*[2][ Please enter a row repeat | in the range 1 to 199 ][OK]lfZ  4" @Dent_rep4Vworking 4 &srep%ps1_rep%&&rrep%pr1_rep%&0&psrep%x00&prrep%x0$&pd&zfv&$6""pcard|(lfv&66 set_repeat&p&|:&pd&zfvcard_length%x:4&p&&rrep%46card|(lfv&p""6  ,&p&vdsrep%zf,P&ncard_width%z@Dset_repeatP   *Vfscreendw_def%f* 6 6 abort_rep*Vfscreendr_def%f*T)Vworking$&p*PUNCHER2.INF$T&lcard_width%lcard_length%limage_type$lio_pth$limport_pth$lh_factlv_fact&lerpz*Vfscreendw_def%f*T*Jf_def%pXrsrc_gaddrdltr_ent_fact%fJf_def%Zh_text%pXrsrc_gaddrdltr_ent_fact%vfv Z,h_text%ph_text%,<h_text%ph_factl*zzD.DDDf<Zv_text%pXrsrc_gaddrdltr_ent_fact%vfv Z,v_text%pv_text%,<v_text%pv_factl*zzD.DDDf<*Vrscreendf_def%f*6 ent_fact(Vdobjdf_def%f("\f_def%l"$aespb%p@df$2inout%paespb%v 2* exit&pinout%*N&pXrsrc_gaddrdltr_ent_fact%v exit&fN.&v p&v x.H exit&p@Dabort_ent_factH2h1_factpdh_text%f22v1_factpdv_text%f2" pDh1_factnfh1_factt,@Dd" p*[2][ The horizontal factor | should fall in the | range 30 to 300 ][OK]lfd  Dv1_factnfv1_factt@Db" p*[2][ The vertical factor | should fall in the | range 15 to 200 ][OK]lfb  6" @Dent_fact6(h_factph1_fact((v_factpv1_fact(6abort_ent_fact*Vfscreendf_def%f*T+Jn_def%pXrsrc_gaddrdltr_name_cols%fJn_def%"&p"bcol_text%pXrsrc_gaddrdltr_name_cols%v v&fv b0col_text%pcol_text%08col_text%p col_name$(&f8  *Vrscreendn_def%f*(Vdobjdn_def%f("\n_def%l "$aespb%p@df$2inout%paespb%v 2* exit&pinout%*N&pXrsrc_gaddrdltr_name_cols%v exit&fN.&v p&v x.( exit&p"@("&p"bcol_text%pXrsrc_gaddrdltr_name_cols%v v&fv b0col_text%pcol_text%08 col_name$(&fpcol_text%8    *Vfscreendn_def%f*(T-rJ Colour 0(8J-vcolour%llmenad%8(J-llmenad%(colour%p(T.rJ Colour 1(8J-vcolour%llmenad%8(J.llmenad%(colour%p(T/rJ Colour 2(8J-vcolour%llmenad%8(J/llmenad%(colour%p(T0rJ Colour 3(8J-vcolour%llmenad%8(J0llmenad%(colour%p(T1rJ Colour 4(8J-vcolour%llmenad%8(J1llmenad%(colour%p(T2rJ Colour 5(8J-vcolour%llmenad%8(J2llmenad%(colour%p(T3rJ Colour 6(8J-vcolour%llmenad%8(J3llmenad%(colour%p(T4rJ Colour 7(8J-vcolour%llmenad%8(J4llmenad%(colour%p(T5rJ Colour 8(8J-vcolour%llmenad%8(J5llmenad%(colour%p(T6rJ Colour 9(8J-vcolour%llmenad%8(J6llmenad%(colour%p (T7rJ Colour A(8J-vcolour%llmenad%8(J7llmenad%(colour%p (T8rJ Colour B(8J-vcolour%llmenad%8(J8llmenad%(colour%p (T9rJ Colour C(8J-vcolour%llmenad%8(J9llmenad%(colour%p (T:rJ Colour D(8J-vcolour%llmenad%8(J:llmenad%(colour%p (T;rJ Colour E(8J-vcolour%llmenad%8(J;llmenad%(colour%p  (T<rJ Colour F(8J-vcolour%llmenad%8(J<llmenad%(colour%p  j&p*[3][ Menu Item | Number vdmess&(ffv* selected ][OK]lfj  <&pXErsrc_gaddrdlttr_menu%f<0Nmess&(fll&0  r&p*[3][ Unexpected Message | Number vdmess&(ffv* received ][OK]lfr  .  lstmes&pmess&(f.  J0J$ ********* Mouse Events **********0J\d`parm&(fhfhd`parm&(ftf@\Bb&lpwx%l|wy%lww%lwh%B `ok|p`parm&(frpwx%h`parm&(flpwx%vww%h`parm&(fr|wy%h`parm&(fl|wy%vwh%@ `ok|pҀ& `ok|p@&Tjbx%pdddd`parm&(fxpwx%f|ffzfTTvby%pdddd`parm&(fx|wy%f|ffzfTJ ņcardx|pdd`parm&(fxpwx%f|fJJ Ŕcardy|pdd`parm&(fx|wy%f|fJ0`parm&(fp@Z0(Ţtmpcol%p6colour%(B*Ţtmpcol%pdmain_col%*  lpDcard|( ņcardx|vfirst_x%l Ŕcardy|vfirst_y%fpŢtmpcol%lŢtmpcol%H~jbx%lvby%ljbx%vlvby%vH0<jbx%vlvby%v0  >&quitp@D(exit>DJ$event6exit, windopen|p@,F&  H&6pgmend$NEcol_data$"&p""&p"*Dcolours&(&l&f*  lP&lDcolours&(&lflDcolours&(&lflDcolours&(&lfl  VJrsrc_free  HJ< ************* Start of procedural division **************HVredraw  4  "^&ltitle%"Bb&lpwx%l|wy%lww%lwh%BBd&lcx%lcy%lcw%lch%BBddwh%|ffzjwh%@BRch%pddwh%|ffzvdch%xwh%fR resize|p  Bddww%|ffzjww%@BRcw%pddww%|ffzvdcw%xww%fR 0tresize|p  :ww%|tcard_width%@:Tcw%pdcard_width%zfvdcw%xww%fvT8cx%pd|fxdcw%|f8 resize|p  <wh%|t,card_length%@<Vch%pdcard_length%zfvdch%xwh%fvVHcy%pddx f|fxdch%|fv H resize|p  & 0tresize|@T&Bf&lcx%lcy%lcw%lch%BBb&lpwx%l|wy%lww%lwh%B  <pwx%l|wy%lww%lwh%<<pwx%l|wy%lww%lwh%<dmain_col%4factorp|,card_length%4:z&lfactorzdwh%|f:Dtmp%p,card_length%xdwh%|fD<tmp%p@tmp%p<,factorp|tmp%,4n&lfactorzfirst_y%42factorp|card_width%2:x&lfactorzdww%|f:Btmp%pcard_width%xdww%|fB<tmp%p@$tmp%p<,factorp|tmp%,4l&lfactorzfirst_x%4  4 wid%pdww%|fx4D,en%pfirst_y%vdwh%|fxDX,en%t,card_length%@^en%pcard_length%Xmenad%llllll ><rx%lry%lrw%lrh%<   Vprt_cardTscnt%p@xs%pBxs%pT(pdscnt%zdh_fact| ffxxofs%x1%vdh_fact| f0(l(ly1%0  (pdrcnt%zdv_fact| ffxyofs%y1%vdv_fact| f6xs%l(x1%l(6  &xs%p@&2(pcard_length%2llen%pFf1pd(zdv_fact| ffxyofs%F0f2%pcard_length%x(0"(p@"f3%pBf3%p  Hf2%bp@llen%pH4f2%b p@4llen%p B,lf1vf3%lf2%l*zzDfB  Blf1xllen%lf1B    Rx1%lhscnt1%pcard_width%x@R2(pcard_length%2llen%pFf1pd(zdv_fact| ffxyofs%F0f2%pcard_length%x(0"(p@"f3%pBf3%p  Hf2%bp@llen%pH4f2%b p@4llen%p ,t$pf2%l*zzDf,B,x1%v lf1vf3%lt$B`x1%v vddt$fzft@ axis_flag|p`  Tx1%vlf1x1%vllen%lf1T    $y1%n@$ y2%py1% 6 prt_axis0(pcard_width%0llen%pFf1pd(zdh_fact| ffxxofs%F (p@ f2%pBf2%p   B(bp@llen%pB0(b p@0llen%p H,f1xf2%ly2%vl(l*zzDfH  Tf1ly2%vf1ly2%vllen%T  ,y2%vt@,$y2%py2%x$scr_dumpJ REPEATJ a$=INKEY$J UNTIL a$<>"" goback|pB goback|p  D goback|p@Dprt_axisD  scr_dumpJ REPEATJ a$=INKEY$J UNTIL a$<>""  0Vrscreendaddress%f0|address%vladdress%vladdress%vladdress%v|   0Vfscreendaddress%f0|address%vladdress%vladdress%vladdress%v|   .Vdobjdaddress%f.address%llladdress%vladdress%vladdress%vladdress%v   Vassemblediin&(fliout&(flptsin&(flptsout&(fdladdrin%(@fladdrout%(@flcontrol&( flglobal&(fl8vdipb%(flaespb%(f88>aespb%(fpcontrol&(f88>aespb%(fpglobal&(f84>aespb%(fp.iin&(f46>aespb%(fpBiout&(f68>aespb%(fpaddrin%(f88>aespb%(fpaddrout%(f88vdipb%(fpcontrol&(f84vdipb%(fp.iin&(f46vdipb%(fpVptsin&(f66vdipb%(fpBiout&(f68vdipb%(fplptsout&(f8 jcodel *`passp*Zpjcode  $G`passl*L-W-$Gjcode G  lAES.Bb>aespb%(flG.Ab.lGGb G  xVDI,Bbvdipb%(flG,Ab.slGGb G CHMAIN0BbpDcard|(lflG 0BblG,Bb>sub_col1%vlG ,.BbRwith_col1%vlG .@GlGCHLOOP@GlG@vGlGGaCHSKIP@GlGCHSKIPBSblG  GGlCHLOOP G RDRAWJJ InitialisationJBblGBblGBblGBblG  &Bbtp_left%lG&BGlG BG lG *Bb,xmark&(flG **BbPymark&(flG *  J0J$ Get current X for drawing into D2 0JBGlGGblG Bbpwx%lG BUGlGBGlGJ$J And then for Y into D3$JBGlGGblG Bb|wy%lG BUGlGBGlGJ J Now to start work Jrloop@GlG&Bbdmain_col%lG&BGlGGvGlGGbrskipJ J Set drawing colour J ,Bbcontrol&(flG,AblGAblGAblGAblGAblGAblGAblG(Bb.iin&(flG(@blG@GlGGVDIJJ Draw rectangleJ,Bbcontrol&(flG,AbrlGAblGAblGAblGAblGAblGAblG*BbVptsin&(flG*  AGlGAGlG  BGlGBUblGAGlG  BGlGBUblGAGlGGVDIrskipBrGBGlGBUblG Bbpwx%lG BGlGGGlGAGlG  BrGBGlGBUblG Bb|wy%lG BGlGGGlGAGlG  GUblG Bb|wy%lG BGlG Bbwh%lG BUGlGGvGlGGidecrowGmrloopdecrow Bb|wy%lG BGlGBG lGBUblGBGlG BG lG GUblG Bbpwx%lG BGlG Bbww%lG BUGlGGvGlGGirdendGmrlooprdend G CCNT0BbpDcard|(lflG 0(Bbcard_width%lG(BGlG*Bb,card_length%lG*BGlG.Bbcol_count%(flG .BblGBblGcloopBrG@GlGGblGBUG lGBGlG BrGBGlGBUblGBGlG  GUblGGvGlGGbcnrowGmcloop,cnrowBG lGGUblGGGlGBGlG   BblGGUblGGvGlGGbcexitGmcloop:cexitGHtl2r(Bbcard_width%lG(BGlGGblG*Bb,card_length%lG*BGlGGblG$Bbh_mid%lG$BGlGBrGBrGBrGVtl2r10BbpDcard|(lflG 0BGlGGblGBUGlGBUG lGBGlG   BGlGGGlGGblGBUGlGBUG lGBGlG   BrG@GlG@GlG@GlG  BUblGBvGlGGgtl2r1  BblGBUblGGvGlGGgtl2r1 G  dtt2b(Bbcard_width%lG(BGlGGblG*Bb,card_length%lG*BGlGGblG$Bbv_mid%lG$BGlGBrGBrGBrGrtt2b10BbpDcard|(lflG 0BGlGGblGBUGlGBUG lGBGlG   BGlGBUGlGBGlGBGlG   BrG@GlG@GlG@GlG  BUblGBvGlGGgtt2b1  BblGBUblGGvGlGGgtt2b1 G clcard0BbpDcard|(lflG0BblG&Bbdmain_col%lG &BG lGGUblGBGlG clcrd1@GlG GGlclcrd1 G  svcard0BbpDcard|(lflG 0$Bb sfile&lG $"Bb 4full|lG"@blGBblGBrGBrG@GlGBrGGsvwritGmsvcrd2svcrd1@blG@GlG@vGlGGbsvcrd2Gsvwritsvcrd2GSblG GGlsvcrd1 Gsvwrit G sverr@blGGsvwrit"Bb"buff%lG "AGlG@GlG"Bb"buff%lG "BG lGOBblGOAGlGOAb@lGOGbAUb lG7BrGBGlG G  ldcard0BbpDcard|(lflG 0$Bb sfile&lG $"Bb 4full|lG"@blGBrGGldreadldcrd1Gldreadldcrd2@GlG GGlldcrd2 AblGGvGlGGbldcrd3Gmldcrd1 ldcrd3 G 0ldread"Bb"buff%lG "BG lGOBblGOAGlGOAb?lGOGbAUb lG7BrGBrGAGlG@GlGGUGlGGblG G Bscr_dumpAb.lGOGbAUblG7 G   `pass  @Xrsrc_gaddrd îtype&l üindex&f@&control&(fpp&&control&(fp&&control&(fp&&control&(fp&&control&(fp&*.iin&(fp îtype&*,.iin&(fp üindex&,lAES0Biout&(fl@GL0result%pB0result%paddrout%(f0  presult%>Vrsrc_loaddTfilename$l der|f>@J2 This procedure reserves some memory and loads a@@J2 resource file into it. The name of the resource@>J0 file is given in filename$ (eg. "1STWORD.RSC")>8control&(fpnrJ Opcode8&control&(fp&&control&(fp&&control&(fp&&control&(fp&^addrin%(fpTfilename$rJ Pointer to filename string^lAES2Biout&(fp@JH2 er|pB der|p   Vrsrc_freeJJ< This procedure releases the memory reserved by rsrc_load.J6control&(fporJ Opcode6&control&(fp&&control&(fp&&control&(fp&&control&(fp&lAESBJ6 IF iout&(0)=0 THEN PRINT "Resource free failed":ENDB  ,PROG1.BSCPROG2.BSCPROG3.BSCPROG4.BSCPROG5.BSCPROG6.BSCPROG7.BSCPROG8.BSCPROG9.BSCPROG10.BSC<<<<<<<<<<A:\*.BSCab Hz/:NuH z0(2(@g4"P&1::g*g2g:ftgl`2g\`NgL`g<`.E\@f#`@Y@j0(Y@1@`,E0Y@j0(Y@XBhmBBhf1@LNu,X.6H*2( 6^VjTzVb&$N Hf($*  n| 60X2 `\V"8"&Z,NNN  $ L& " V ,>v" 2^nP ZV 4n  $ rT*0 0D>L  " >: RR8N".$B.d Dbn^jX2 8*  v2`ll|:D.D&|"(8BBBP&&LHJHNLHJH$., THJH*&.ZR PFHH@ (0\HxT0&TDL R$6.* $  $)",* Desk File Edit Misc.Colours Puncher V.2.0--------------------123456QuitImport Image Save DesignLoad DesignClear CardSet Image Type----------------------------Print DesignView Whole DesignStart EditTurn CardScale PrintoutSet Main ColourSet Card SizeColour CounterSubstitute Colour-----------------Redefine ColourPattern RepeatSave ConfigurationEnter FactorsName Colours Puncher Version 2.0 Written In Computer ConceptsF A S T ST Mark Lancaster 1989 Colour Editor ColourCurrentRedGreenBlue#red#grn#blu@________9@________9@________9NewvaluevalueColour Name:@_______________________________________XExitCancelChangeCurrent ValueNew ValueX@__nSelect Main ColourChangeCancel Puncher Version 2.0Designed and writtenby Mark Lancasterusing Computer ConceptsFast Basic.Copyright 1989 OK Set Card SizeWidthHeight@______9@______9OKCancelColour CountOK0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Substitute@__nwith@__nColour SubstitutionCancelChangeTest Turn Card Left to RightTop to Bottom OK Cancel Select Image Type Neochrome Degas OK @_______________________________________X@_______________________________________X@_______________________________________X@_______________________________________X@_______________________________________X@_______________________________________X@_______________________________________X@_______________________________________X@_______________________________________X@_______________________________________X@_______________________________________X@_______________________________________X@_______________________________________X@_______________________________________X@_______________________________________X@_______________________________________X OK CancelEnter Printer FactorsHorizontalVertical@______________X@______________X OK CancelPattern RepeatRepeat StitchesRepeat Rows@______9@______9OKCancel Working, Please wait.."" p              01_ejlrwy&;<  (<=[p   57Lacx(=?Tik'=>S\d fow  \ZZ! $ + 2  9 @ ,(  H X moqsu w y~ ,!+ "#$/%=&L'^(p)* +  -<.0/10213243546576879 8A 9B :C ;D <E, F(0        BAS  I  C      < 2X9AE K  P  U  Z    X t      '   012345 6 7 8  9  A B CDEF    %  =Rd| '    8  T  % #  012345 6 7 8 9 ABCDEF p !' -!3"9#? E)&% 012345 6 7 8 9 ABCDEFKQW]ciou{ !"# $  %   ' () 7      %!    > J %V #"! 012345 6 7 8     4 P l         0  L  h    9 A B C  D!EF#%     ? J  y %~   ,  Hd '  p(8#($$(() P U N C H E R V E R S I O N 2 . 0 By Mark Lancaster. The purpose of this manual is to explain how to use the features of Puncher Version 2.0 to your best advantage. The manual has been organised in three basic sections: Section 1 describes how to start up the program and also gives a general introduction to using Atari GEM. Section 2 describes how to start up Puncher V.2 and use the basic functions. Section 3 deals with the more advanced functions which make Puncher V.2 the most comprehensive and flexible machine knitting software available for the Atari ST range of computers. I hope that you enjoy using this program. Mark Lancaster 84 Redfern Avenue Hounslow Middlesex TW4 5LZ This software has been placed in the public domain. Please feel free to make copies for your friends. Support for this software extends no further than this manual. Contents 1.1 Getting Started 2.1 Setting the size of the design 2.2 Setting the main colour 2.3 Creating your design 2.4 Saving and loading designs 2.5 Printing your design 2.6 Leaving the program 3.1 Scaling the printout 3.2 Importing pictures 3.3 Counting the colours 3.4 Colour substitution 3.5 Pattern repeat 3.6 Re-defining the colours 3.7 Naming the colours 3.8 Turning the card 3.9 Saving configuration 3.10 Notes for hard drive users Appendix A Red, Green, Blue values for some colours Appendix B Credits 1.1 Getting Started To start using the program, ensure that your computer is switched off and insert the Puncher disc in drive A. Next, switch on the computer and after a few moments you should see the GEM desktop. Using the mouse, position the pointer over the icon labelled PUNCHER2.PRG and click the left mouse button twice in rapid succession. Alternatively, click the left mouse button once over the PUNCHER2.PRG icon. The icon will turn black to show that it has been selected. Now move the pointer to the word 'File' on the top of the screen and a menu of options will drop down. Move the pointer to the word 'Open' on this menu and click the left mouse button once. The screen will then clear and the program name, PUNCHER2.PRG, will be shown at the top of the screen. You will hear the disc drive working and after a few seconds, the main puncher screen will be shown ready to start work. 2.1 Setting the size of the design To set the width and height of your design, select the 'Set Card Size' option from the 'Misc.' menu. You can now enter in the width and height of the design in rows and stitches. When you have done this, move the mouse pointer to the box marked 'OK' and click the left button. If you decide not to change the size of the card, click on the box marked 'Cancel'. 2.2 Setting the main colour. The main colour is the background colour for your design. Select the 'Set Main Colour' option from the 'Misc.' Menu and a dialogue box will appear. In the upper part of the box are the available colours which are labelled 0 through to 9 and A through to F. Below this is the label of the colour which is currently the main colour. Directly beneath this is where you can enter the label of the colour that you want to be the main one. As before, to make the change, click on the 'OK' box or on the 'Cancel' box to leave the main colour unchanged. 2.3 Creating your design To start work on your design, select the 'Start Edit' option from the 'Edit' Menu. A window will appear on the screen. You can now select the colour you want from the 'Colours' menu. The current colour is always shown with a black tick against it. To start drawing, move the pointer into the window and press the left mouse button. You can hold down the left button while drawing in order to use the pointer as a sort of pencil. When you press the right button over a stitch, that stitch will be set to the main (or background) colour. Again, by holding down the right button, you can use the pointer as an eraser. The current colour can be changed at any time by selecting any of the 16 available from the 'Colours' menu. While working on your design, you can use the 'View Card' option of the 'Edit' menu to see the whole design at one time. This is useful when working on large designs. If you want to clear the card and start again, select the 'Clear Card' option from the 'File' menu. When this is done, a box will appear asking you to confirm that you want to clear the card. This is a precaution against the option being selected accidentally. 2.4 Saving and Loading Designs Once you have created a design, you can store it on disc for use at some future date. Select the 'Save Card' option from the 'File' menu and the Item Selector box will appear. You should now think of a name for the design which is eight characters or less long and type this in under the word 'Selection:'. Next, key a full stop and the characters 'CRD'. Finally, click the mouse on the 'OK' box. If you choose not to save the design at this point, click on the 'Cancel' box. If the name that you have chosen has already been used on the disc, a warning box will appear saying that if you decide to continue, the design which is already stored on the disc will be replaced with the new one. If this happens, then you can choose whether to replace the design or to enter a different name for the new design by clicking on either the 'Continue' or 'Cancel' box. To bring back a design which has been saved in this way, select the 'Load Card' option from the 'File' menu and the Item Selector will appear. You will notice that beside the list of designs, there is a slider which can be used to move up and down the list. When you have located the design that you want, click on it's name and then on the 'OK' box. (Double clicking on the name will have the same effect). The disc drive will start working and after a few seconds the design will have been loaded. If you then make any modifications to the design which you want to keep, then you will need to re-save the design and select 'Continue' when the warning about an existing design appears. 2.5 Printing your design. In order to print your design, you will need to have an Epson compatible printer. To find out if your printer is Epson compatible, first ensure that it is switched on and connected to the computer, then hold down the 'ALTERNATE' key and press 'HELP'. If the printer is Epson compatible, then a copy of the screen will be printed. Since the most commonly used printers are monochrome, Puncher V.2 uses different types of shading to represent the colours in the design. I have not used Puncher V.2 with a colour printer but in theory, they would produce the same black and white printout as the monochrome printers. Before you print your design, it is a good idea to ensure that it is saved on a disc. This is because if the computer finds that it cannot send information to the printer for any reason, you will need to re-load the program and your design before you can try again. If the design is too wide to be printed in one pass, it will be printed in 2 or more strips which can be joined together when the print is finished. The amount of paper used rather depends on the size of the design, therefore if you are printing a large design, it is a good idea to ensure that there is ample paper for the job. If your printer can use either cut sheet or continuous paper, it is better to use continuous since there will be fewer joins to make when it is finished. To print your design, select the 'Print Card' option from the 'File' Menu. The screen will clear and a key will be displayed which shows the types of shading used to represent each colour. The numbers beside each shade are the numbers of stitches of each colour in the design. This can be a useful guide to the amount of each yarn that you will need to produce the design. In the middle of the screen will be a box asking you to ensure that your printer is ready. Clicking on the 'OK' box will cause the colour key and the design to be printed. The 'Cancel' box will abort the printout in case you had selected the option accidentally. It is possible to control the width and height of each stitch when it is printed. For a description of how to do this, please see section 3.1. 2.6 Leaving the program When you have finished working with the program, you can select the 'Quit' option from the 'File' menu. You will be asked to confirm that you do want to leave program just in case the option had been selected accidentally. 3.1 Scaling the printout This facility allows you specify the exact width and height of each stitch when it is printed. In this way you can produce a printout of your design which will be exactly the same size as the cards used by your knitting machine. In order to do this, you will need to obtain two values known as the horizontal and vertical factors. First, ensure that your printer is ready to print and then select the 'Scale Printout' option from the 'Misc.' menu. The screen will clear and two rules will be displayed on the screen. When you click on the 'OK' box, the two rules will be printed. Now get the printout and use the rules to measure 10 stitches and 10 rows from your card. Record these measurements in the spaces provided. You can now use the 'Enter Factors' option from the 'Misc.' menu to enter these values into the program. You may find when working with large designs that the factors which you have measured are not quite accurate enough since the printout is not quite the same size as the card. To get around this problem, measure the overall length and widths of the stitches on the card and on the printout. Now calculate a more accurate pair of factors in the following way:- Width of card New horizontal factor = ----------------- X Old horizontal factor Width of printout Length of card New vertical factor = ------------------- X Old vertical factor Length of printout 3.2 Importing Pictures. Using the 'Import Image' option of the 'File' menu, you can select an area of a Neochrome or Degas picture to be used as a machine knitting design. Neochrome and Degas are both very popular art packages for the Atari ST. Other art packages usually have provision for saving pictures in either Neochrome or Degas format. The Neochrome package is a public domain program which means that it can be obtained from any public domain software library for little more than the cost of a disc. PD libraries are also a good source of other peoples artwork which are normally supplied in Tiny format in order that more pictures can be saved on a single disc. There is a public domain utility program called TINYSTUFF which will convert these pictures into Neochrome or Degas format. Before you use the Import Image facility, you should use the 'Set Image Type' option of the 'File' menu to specify whether you intend to use a Neochrome or Degas picture. Now use the 'Import Image' option to select the picture that you want to use. If you need to change discs to do this, then you should remember to replace the Puncher V.2 disc after you have loaded the picture. When the picture has loaded, it will be shown on the screen. Press and hold the left mouse button and a dotted rectangle will attach itself to the mouse pointer. Now move the pointer so that the area of the picture that you want is within the rectangle and release the left button. The selected area will now be read into the design. Because Puncher V.2 uses rectangles instead of squares for each stitch the program has to attempt to preserve the proportions of the image to prevent a horizontal stretching effect. In doing this a design can become slightly distorted horizontally any you may have to do a bit of re-touching from the editor window. When an image is imported in this way, the program will set the main colour to that which occurs most often. 3.3 Counting the colours. This option will cause the program to tally the number of stitches of each colour in your design. To use it, select the 'Colour Counter' option from the 'Misc.' menu. Using this option, you can get a rough idea of the amount of each coloured yarn that you will need to knit the design. 3.4 Colour substitution. This option is especially useful after you have used the import image option. It allows you to substitute one colour for another in order to reduce the number of different coloured yarns needed to knit the design. When you select the 'Substitute Colour' option from the 'Misc.' Menu, a dialogue box will be displayed. In the upper part of the box are each of the colours together with a value representing the number of stitches of each colour in your design. If, for example, you have a design which uses all of the 16 colours but you do not want to use this many when you are knitting. By finding two similar colours, you can instruct the program to substitute all the stitches of one colour with the other. By clicking on the 'Test' box, you can view the effect of a colour substitution without actually changing the design. If you are satisfied with the effect, you can use the 'Change' box to make the change permanent. 3.5 Pattern Repeat This facility will allow you design a pattern and then use it to fill the whole card. First, create the pattern to be repeated in the extreme top left of the design. Now select the 'Pattern repeat' option from the 'Misc.' menu and key in the width and length of the pattern to be repeated in stitches and rows. When you click on 'OK' the pattern will be used to cover the whole area of the design. 3.6 Re-defining the colours You may already know that any colour can be created by mixing different amounts of the primary colours, red, green and blue. To re-define a colour, first select the colour to change from the 'Colours' menu and then select 'Redefine Colour' from the 'Misc.' menu. A dialogue box will appear. The numbers beside the words 'Red', 'Green' and 'Blue' represent how much of each primary colour has been used to generate the current colour. A value of 0 means that none of that primary colour has been used and 1000 means that the maximum amount has been used. For example, Red=0, Green=1000, Blue=0 would give a very bright green. Red=0, Green=500, Blue=0 would give a darker green. To change the colour, key in your new values in the appropriate fields. Appendix A contains a list of the values which will generate just some of the many possible colours. If you want to make the change permanent, click on the 'OK' box, otherwise click on the 'Cancel' box to leave the colour unchanged. 3.7 Naming the colours When you re-define a colour, you can enter a name for the new colour at the bottom of the box. Alternatively, you can use the 'Name Colours' option from the 'Misc.' Menu to name each of the colours. These names are saved when you save the design to disc and they also appear in the colour key when you print out the design. 3.8 Turning the card This option allows you to turn the design either from left to right or from top to bottom. This is useful in producing 'Mirror Images' of the design to counteract the same mirroring which occurs when the design is knitted. To use this option, select the 'Turn Card' option from the 'Edit' menu and click on 'Left to Right' or 'Top to bottom' as required. Now click to 'OK' to turn the design or 'Cancel' to leave it unchanged. 3.9 Saving configuration Before using this option, ensure that the Puncher V.2 disc is not write protected and inserted in the disc drive. Selecting 'Save Configuration' from the 'Misc.' menu will save information about the cards that you use so that when you next startup the program, you will not need to key in information about the size of the card etc. before you can start work. The following information is saved with this option. The width and height of a design The horizontal and vertical printer factors The image type used for image importation The disc path used to store your designs The disc path used to import images. 3.10 Notes for hard drive users. If you own a hard disc drive, you can install Puncher V.2 into any directory that you wish so long as the three files PUNCHERV2.PRG, PUNCHERV2.RSC and PUNCHERV2.INF are all in the same directory. You may already have some other software installed on your hard drive which needs GDOS to work. Unfortunately, Puncher V.2 does not work correctly if GDOS is installed. Therefore, before starting Puncher V.2, you should check the AUTO folder of your boot drive for the presence of GDOS.PRG. If it is there, then rename it to something like GDOS.PR1 and re-boot your computer. The program should now run correctly. Incidentally, there is an excellent public domain program by Gordon W. Moore called Super- Boot which allows you to select the AUTO programs and desk accessories you want when you start up your machine. Using a hard drive without this program is a pain! Appendix A - Red, Green and Blue values for some colours. The table shown below gives the values of red, green and blue to produce a few of the many colours available. It is worthwhile experimenting with the 'Redefine Colour' option and recording the red, green and blue values for any colours that you discover and may wish to use in the future. Colour Red Green Blue --------------------------------------- Pastel Blue 750 1000 1000 Jade 0 700 500 Lilac 800 500 1000 Charcoal 400 400 400 Gold 950 900 400 Nut Brown 429 0 0 Primrose 1000 1000 859 Apricot 1000 800 800 Aran 1000 1000 925 Navy Blue 0 0 400 Cerise 800 0 800 Lemon 1000 1000 600 Silver 700 700 700 Chocolate 286 143 143 Baby Pink 1000 859 859 Royal Blue 0 0 600 Turquoise 0 1000 1000 Rust 571 286 286 Steel Blue 200 500 1000 Peach 1000 750 750 Cornflower 600 1000 1000 Tangerine 950 400 400 Sunset 1000 1000 714 Pastel Pink 1000 800 800 Appendix B - Credits Puncher V.2 was designed and written by Mark Lancaster using Computer Concepts Fast Basic on an unexpanded Atari 520STFM. Resource file constructed using Hisoft Wercs. Many thanks to owners of Puncher V.1 who suggested many of the features present in V.2, and to my wife Alison and my mother-in- law Audrey who were a great help in finalising the design. Puncher Version 2.0 By Mark Lancaster. This file contains a concise description of Puncher Version 2.0. The full manual is in the file named PUNCHER2.TXT. Here are some of the features. * Easy to use * Suitable for any knitting machine * Design up to 200 stitches by 200 rows * Use up to 16 colours * Each colour is re-definable * Proportion control of printout * 1:1.5 stitch ratio * Image importation * Colour substitution * Pattern repeat Easy to use Puncher V.2 uses Atari's GEM (Graphic Environment Manager) throughout. This makes the program extremely easy to use since nearly all operations can be performed using the 'Mouse'. Suitable for any knitting machine Puncher V.2 can be used to produce designs for machines which use punched cards or mylar sheets as well as intarsia patterns. This has been done by giving you control over the exact width and height of each stitch when printed. In this way your design can be printed precisely the same size as your card or sheet. Up to 200 stitches by 200 rows The size of your design can easily be changed anywhere between 1 and 200 stitches wide and 1 to 200 rows long. 16 Colours Your design can include up to 16 different colours each of which can be re-defined to closely match any colour that you could want. When you print your design, each colour is represented by a different type of shading together with a key to show which colours are represented by which types of shading. 1:1.5 stitch ratio When creating a design, each stitch is shown as rectangle which has a top edge 1 1/2 times longer than the side edge. You do not need to take account of the 'stretching' effect which occurs using squares. You can be confident that the design which you create on the screen will have the same proportions when knitted. Image importation Puncher V.2 has a facility to use low resolution artwork saved in either Neochrome or Degas format as the basis of a design. There are already a vast number of these pictures available from any public domain software library or you can use an art package to create your own. In fact, with the right equipment, you can scan drawings, photographs and even video images and use them as knitting machine patterns. To use Puncher version 2, you will need any model of Atari ST computer with a colour monitor or television. To print your designs you will need any Epson compatible printer. Now read PUNCHER2.TXT for the full description. . !.. BS301DOCPRG &<BS301DOCTXT w*BSAVE301ACC *)BS301CONPRG )9 BOOTSAVESEC p]&`9Z>H?<NNT/$@?<NNT2<<g2<gNqQC\|<<f|(HzF?< Nq\B?< NA\/?8@AL"H/(a,_1߂@?< NA\G*"K kK^ JgёBJAg<f``+k +k+k  -"- Ҁ+A -Ҁ+A м$@*@t_CQ"KA$HNM@,$$$$ٵoC&i")n"<BBBBSlLBNHaaKa.(I,I&N%aLNurQNua.d&NqNqra$dCv !a"H@@Vҩ%QnNuf%Nurf%AQNuCtaTxr1 Hka1 Ag"CvtaTr1 HaBq jD`rptadpt?aBC@!!Q`N   jY JAM Packer Decrunch V4.0kIce!9Yvt`x##uY`BootSave~V3.01 Manual B NA-t|VL:r gV պ2Jri$v,,l V* Yʾ Ny ʐe^ Xd2ֵ|v ʐ pQ`rه ! W9 GEfHJ(c = lD* ( Cr2C \[, r f%3fB^ ˀB8?U4>8 2sxf:pl >L9E6H=&s#Kpr {VJ@I;K*<3n"޳ `F HiS@7f -G޷G[ yV- L?%B\~o,a0B@H@rb<[i V Jk[ZK j  Nu{pEޔs0z, kRrek >Bei%8DJgf~ؙЎnU@N7f, spxrynN|fwff$ $ V / L،B#,ۄY(Xr{nCH=נ-/h ALrH8z~~C:+ rָ&%fqN|ʿegݬ&땯 0:~`~!Bx&!g0gJفZ^m8.e2wIdV`&9;ssصMdhXPf REfw #Вg-rg@6HŠ#SF8RɾD.sj%gْZe`*OTUld{5c=εN(mD{Pj!.8Q2A& FfBf. n@iHg +)91 fyi`lC@sPĵ< xW0 X%xZ \! flRY5(>ιXjD` |#/3 E&xրX;mGnd;u[r4"TبJE,xrܵ0:3I% Kc2253@U` ,v*NIޔp,hh%`*+ 8`wvecmɈVJt+~qD&f&U5x!H_"D<00n.pB5$~beHgPg$& g6`όdXq¦*%$hcf`f!|HLDf:@];fJSʟ3>YgHZY 9ukA-g(Pf-/r yb8Kt._f;nu- mȽNTL}k08p XtaBrgt0xPWrLsl8 3!4 /;|f ZBNA/#ꅒ/eHxy/cNNO X084g5RxhfF'!~op 8L _G*Ns`(sn@N-:-{tVnI{u*6mݪx椔@fbі5-f?<`=t3j4K4m` >GG`MIgnJXI9>`p@SV f!P.zg f e sod5Xc6=4̘AB HGctfLgl;B4f$HHIKL________f IkMNO/4f @APB*CTD EUF Gg [uցBCDFE=FUGAB@CDE FG`nmhEsGjFɸc` %6EITJ@k | n%ap7ՂmW.2ێY{ ax^ `gJ@u8Y1x6.rdFYP"`0HAJAgR@?vf?:`Xj!NN?'b VtnV^ 8b.g2SP LtL0N*v}vfe>J8~f L6#s,3Yp+ Gm3p:t,sWpr$²92>IJ9֑d[[`^V#fd{2TffkTaLwaPa<;iaB3a.d_"aM,U@з7a14a{ZJf6"-fd4f4,K]>O<# f5ˑ~f^`e5ZB-gR`-g.64m*65n`%GmsJnImyIYɕ`Jp]54f>{-f8l@fI?g1 Sf L@ -J  f pHǂpa|pIax )g*3{ag"8 ֜tĹ>-–Fl3o~ra2fp a"wnVA'>"x<?"P?q0\-\R p@pv3:J2UZ8f2^xgk3Pu@Yt@?S`/ NMgF`\B8\ 02x^(xNw?B11,\zfg*W#pM]¤f@gv vCA)J N!Ī AfǪH@v|4'ABIJJ.8YB GJhf@A >z>v>Pan<wf&7&Ţ\T gma p0Y5q|vg b HGq޸R~upmv3l`g[JgZfgZs YYqbANlɼ1-0SkmtS@Gy%6tM _p?g2uM ֝ ><L`fHA(Q/rvh<(RAXQNSFo0k5%?\`T8{0Ήb8/w fk!`7 YP2nBQ92m5nn y25(6n$)9f`d`we j>jP$faVaMxY9o #3 hha\fTTUZ-!a4[[Jke9ϐZ:p6ӀUKV1zDb@N|t$ʴd8r,]VAYH1r`7W`l@Nu#dQ 'p9mKPV$:V`g0g3q+2]ffNg`.Ƭx6mpnl#gy|jR)h]rsk4 =sfw` 1f]Q4靇P]fRENk'<9f,?NCr"qJfmHFdMȋp!*AG40_68CpD:<>MWŪ9NRƩH:L;@p2rp gH@/HfS@:śt3h\PfR ]f&PBy3FBgf,Ё#Bc2:AA@C 13PGHXhM*C"*R BDUjjUBof4<0䯁UkfC3vp0pDb~|lfSD|fx0BCE?d`Mpr_faNLNu)G 7>g@kƄCcWnabzi,1S \(jux x#1)E(n>u[d:q$'^ CfnYnscivOs (Y/n)XSecAT[gIì@bGGZk!n?DOCm^͌sHELPcٍctowf0. -=ʛU?D$ r(pbnHwarTJ1+B:LaAw[]:BanQ:9 lt-T:Firs6Hj-Zba .%Y'3Fٍcancello͉g%xB@nz"sp;ng! I,con`egOnbԙ?]xEND'J@4ST@5vdu CX0`l V5ìMiC!sU@I-cT#0 )YͬPces6-AIwait.P D*Dislayav5.9=by)+THE6 |ڃWF19sVqq(Invf5ֹ2MXu X1' q"SxNhppo`amr3`Kxxc4^[w7. bW,s$6boޜ#/zCDr,YbwLwe, ftr7fNchZhZF8 @Gl45HT4pUf@5/j1Ke=d@-}/Cx,zY9͊ur.^ptADRAFTFQ~bIME/l>`Rl;瞽؎yS΄v4v%<>6 j~쉶||n}&M |݇+ƙWF2ƭipӋM/4̾Ãؖy*6 8@~`q!.cpkЏuxcnxeK bQK x%kۈ 4M$fox)ixY)p'f [ ~ bQ Fl`u$l KܚQ l0۟bP3fdf>!Hb(}$<8{-l(Q膙@X~< '0|<0FL}f<`| >xfF~#\~w~f cf \0-44oZ/$+W 4>xxL|܂T pe ef@`ִ`\%D(n|xn͘|I ˀIH#ߍ|8|f8v>|<<(y0ϙH~lFŻB, v7@0"knEvv-l6ʪ7?v7*?fܛ`R0T`u - 2l|x7D^Ap C.~R!T|!Z P^~ĭd J@WxUX H DDHD<ݤhDc`?s)<0fn`Wl~Tf홥< lTnBB&xv|`l8f_~~p8~`q& T|B1x:0@8 pS&pdݍ*XeK u}B!Ndocuig(p Ec&p7q}wB'Bg9301.ACC'MeG;2+qzp/mosi>w6\ۇPL SAD THLLOWEF旙USINGySAVER *}dxlc63b:Wޫ@ )Ipx. I~ fҏTsDDnSnRosEѨ !HKDnԹ$\w}5s!L\vG3[m3%) "_z@|,a9g‹.tsIw^/c MMuxr8r3sO.cpp R.^/K𾹐rxvrlR[{rU/C}ӹ Xf1D @4cN_Y]Zci9A9Uӹ-¾zF1]¾b&as6+Uib"VYV:bpKhQ#qZ3#x3k%Y &EQ1{x oN%5*8+9/`t|urn" qo p kmLf!Iegeg,H{imWf 3H)kpȜԢS[t^nSuG3oL3Soau~b/sᴃ)mxי80f g<'M̬5fA+%B݁&n/N.F!2evoinzufnЊ)5 ?؀`lB U2[ppGq|`{b#Xbex2kToˬY Z}ab1*Y BOOT;K.SEC/ e L$ ,};dq1ӹǚ`g+{x':<<)x3R;S;{|g ޭ,eRxgF%,w/m{$p\#h9O+i }a(rƅ9gD0d*Ҽ3x{*+$VN`V.^uP6b qef3Y{sA3ӶɎVaaQ[4{p#srC]pʂ(,gn!)^]-ߝXJnxu6lT aƇ9a!T7 ОC4US%a@Z,wEtJt-<]oct Nzaccep[fau;oOLDޥXݬ#gq9u5*n$30/hun,Qd2Úwk4hxn©Lf9Xk׌IsrFt.KBPBޘPxRNVa:O.;J.]O7g}'"wad $<0im-o9afeus aVỀ iN+xN/j]ghnewLux u];ψ:-DAPg yN<5)}'x pGqWRnE-PTzJq%kAs"|SΈ|x+/-+8C9.Tn[_ι?86gg,1s["et73{aSeL,f7E8w9cLe˲S܆ mRic numgKQ<q\kvcn"(wi)&`XgKStHdp$Ӆx1NnfىĬA^o3k-w3g׳fKETOf87$Ҭlf b^lvnF?Fm>hc.Дelp33stv5n$quvm.[ [6ӱq&4e/T\.A歺w{k$fu1f4 }ٲwcf a8YyBUczY,n9dow֩3mmI CE/ig5+YLV6wKJgAz5mGI;u&6V L7xVIRUSvk>UZEXIT;] nWa/Edf/3n,QnaS_2w>:On_q.ZDlL[:LWA3 Ui;cW 3[ckc\b,w,-ZNl;Αnw1 awAe off-, t=lcci*1x(KkEp2LoA~ N3.) Ru;mmM]Xd0S 7 LOgpks+faeZǒ%7b79~uQtcqd+0A*×(m*.S7Ǹ¡"GwnrtV4y% ASIHEXECIMAL~3Z-dUum3XTn:,Fa.Nalw1䀕I IINT |oDdu,LaV/둰f LEpx"kY]E(alzs1REA%qnANf1+nBX*nČn]Ctrl+y+Dܡb--@GAln@H>X6cPFIkpNDISPLAY%i탵4PpF3To'BS301CON.PRG'EbeOlu s0!Nexcx_ aYg ma virW k`T!7cʵt!a* 7e/ |`;=AfXVA0u3tXXHNfh1I>"mlWq(|Їlm 6ll2.HQCsY&-mL⦣8suĢ`FiɒA$N]& p $* 2$&jXN \"V &  "<H BootSaver The Ultimate Virus Prevention Utility Version 3.1 1988/92 C.N.D Copyright & distribution. BootSaver is under normal copyright rules, although you may give copies to anyone, in fact please give as many copies to as many people as possible, however this document must always accompany the file 'BSAVE301.ACC', and neither file must not have been modified in anyway * PLEASE READ THE FOLLOWING BEFORE USING BOOTSAVER * I am happy with the performance of BootSaver, I hope that you too will find it useful, however because of the potentially dangerous functions that the program offers, I would advise you to read this manual carefully before using BootSaver, although I must stress that I will not take any responsibility for any loss or damage arising from the use of this program, however so caused. Main Menu. When you select BootSaver from the DESK menu, you will be presented with a standard GEM window, containing the options that are available from with BootSaver, unlike quite a few other DA's, BootSaver will happily multi-task with other applications, which means that you can position BootSaver anywhere on the GEM desktop and still have it available at all times. The icons displayed within the window are as follows: +-----------------------------------+ | STORE | REPLACE | VIRUS | DISPLAY | +-----------------------------------+ +-------------------------------------------+ | EXIT | +-------------------------------------------+ While the BootSaver window is the current top window, you may select any of the icons with the mouse, or by pressing the Control key plus the first letter of the icon, (Control+D for DISPLAY etc.) you may also select the icons in combination with the alternate key, these actions are described in the sections relating to each icon. You may also press the Help key for the credits screen, and Return & Enter keys to close down the BootSaver window. Clicking on the close window gadget, simulates a Return key press, and will close down the BootSaver window. Clicking on the full window gadget will simulate a Help key press. Store Sector. When this icon is selected by clicking on the STORE icon or by pressing the key combination Control+S, BootSaver will read the bootsector from the disk in drive A and the present you with a standard file selector where you should enter the path and file name that you wish to save the sector under, (Please note that if you only have one disk drive, then I would recommend that you use drive A (or a RAM disk), instead of drive B as the destination drive, and follow the prompts from BootSaver to avoid any possible confusion.) when you have left the fileselector, a dialogue box will appear asking for any comments that you wish to save in the file, for example: To save the bootsector from your work disk you could enter the filename as BOOTDISK.SEC with the date of the save in the comments field. Please Note: If you select STORE whilst holding the Alternate key the file will be saved immediately after leaving the fileselector. Replace Sector. When this icon is selected by clicking on the REPLACE icon or by pressing the key combination Control+R, you will be presented with the standard file selector, showing the last used filepath. Once you have selected the desired file you will be presented with another dialogue box showing any comments that may have been entered into the bootsector, you are also given the chance to abort the operation. It is possible (by design!) to replace a single sided bootsector onto a double sided disk, and vice versa! You will be alerted if you try to replace any file that contains any data that is different from the BPB of the current disk. In most cases you should accept the default of using the OLD BPB, which means that the bootsector code from offset $2 to offset $30 will remain unchanged, however if the bootsector has been totally cleared you may wish to try using the loaded BPB. Please Note: If you select REPLACE whilst holding down the Alternate key the file will be loaded and written to disk immediately after leaving the file selector. Virus Checker & Protector. When this icon is selected by clicking on the VIRUS icon or by pressing the key combination Control+V, you will be presented with a new dialogue box containing the following buttons:- Drives A through P (greyed drives are not installed) +---------------------------+ | SAVE WRITE-PROTECT STATUS | +------+-------------+------+ | VIRUS CHECK | +------+-------------+------+ | EXIT | +---------------------------+ Clicking the mouse on any drive button that is installed will toggle its state between unprotected (normal) and protected (selected). When a drive is software protected the computer will react as though the device really is physically protected (little square window in the corner of the disk is open), and present the standard 'The disk in ... ... is write protected' alert box, but the screen will also briefly change colour and a bell will sound to let you know that it is protected by BootSaver. If you hold the Right Shift key down while writing to disk the software write-protection will be ignored and the disk will behave as normal. You may save the status of the write-protected drives by clicking on the SAVE STATUS box, which will write the current status of the drives within the main program code (BSAVE301.ACC) starting at offset $1E. This way the selected drives will be protected each time you start your system with the BootSaver disk. Selecting the VIRUS CHECK button will compare the bootsector checksum with the executable flag ($1234), if it's not equal it is assumed that the disk is completely virus free. If however it does contain the magic number, the bootsector is then tested for any of the recognised (anti)viruses, if the disk is found to be infected you are given the option of removing the offending program. If the disk contains an unknown program you should fist STORE the sector, and then use DISPLAY to look for ASCII messages etc., if you still think the disk contains an unwanted program then remove the program, and reboot your computer with that disk. If the disk works as usual then the disk probably was infected by a virus, BUT, if the disk does not then simply REPLACE the original bootsector and all will be well again. You may also select this option directly from the main menu by pressing Ctrl+Alt+V or by holding Alternate while clicking on the VIRUS icon. Selecting the EXIT button or pressing Return/Enter will return control to BootSavers main display. Display Bootsector. When this icon is selected by clicking on the DISPLAY icon or by pressing the key combination Control+D, you will be presented with a standard alert box offering the following choices. 1.) Reading the bootsector from the disk in drive A. 2.) Loading a *.SEC file from disk. 3.) Returning to the Main Menu. Selecting the READ or LOAD buttons will either read the bootsector from the disk that is in drive A, or let you select a *.SEC file to be shown, and display it as an ASCII and HEXADECIMAL listing. Use ? to page forwards and ? to page backwards through the file, PRINT DISPLAY dumps the whole sector to any standard Epson compatible printer. You may also select the READ option directly from the main menu by pressing Ctrl+Alt+D, or by holding Alternate while clicking on the DISPLAY icon. Convert Program. The 'BS301CON.PRG' has been included so that users of the excellent german virus killer SAGROTAN can use any BOOT.* files that they have with BootSaver. After starting the program you should select a BOOT.* file from your SAGROTAN library folder, the program will then read the file into memory and convert it into a suitable form for use with BootSaver, during conversion you are presented with a dialogue box containing the comments of the SAGROTAN file, and given the option of replacing or adding to them. Please note that when SAGROTAN saves a BOOT.* file it changes a few of the BPB bytes, which makes it incompatible with standard ST disks, therefore this program replaces these rogue values with standard double sided disk data. I might not be totally correct with this, but as I wrote the program in only 35 minutes I thought that it would be okay. Please look out for a new improved version shortly (PROBABLY!). Contact Me. If you encounter any problems whilst using BootSaver, or if you have any comments, or suggestions which would enhance the usefulness of BootSaver, then please don't hesitate to contact me. Craig Margrove. 56, Downland, Two Mile Ash, Milton Keynes, Bucks, MK8 8HN. ENGLAND. ``O/`Hz ?<&NN\:<=<<?CA><g f1| `1| SIQaBAI(A:<Q#b~a@3-#-#v~a"3-8?<NNT3-Fa#-By-a #,-#~a L,lH- z,!z,By->3-#-3-#-`-#l~a #,-#,-2?3-a 0ga$`ga"` gaBy-a `A+0|g|g`0:+аz+f 3 -` Nu|)g`0:+z+~f 0:+~gBy->Nu|(g`0:+z+\f0:+Zg 3 -` a3-~a L+H-3-#-L+nH-a 3-L+TH-#~a 83-D3-#-a 3*-L+H-#~a 3->Nu|g`<0:*z*`f0L*|H-3-a a ZH- z*!z*Nu|g`p0:*Bz*fd3-a 03-#-H-a 0:)a LA$a 3)-#~a H# ~a :By->Nu|g`0:)Ȱz)f3-a 3 -a Jy-XfJy-Zg^ :)":)abH@HAa\HA#- :)jк)j":)vҺ)vaBH@HAa|n8|g2 y-:g>#-a &A HC Np 2:(0$YXWNNua DaC0a a d6<a C&a C a gJC z(dJg .g `pQ:'f*EDa AhBG$va fA naa`8A baa`C%F fBNua Hz"F?<NA\Bg/:'?<NNAPJ@f:I,z  Q*z'I:< JgQAa  y-Rfa d<<<<@a 8&g Aaa :a L`a g`aaa >CaC aga L<<=a Jkva Q'afP'Ca^:&f IaTfD6<a vA":C$\0<fQ`A aLg|g`A$8C"0<QaX`a Rgh`HaA#C fA aGvaX|LNuA! <BXQ|4NuB@J9'g0<??<g h gBh Q`1| QG vaFCA>< h g<`<Q|gn|fFBgHz?<=NAPJkH>Bg?/<?<BNAO HzT/<??<@NAO a`~B-aPaaNuAa0g`\6<a4a2fzA A:gf B:g\ G:gR Hz:gH \`fg> A:gH $HA:g> :g4 :g* Nu:fA`A` A`A2af a`Aa:!g`4A0<zBQA>0`8!|Nu:!|puke!|'(!|*** 0<`zXBRABsav O0 fNh]H h g h g zNaf0(AJ0gapNsXBRABsavaf40/@g*0/AJ0g?a?< xNH@Sg0TNu zNXBRABsav0 g4 O\H Pf* hf" h!&m!$n!v!2! zN/?<Fa THaQNu:0NuE i :fTJC$ %| %|.  .fRI .ffNuA`AB?</??<NMONuA^`BgHz?NAPNuHz/<&??NAO NuHz|?<ANA\Nu><<?a??<>NAXNu0<ARBQNu?<NATNu??<NAXNuB@ zAa zTCz?JgQz? !\gQB)A/?<;NA\NuThere are no comments in this file!:\*.SECSelect filename for 0:\BSAVE301.ACCsaving loadingshowing #*+/23 46MNZ[defghijklF r r / -H-p--R---x  8B8(f>8(v8(8(' `Z%! F   Xb ~$ - 6  ?&H IxxDxxpt (%<( -x  P.Jf"*6>' `2:nx MD$sx-H88}cHppX %X 1/pl X,1>,'>X0-x 4A  B0  CH  D`  Ex  F  G  H  I J0 KH L` Mw N O P *(  `%(H EXITAbout to xxxxxxx: ________.___installdisplayComments:ARE YOU SURE??YESNOAttention!!!About to save: FILENAME.EXTEnter comments (MAX 37 CHARS):This is a line of FTEXT with 37 chars_____________________________________SELECT AN OPTIONSTOREREPLACEVIRUSDISPLAYThe Ultimate Virus PreventionUtility.Version 3.01 BootSaver (c) 1989/92 C.N.D.This program is 'FREEWARE'See manual for more information.XVirus CheckSELECTED DRIVES ARE WRITE-PROTECTEDSAVE WRITE-PROTECT STATUSDISPLAY SECTORMain Menu12345678901234567890123456789012 123456789012345612345678901234567890123456789012 123456789012345612345678901234567890123456789012 123456789012345612345678901234567890123456789012 123456789012345612345678901234567890123456789012 123456789012345612345678901234567890123456789012 123456789012345612345678901234567890123456789012 123456789012345612345678901234567890123456789012 1234567890123456Print Display(> U s |    &&% :SM B9  * !"?  6!"G  *"r"M  5??H H?H H H H H O @ @ C D D D D D D $ ????H HH H H H H O @ @ C D D D D D D $ ????@@QgJWDf@PT @ @ [1@ O @ @ ^Cj@ @ I]@ @ S @ @ Dv@ @ F@ S `@ @ a PROGRAMyour SAVE[1][Please insert xxxxxxxxx disk |into disk drive A.][OK][1][A disk error has occured][Retry|Cancel][3][ This disk is full! | ][ Oops! ][3][ The file | already exists! | | Over-write it?| ][ Yes | No ][1][A print error has occured|please ensure that the printer|is online before retrying][ Retry | Cancel ][1][This disk is virus free!!|but, it is also unprotected][Protect|Cancel][1][This disk is infected by a|known (anti)virus!!][Remove][1][This disk contains a known|virus-free bootblock][Great][1][Unknown executable disk!!! |(It MIGHT be a virus, so save|the bootsector before selecting|the remove option)][Remove|Cancel][1][This disk is 100% virus free|and immunized to VDU standards!|(thanks to Richard Karsmaker!)][Great!][1][ |What would you like to display|a Bootsector or a File? ][Sector|File|Cancel][3][ |Sorry, this function only|works in either medium or|high resolution.][Cancel][3][Write-Protect status was not|saved because I was unable|to locate 'BSAVE301.ACC' on|the current disk][Retry|Cancel][3][Caution, The BPB on this|disk is different! Would|you like to use the old|or the new settings?][Old|New|Cancel]x       ,,$&     "&   $ 8"  | 2p  $ ,$PX ,$     $   (0H00H00H`nZ&oO + ЫЫ// Bg?<JNAO ?<NATACEGI0<Q#VaQaKaX y faaja$a`# (# # $agajaBgHz ?<=NAPJk,>/:X/<??<?NAO # ??<>NAXaNuaR`A CH"____#|____#|.___ .f .gR` f zGJE <QSI pQ`aBgHz D?<NNAPJk?</NAT @ (/?<HNA\Jg#,PNua`#) (#  # $agaLBgHz ?</< /<&??<@NAO ??<>NAXaNua<`a#`a?<LNATJ9g/: ?<INA\QNuK`Kav y f*NuC-?<?< a THaQNu:0NuB@ z A??<NAX z TC z?JgQz? !\gQB)A/?<;NA\Nu[0][ | Sagrotan to BootSaver|bootsector converter V1.0 | 24-03-92 C.N.D.|][ Convert | Desktop ][1][ Disk Error |There has been a general disk |error. Please check all drives |and filenames, before retrying.][ Retry | Cancel ][1][ Memory Error|Unable to allocate file buffer| due to insufficent free RAM.| Retry with a smaller file! ][ Retry | Cancel ] D 0H&8  (0@a $P    d0  % SAVEEXITSagrotan to BootSaverBootsector Converter v1.0The Comments in FILENAME.EXT are'________________________________' Enter BootSaver Comments &&_____________________________________XSelect filename for loadingSelect filename for saving:\BOOT.*:\*.SEC *23 46Z[   X >&,*  , @00`8NNNNNNkwp NNNNNNNNNNNNNNNNNNNNNNNNNNNNNupuke'(*** 2'BootSaver' Workdisk v3.01 02:29:1992.  =.. ABC NEO 1!}CAROLINECTI !>ZCTIPQ111BAS J!?-CTIPQ111PRG `vPIC PI1 %`;"}QSCREEN NEO ![}READ_ME DOC Qt {xREAD_ME2DOC i }\ RSCREEN NEO 9`}DfUD3"PAwGFPNEO!??ǀ? `?qQ'<q"'9!"(9q?K/"$(b( "(`" K>?BH""$( ("/BǞ?A"qȞqǜpG'A?<<`??08p <xxp @Ϝ0cɟ6`s ρ0~Ϝ0c3 ?p3> ϟ0`Ç>>"""""""("("(*** """"'"'"'"""ppp"""r r r ?????>>>>>>`p>>>>>>888>>>ÀÀ<8w8wLj888wwwÀÀ<8p8pǏ888www|8p8pǏ888ÀÀ<8p8pǏ888wwwÀÀ<8w8wLj>>>w>w>w>`p>>>>>>?????3?3?>>cc3333;0;0 3 3ww0303?0?0 3 30303?>?> > >kk03037070 6 6cc33333030 3 3cc303033cc?? 10 9 6 7 7 3 7 4 8 6 9 5 4 3 1 6 91 59 72 62 58 Lionpoulos-~~q" ***************************"*check docs have been read*"***************************247<pic.pi1,=abc.neo,2F::():: G ************************ H *read in questions.....* I ************************nJQ1$(),Q2$(),Q3$(),Q4$(),Q5$(),!A()KI Q: Q1$, Q2$, Q3$, Q4$, Q5$: Q1$( Q) Q1$: Q2$( Q) Q2$: Q3$( Q) Q3$: Q4$( Q) Q4$: Q5$( Q) Q5$: QM%STENS(, ):***************** *read sten table* *****************hNI Q:I I :% STENS( Q, I): I: Q O rscreen.neo,P:q:2.Z:ͦ:, :ަ::d:, :mIt is pointless proceeding unless you have read both READ_ME.DOC and READ_ME2.DOCi|n,: ::s ,,: Yes I have:,:s ,,: -> Desktopsq$xK: M: Mt:, :s,,: Show old file:, :s,,:Create new file$L0: M: M :::oType your name or other ID. Maximum of 8 letters. Don't use spaces or punctuation; F$M I( F$):(( F$, I,))z(( F$, I,))A((( F$, I,))Z(( F$, I,))a)( F$):Illegal filename-try again:K:  I F$ F$.CTI<:!Input m for male and f for female; SEX$f SEX$m SEX$M SEX$f SEX$F:::ȡ:Before commencing the questionnaire, please check that your disk is not writeprotected, and that it is present in drive A: while this program is running. Click on 'ok' to continue0ҩ,:s,,:OKܠ$O: M: M& ******************************& *Ready to start questions *& *but first load questns/scrn *& ******************************"'()*,q::,E 16,: F$&@,,U,&J,h,,&T,,+,&^,h,, h,+,$ *****************************$ * *$ * The Question Sequence.... *$ * *$ ***************************** OLDX3: V| Qtâ Q,,,?,,,:,,,?,,,tĢ Q,,,?,,,:,,,?,,,&Ǵ,, ,(;,`Ȓ4 Q,̩,֡ Q1$( Q):,: Q2$( Q):, : Q3$( Q):, : Q4$( Q):, : Q5$( Q)N X3(): X, OLDX,: OLDX X$T: M: MP()() T! A( Q)()>! A( Q),(700,5)(000,5)>! A( Q) ,(421,5)(000,5)>! A( Q) ,(070,5)(000,5)$V : M: Mަ:()(()T$ q: Q  Qh::::,: CALCULATING:,(000,20)(700,20)& *******************************& *Get raw Scores from responses*& *******************************& A((! A())(! A(3))(! A(`))(! A(w))(! A()))()' A A((! A())(! A(3))(! A(`))(! A(w))(! A()))()( A A((! A())(! A())(! A(2))(! A(I))(! A()))()) A A((! A())(! A())(! A(2))(! A(I))(! A()))()P* B((! A())(! A())(! A())(! A())(! A())(! A())(! A())(! A())(! A())(! A())(! A())(! A())(! A()))()0 C((! A())(! A())(! A(4))(! A(a))(! A(b))(! A(y))(! A()))()1 C C((! A())(! A())(! A(4))(! A(a))(! A(b))(! A(y))(! A()))()2 C C((! A())(! A())(! A(J))(! A(K))(! A(y))(! A()))()3 C C((! A())(! A())(! A(J))(! A(K))(! A(y))(! A()))(): E((! A())(! A(5))(! A(z))(! A())(! A())(! A())(! A()))(); E E((! A())(! A(5))(! A(z))(! A())(! A())(! A())(! A()))()< E E((! A())(! A())(! A())(! A(6))(! A(L))(! A(c)))()= E E((! A())(! A())(! A())(! A(6))(! A(L))(! A(c)))()D F((! A( ))(! A(7))(! A(N))(! A({))(! A(|))(! A())(! A()))()E F F((! A( ))(! A(7))(! A(N))(! A({))(! A(|))(! A())(! A()))()F F F((! A())(! A(M))(! A(d))(! A(e))(! A())(! A()))()G F F((! A())(! A(M))(! A(d))(! A(e))(! A())(! A()))()O G((! A(f))(! A(}))(! A())(! A())(! A()))()P G G((! A(f))(! A(}))(! A())(! A())(! A()))()Q G G((! A( ))(! A(!))(! A(8))(! A(O))(! A()))()R G G((! A( ))(! A(!))(! A(8))(! A(O))(! A()))()X H((! A( ))(! A(#))(! A(g))(! A(h))(! A(~))(! A())(! A()))()Y H H((! A( ))(! A(#))(! A(g))(! A(h))(! A(~))(! A())(! A()))()Z H H((! A("))(! A(9))(! A(:))(! A(P))(! A(Q))(! A()))()[ H H((! A("))(! A(9))(! A(:))(! A(P))(! A(Q))(! A()))()b I((! A( ))(! A($))(! A(i))(! A())(! A()))()c I I((! A( ))(! A($))(! A(i))(! A())(! A()))()d I I((! A( ))(! A(;))(! A(R))(! A())(! A()))()e I I((! A( ))(! A(;))(! A(R))(! A())(! A()))()l L((! A(%))(! A(S))(! A(j))(! A(k))(! A()))()m L L((! A(%))(! A(S))(! A(j))(! A(k))(! A()))()n L L((! A( ))(! A(<))(! A(=))(! A(T))(! A()))()o L L((! A( ))(! A(<))(! A(=))(! A(T))(! A()))()v M((! A(&))(! A('))(! A(>))(! A(V))(! A(l))(! A(m))(! A()))()w M M((! A(&))(! A('))(! A(>))(! A(V))(! A(l))(! A(m))(! A()))()x M M((! A())(! A())(! A(U))(! A())(! A())(! A()))()y M M((! A())(! A())(! A(U))(! A())(! A())(! A()))() N((! A())(! A()))(! A(n))(! A())(! A()))() N N((! A())(! A()))(! A(n))(! A())(! A()))() N N((! A())(! A(())(! A(?))(! A(@))(! A(W)))() N N((! A())(! A(())(! A(?))(! A(@))(! A(W)))() O((! A())(! A(*))(! A(B))(! A(Y))(! A(o))(! A(p))(! A()))() O O((! A())(! A(*))(! A(B))(! A(Y))(! A(o))(! A(p))(! A()))() O O((! A())(! A(+))(! A(A))(! A(X))(! A())(! A()))() O O((! A())(! A(+))(! A(A))(! A(X))(! A())(! A()))() Q1((! A())(! A(-))(! A(C))(! A())(! A()))() Q1((! A())(! A(-))(! A(C))(! A())(! A()))() Q1 Q1((! A())(! A(,))(! A(Z))(! A(q))(! A()))() Q1 Q1((! A())(! A(,))(! A(Z))(! A(q))(! A()))() zQ2((! A(.))(! A(D))(! A(E))(! A())(! A()))() zQ2 zQ2((! A(.))(! A(D))(! A(E))(! A())(! A()))() zQ2 zQ2((! A())(! A([))(! A(\))(! A(r))(! A(s)))() zQ2 zQ2((! A())(! A([))(! A(\))(! A(r))(! A(s)))() rQ3((! A(/))(! A(F))(! A(]))(! A())(! A()))() rQ3((! A(/))(! A(F))(! A(]))(! A())(! A()))() rQ3 rQ3((! A())(! A())(! A(t))(! A())(! A()))() rQ3 rQ3((! A())(! A())(! A(t))(! A())(! A()))() jQ4((! A(0))(! A(1))(! A(G))(! A(^))(! A(u))(! A())(! A()))() jQ4 jQ4((! A(0))(! A(1))(! A(G))(! A(^))(! A(u))(! A())(! A()))() jQ4 jQ4((! A())(! A(H))(! A(_))(! A(v))(! A())(! A()))() jQ4 jQ4((! A())(! A(H))(! A(_))(! A(v))(! A())(! A()))()" ***************************" * *" *Start converting to stens*" * *" ***************************b bA10: Q : A% STENS(, Q) bA10  Qb ZB10:4 Q : B% STENS(, Q) ZB10  Qb RC10: Q : C% STENS(, Q) RC10  Qb JE10: Q : E% STENS(, Q) JE10  Qb BF10:~ Q : F% STENS(, Q) BF10  Qb :G10: Q : G% STENS(, Q) :G10  Qb$ 2H10:Z Q : H% STENS(, Q) 2H10 % Qb. *I10: Q : I% STENS(, Q) *I10 / Qb8 "L10:6 Q : L% STENS(, Q) "L10 9 QbB M10: Q : M% STENS( , Q) M10 C QbL N10: Q : N% STENS( , Q) N10 M QbV O10: Q : O% STENS( , Q) O10 W Qd` Q110: Q : Q1% STENS( , Q) Q110 a Qdj Q210:` Q : zQ2% STENS( , Q) Q210 k Qdt Q310: Q : rQ3% STENS(, Q) Q310 u Qd~ Q410:@ Q : jQ4% STENS(, Q) Q410  Q$ *****************************$ * *$ * secondary factors *$ * *$ *****************************L SEX$f SEX$F~⏘np#, F$(#, bA10-#, ZB102#, RC10<#, JE10F#, BF10P#, :G10Z#, 2H10d#, *I10n#, "L10x#, M10#, N10#, O10#, Q110#, Q210#, Q310#, Q410#, EXT#, ANX#, TP#, IND¡#, LEADҠ#۠&܊&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&݊& Show a profile using current&&ފ& file.(new or old) &&ߊ&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&():ަ:,:Z bA10 ,;Z ZB10 , ;Z RC10 ,;Z JE10 ,; BF10 Z,; :G10 Z,%; 2H10 Z,+; *I10 Z,1; "L10 Z,7 M10 Z,=; N10 Z,C; O10 Z,I; Q110 Z,O; Q210 Z,U; Q310 Z,[; Q410 Z,a EXTA4VxZ,m; ANXA4VxZ,s; TPA4VxZ,y; INDA4VxZ,; LEADA4VxZ,Z bA10 ,Z ZB10 , Z RC10 ,Z JE10 ,Z BF10 , :G10 Z,% 2H10 Z,+ *I10 Z,1 "L10 Z,7 M10 Z,= M10 Z,= N10 Z,C O10 Z,I Q110 Z,O Q210 Z,U Q310 Z,[ Q410 Z,a EXTA4VxZ,m ANXA4VxZ,s TPA4VxZ,y INDA4VxZ, LEADA4VxZ,F,),w,:,,,@ ***********************J * *T * disc/printer write. *^ * *h ***********************$F: M: M ():"()p, :s,, : RS232 PORT :, :s,, : PRINTER PORT$:M:M$:M:M6PTPT#(@¢PT#,aux#,prtNġ#,2Characteristics expressed in Standard tens (STENS):#,"̡#,warmth,A10(ѡ#, intelligence,B100֡#,emotional stability,C10&#, dominance,E10*#, impulsiveness,F10&#, conformity,G10$#,boldness,H10(#, sensitivity,I10*#,suspiciousness,L10(#, imagination,M10&&#, shrewdness,N10&0#, insecurity,O10(:#, radicalism,Q110.D#,self-sufficiency,Q210.N#,self-discipline,Q310&X#,tension,Q410.Y#, extravert,EXT ,Z#,anxiety,ANX .[#, tough poise,TP 0\#, independence,IND *]#, leadership,LEAD10b# l:(۠I must click on one of the$ܠboxes labelled agree, *ݠdisagree, or in-between, and*ޠthen click on confirm.,&堦I expect I shall send my (栦data file to the author of"砦this program, for a ,蠦professional evaluation,"It is nicer to have (neighbours than to live in,an isolated place.,,@I am an energetic person.,,,,&Sometimes, the worries of&the day keep me awake at night,,* I try not to criticise other<people's judgement and taste,,,$I don't mind insulting:someone if they deserve it,,,(!I don't mind telling jokes."to an audience,,,&+If my two neighbours were&,arguing in the street, I(-would let them get on with*.it, and not interfere.,(5People tell me that I am a.6born organiser,,,$?I would prefer to build&@things rather than write Apoems.,,(II am more interested in art0Jthan in politics,,,&SI get annoyed very rarely8Tcompared to other people,,,(]One can judge people quite"^accurately from their&_ appearance.,,&gThe working week at this&hstage of civilisation is&i far too long,,&qI enjoy an occasional bet*r or gamble.,,,${I would prefer to play(|a good adventure game than2}a computer arcade game.,,&I sometimes lose my self-"confidence when I am,talking to someone,,$I don't get worried if8someone doesn't like me.,,,BMoney cannot buy happiness.,,,,$I always consider other$people when making any$ decisions,,&I like to join clubs and"to take part in club& activities.,,"I don't like to make4plans too far ahead.,,,$People tell me to slow" down in my day-to-day$à activities,,4ˠ I never sulk.,,,,(ՠI'd rather be a lighthouse"֠keeper than work in a4נTourist Information Centre,,"ߠI would prefer to be ࠦan astronaut than a.ᠦmarriage counsellor.,,&I've not had a great life(so far.,,,"I've got very strong* willpower,,,$ The Royal Family does a*  good job.,,,$ I don't like to have to& make quick decisions that. affect other people,,& I like to play the clown.  occasionally.,,,: %I am a tidy person.,,,,$ /I don't like to be the4 0centre of attention,,,$ 9On a train journey, I $ :would rather talk to a" ;fellow traveller than$ <sit in silence.,& CI would rather go to Art& DCollege than to Technical" ECollege,,$ MNever trust anyone who$ Nsmiles for no apparent " Oreason.,, WIt is better to be& Xspontaneous than to think: Ytoo much before doing, something.,& aI would rather lead than* b organise.,,,$ kI often fantasise about* l my future.,,," uIt is important to be( vpolite.,,,$ I get depressed when I. am criticised.,,,$ If my boss/teacher asks* for me, I am usually pleased. rather than worried.,,$ This country needs more: do'ers and less thinkers.,,,& The media in this country( is politically biased, even4 when it claims not to be.,," I don't like to play, team games.,,,B People think I am stubborn.,,,,$ I have yelled/screamed" when a loud noise has& startled me.,,$ ŠI wake up slowly in the( Ơmorning.,,,( ϠI would rather be an Arctic$ Рexplorer than a holiday" Ѡcourier.,,< ٠I like to sell things.,,,, My friends never. disappoint me.,,,$ In a foreign restaurant( I would eat any dish, even" if I didn't know what  was in it.,& It is best not to show it4 when you are upset.,,,&  `See the funny side` is8  a good motto for life.,,,( Rules are for the obedience" of fools and for the 0 !guidance of the wise.,,$ )You should respect your4 *elders and betters.,,,$ 3I find it difficult to$ 4make presentations to a& 5 large group.,,& =I would rather direct the( >efforts of a team than work& ? with a team.,,* GIf someone became angry with( Hmy actions, I would try to ( Icalm them down rather than " Jget irritated.,& QNewspaper articles could8 Rnever move me to action.,,," [I am not very good at< \remembering trivial detail.,,,( eI would rather be a farmer2 fthan a bank clerk.,,,$ oPeople say I am absent-( pminded.,,,& yIt takes an awful lot to, z get me down.,,,( I sometimes get excited in& manner and voice, to the6 embarrassment of my friends.,," I would rather be a * playwright than a policeman,0 given the same salary.,,( I have a few, close friends& rather than a wide circle* of acquaintances,,& Sometimes, I wish people ( would just leave me to get, on with something.,,$ In business, one cannot$ take people's feelings& into account when making( important decisions.,6 I often daydream,,,,$ People tell me I have a( temper.,,," ɠI would rather be a < ʠtechnician than a salesman.,,,( 砦Sometimes, I have offended& 蠦someone without realising" 頦it until later, when . ꠦsomeone else has told me.,& People in general are not$ very sensitive to the 4 feelings of other people.,,( People who belch loudly in2 public disgust me.,,,$ in conversation, I am a$ listener, rather than a" talker.,,& I am at my happiest in a& crowd of people, or at a party.,,$ Whatever you achieve in& life, the important thing$ is to get on well with"  other people.,& #When arriving at a party,& $I feel quite nervous to & % begin with.,,& -I don't see the point in< .engaging in social chit-chat,,,* 7I prefer to read a biography6 8than a romantic novel.,,,( AIncreasing crime is largely$ Bdue to the abolition of" Ccapital punishment in" D this country.,$ KI have a basic trust in. L human nature.,,,& UThe trouble with society$ Vtoday is that people do& Wnot set high enough goals$ Xin their lives., _I only enjoy those& `activities that have some4 asort of point or purpose.,,( iAmbition is more important0 jthan friendship,,,( sSome days, nothing seems to& tgo right, and then I get* uvery frustrated.,,& }I suffer from feelings of& ~guilt more often than the* average person.,,( I like to know for certain& what I shall be earning . from month to month.,,$ I wholeheartedly look " forward to going out$ socially.,,( I would enjoy working as an: Agony Aunt on a newspaper.,,,* The detail is more important$ than the overview of a" problem.,,( I have been told that I am4 an irritable person.,,,$ I always sleep soundly,4 whenever I wish to.,,,F àIn business, I would enjoy,dealing with people more( Ġthan I would enjoy keeping* Šaccounts and records.,< ᠦI never bear a grudge.,,,,& 렦I can block out external& 젦noise when I am trying to& concentrate.,,& I would never argue with0 my boss/teacher.,,," I don't tend to enjoy2 social functions.,,,( If I get into an argument,8 I usually seem to lose.,,,( When dealing with problems," I usually plan ahead8 rather than think on my feet.,,& I find it easy to talk to$ a wide range of people. about many subjects.,," 'I am diplomatic and $ (persuasive rather than2 )blunt and to-the-point.,,( 1I would rather be an actor: 2than a building surveyor.,,,& ;If people's work doesn't" <reach my standards, I6 =would usually tell them so.,,* EI think I am good at getting( Fpeople to help me, without* Gthem realising.,,( OI enjoy the theatre, opera,2 Pballet, and so on.,,,( YMy memory and concentration$ Zare not so good as most* [other people's.,," cI am not particularly" dinterested in talking6 eabout emotions and feelings.,,& mI sometimes get a feeling& nof dread for no apparent" oreason.,,& wI sometimes get depressed2 xwithout due cause.,,,$ It is a bad thing that 8 Britain lost its empire.,,,* I am always very fashionable4 in the way I dress.,,,$ If I have a question at( work/school, I would rather* ask someone than look up the, answer in a book/manual.,$ I sometimes feel sorry, for myself.,,,& When under stress, I have$ suffered indigestion or4 other physical complaints.,,6 I hate routine.,,,,& Given the same salary, I( would rather be a solicitor( than a farmer.,,( ۠Despite looking forward to$ ܠan event, when the time$ ݠcomes, I often lose my ޠ enthusiasm.,& 堦On the whole, I feel that" 栦I cope with life very" 砦easily.,,$ I will speak to someone& passing me in the street& if there is something to. say that seems worthwhile.," My life could be more* exciting.,,,& I don't think I will ever$ fully grow up - I enjoy6 being childish occasionally.,,( I like to keep busy as much,  as possible.,,, I consider myself 4 to be an extravert.,,,< !I make friends easily.,,,,( +On TV, I prefer to watch a* ,comedy than a current affairs$ - programme.,,$ 5I would rather paint a: 6picture than paint a room.,,,& ?I consider myself a very2 @persistent person.,,,& IThere are greater rewards8 Jthan money in some jobs.,,,( SI would rather read a novel" Tthan an article by a . Uradical politician.,,& ]I would prefer a package$ ^holiday to planning a 6 _foreign tour as I go along.,,( gWhen I have to be somewhere$ hon time, I cannot relax, iuntil I get there.,,& qI specially enjoy solving" rproblems created by ( s other people.,," {Society should adopt( |scientific principles, and$ }not look to traditional" ~beliefs to solve its   problems.< I am a non-conformist.,,,," I have sometimes felt< jealousy, and acted upon it.,,,& I like to impress people: with my memory for detail.,,,@ I worry about the future.,,,,< I can take criticism.,,,," I would rather be a " photographer than a & politician.,,@ ՠMy dreams are quite vivid.,,,,* ߠEven if something appears to( ࠦbe a bad idea, it is still. ᠦworth trying it out.,,L 頦I am proud of my achievements,in life,,,D I would not like to be famous.,,,," I have a hobby that I0 enjoy on my own.,,,(Generally, I do what I want$without too much regard, for other people.,,@I have strong principles.,,,,$I would never talk to a$stranger unless it was$ necessary.,,$%I enjoy seeing pompous>&people get their come-uppance.,,,$/I have always preferred$0studying English rather&1 than Maths.,,"9Born-again christians,: irritate me.,,,(CI find that most people are8Dinteresting to talk to.,,,$MI don't always speak up:Nfor myself when I should.,,,"WIt is important to be(Xpolite, even with ignorant"Ypeople.,,&aPeople seem to regard me>bas a solid shoulder to cry on.,,,*kThe age of chivalry is dead -2land good riddance!,,,$uProgress tends to be a*v bad thing.,,,(I find it easier to follow&the written word than the& spoken one.,,"I like to push rules0to their limit.,,,*I won't argue a point unless>I am totally sure of my facts.,,,(On occasion, little things4start to niggle me.,,,&I usually put my brain in>gear before opening my mouth,,,,(I have collected money for&charity on more than one$ occasion.,,$ϠI wish I was better at 0Рavoiding hassle.,,,&٠Look after number one is6ڠsound advice for life.,,,B㠦A little danger is exciting.,,,,&I believe in doing things, on impulse.,,,DVariety is the spice of life.,,,,(It is important to keep to. a moral code.,,,& I have been described by* my friends as a conscientious" person.,,0 I am shy.,,,,$`Pen` is to `write` as  `Spade` is to: ! [a] shovel"[b] dig#[c] fork()What is the next letter in$*this series: a..c.._..+[a] d,[b] f-[c] e&3`Mouse` is to `cheese` as4`horse` is to:5 [a] nosebag6[b] hay7[c] milk$=What is the next number&>in the series 13..16.._..?[a] 17@[b] 19A[c] 11(G`Quiet` is to `whisper` asH`noisy` is to:I [a] screamJ [b] shoutK[c] talkQ`81` is to `9` asR `25` is to:S[a] 5T[b] 125U[c] 16*[Which of the following words \is the odd one out?][a] hat^[b] coat_[c] hood"e`Big` is to `tall` asf`building` is to:g [a] househ [b] smalli [c] kitchen&o`Butcher` is to `meat` asp`compass` is to:q [a] pointr [b] norths [c] direction(yWhich word does not belongzwith the others?{ [a] curve|[b] bend} [c] corner"`Page` is to book as `leaf` is to:[a] tree[b] twig [c] trunk(Which word does not belongwith the others? [a] ladder [b] stairs[c] ramp"`rqp` is to `STU` as `fgh` is to:[a] IJK[b] ijk[c] KJI$This is the end of the(CTIPQ. I have answered all&the questions as honestly  as I could., **************** * Load old file* ****************$: M: MH F$(*.CTI, CTIPQ Response File Selector, )( F$K#,F$#,A10,B10,C10,E10,F10,G10,H10,I10,L10,M10,N10,O10,Q110,Q210,Q310,Q410,EXT,ANX,TP,IND,LEAD#:& ****female secondaries********V EXT bA10 BF10 2H10 Q210, EXTFEXT3< EXT( EXTGEXT3, EXT( EXT3d ANX "L10 O10 Q410, RC10 2H10 Q310, ANXFANX3< ANX' ANXG ANX3, ANX(ANX3l" TP JE10 BF10 "L10H bA10 *I10 M10*# TPF TP3*$ TP(TP36% TPG TP'TPj, IND JE10 2H10 M10 Q110 Q210 :G10,- INDFIND3<. IND' INDGIND3,/ IND( IND36 LEAD ZB10 RC10 JE10 BF10 :G10 2H10 N10 Q310 *I10 M10 O10 Q410"7 LEAD10 LEAD h& ******male secondaries********VEXTA10F10H10Q210,EXTFEXT3<EXT(EXTGEXT3,EXT(EXT3dANXL10O10Q410,C10H10Q310,ANXFANX3<ANX'ANXGANX3,ANX(ANX3dTPF10yA10I10M10Q110*TPFTP3*TP(TP38TPGTP'TP3INDE10H10L10Q110Q210G10N10O10,INDFIND3<IND'INDGIND3,IND(IND3LEADB10C10E10F10G10H10N10Q310I10M10O10Q410"LEAD10LEAD D,,,, , , ,,,D,, , , ,,,,,D,,,, , , ,,,D,,,, , ,,,,D,,, , , ,,,,D,,,, , ,,,,DĠ,,,, , ,,,,DΠ,,,,, , , ,,Dؠ,,, , , ,,,,D⠦,,,, , , ,,,D젦,,,, , ,,,,D,,,,, , , ,,D,,,, , ,,,,D ,,, , , ,,,,D,,, , ,,,,,D,,,,,, , , , VpKPlease write-enable disk in drive A: Press a mouse key to continue.$z:M:Mf#(:YPrinter not ready - please check power and connections. Press mouse key to continue.$#2:M:M$#<:M:M#F??ǀ? `?qQ'<q"'9!"(9q?K/"$(b( "(`" K>?BH""$( ("/BǞ?A"qȞqǜpG'A?<<`??08p <xxp @Ϝ0cɟ6`s ρ0~Ϝ0c3 ?p3> ϟ0`Ç>>"""""""("("(*** """"'"'"'"""ppp"""r r r ?????<``?``8LJLJ8xχχ0xxp<><><>|<|<|<<<<88|||<|<~~Ɓ9<<<<||   <33330ffffffffffffffffff9ffffff  f>f>f`~`~`~~~~fff~f~)~~~~ff  <38 3 f>f>f>`````````fff`f`||````ffǏǏ8px?3xp>>>`<`<`<<<<<>cc3333;0;0 3 3ww0303?0?0 3 30303?>?> > >kk03037070 6 6cc33333030 3 3cc303033cc??DfUD3"PAwGFPNEO!<69>aLaDGDCaX`0,29R@t4g 2,`a~`F0,g 2,S@`p0,4S@9@`0,2,gSA`PJl0f\2,6SA`>092,RAt6g 0,`"Jl0gSA`0,BA` B@2,`a`BlJyk3/<a Nu9|JlgBy9| yg/0,a Nu0, 9@Nu0, 9@Nu0, 9@0,a)N 0, a)NNu0, 9@`0, 9@Nu0, 9@Nu9@>JygGOOl` lGla)N Nu9@ >JygGOOl?`lOGlaJ)NNuB@` p`p9@PNu9|0NuBl0Nu0,2,`l4l@`R`N > `Stos basic compiler V 1.0 by Francois Lionet00@Q(?H=zbO@4Vxwpp 0PU33ss777M,K Ugݝ`*n ]gݝ`*nJgݝ`C0<BYQC nE 0<&Jf(Q Hz?< NA\@ f B?< NA\K0?<NNT+@A@Cp2Q"9Az#$09.B#ArXg QAEp$QAd#I?<NNT;@G k p,8Q kp 8Q k(*y. , MI < kBQ oA+|#EhD+HH+O 0.MGd+K.+S2+k6+k:BA+HAp Q( B(D+LAD+H+HA+HA@p rBQQ 9.+@+@ .+@ m$H"m`# # # # b+I+IACp"Q, n$N(n*-BG&.$(.(gP<f~`Afݒ`ݒ&Rd~gJGffkfB`&`&&`JGf+N ,+n <+L H+O T T+n P+n X+n+n E+J h(n+L&L+L pI0+L lI$+L `$I+L \%LI+L d%LI%L I%LI+L I+L @I+L L+L 8 L+H +H @ A+H A +H I C+I tC +I |C,+I C,+I ;i$;i&DBm +n$ +n( dBe L"m$na$n&n(n ./,nN,_J@f$na$nG .(nNJ@f;n" g$naHNL$natNJ@fb+H DA    A#A# A#A#A#pARNE~NCpNG m6;hT+y A!M#,m LA +H ;| &m ,Et m D"mgH >$RB@N" L|J@fL%AhEQ+H D+H?<%NNO/- ?<NNO m0<BBQ`09`0<`p` p `NupR`p. m ( (h)*~b( (h)*~f list listbank`fload"*.bas"`fsave"*.bas"`run`dir`dir$= dir$ + "\`previous`off`full`multi 2`multi 3`multi 4`mode 0`mode 1`accnew:accload"*"`default`env`key list`f1: f2: f3: f4: f5: f6: f7: f8: f9: f10:f11:f12:f13:f14:f15:f16:f17:f18:f19:f20:NRNNN&I-<NI-<NI-<pN@I-<pN@I-<pN@I-<Q-<pNI-<Q -<pNI-<NNI-<NNI-<NpI-<NI-<NI-<prtA>PN-<prtA>TN-<prtA>XN-<prtA>\N-<prtA>`N-<prtA>dNI-<A>h --<-<ENIA>lpN A>ppN A>tpN A>xpN A>|pN IA>l-A>h-A>PN\ IA>p-A>h-A>TN\ IA>t-A>h-A>XN\ IA>x-A>h-A>\N\ IA>|-A>h-A>`N\ INEG"<$NI-<A>h --<-<ENI-<A> --< -<ENIA>h-A>-A>N\pN INEG"<$ INA>--<NzEN^IN-<NJg0Ip m INA>--<NzEN^IN-<NJgINNZINI-<NINI;|,-<QNA>=<-pNI-<A> -A>-N-<EZNIA>-A>--<NN-<zNA>-A>--<NN-<AN A>-A>--<NN-<ZNA>-A>--<NN-<aN  A>-N-<N JgjINB+LN8BINB+LI-<R@NN8BI-<KNINNzINEG"<$--<R\NA> INB+LN8BI;|,-<RbNA>=<-pNIA>--<RNA>--<RN A>--<RN A>--<RN Jg0IN^IN^IN^INNINB+LN8BINB+LI-<RNN8BI-<-<NI-<-<-<NINB+LI-<SRNN8BINIINA> INA>--<NzE&N^I-<NNI-<NpI-<-<NI-<NI-<-<ENI-<NI-<-<NINB+LIA>-NN8BI-<-<-<-<U-<NBI-<-<h-<-<-<NBI-<-<-<-<+-<NBI-<-<h-<-<-<NBI-<-<-<+-<NI-<NI-<3A> I-<NI-<A>h --<-<E#NIA>h--<NVJgvI-<-<-<-<?-<N-<-<N I-<-<-<-<?-<N-<-<N IA>h--<NVJgvI-<-<-<-<?-<N-<-<N I-<-<-<-<?-<N-<-<N IN-<-< -<(-<;-<`N I-<4A>h- -<NI-<-<NINB+LIA>h-A>PN\-NN8BI-<-<NINB+LIA>h-A>TN\-NN8BI-<-< NINB+LIA>h-A>XN\-NN8BI-<-< NINB+LIA>h-A>\N\-NN8BI-<-< NINB+LIA>h-A>`N\-NN8BI-<3N-<N A> IA>--<A>--<prNIA>-A> IINA> INA>--<NzE!N^I-<Nv-<NV-<Nv-<NV JgNN!I`(I-<NvA>h-A>dN\ IA>h-A>dN\--<NVJgI-<-<SVN4IA>h-A>dN\--<NVJgI-< -<SfN4IA>h-A>dN\--<NVJgI-< -<SvN4IINA> INA>--<NzE#.N^IN.I-<NpI-<Nv-<NzJgINN!IN-<SNfJgINI-<A>h INEG"<$dN\--<NV-<3A>dN\--<NV і-<`A>dN\--<NV і-<wA>dN\--<NV і-<A>dN\--<NV і-<DNrA> IA>--<A>dN\--<NV-<3A>dN\--<NV і-<`A>dN\--<NV і-<wA>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<A>dN\--<NV і-<2A>dN\--<NV і-<IA>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<A>dN\--<NV і-<2A>dN\--<NV і-<IA>dN\--<NV і-<A>dN\--<NV і-<DNr іA> I-<A>dN\--<NV-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNrA> I-<A>dN\--<NV-<A>dN\--<NV і-<4A>dN\--<NV і-<aA>dN\--<NV і-<bA>dN\--<NV і-<yA>dN\--<NV і-<A>dN\--<NV і-<DNrA> IA>--<A>dN\--<NV-<A>dN\--<NV і-<4A>dN\--<NV і-<aA>dN\--<NV і-<bA>dN\--<NV і-<yA>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<A>dN\--<NV і-<JA>dN\--<NV і-<KA>dN\--<NV і-<yA>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<A>dN\--<NV і-<JA>dN\--<NV і-<KA>dN\--<NV і-<yA>dN\--<NV і-<A>dN\--<NV і-<DNr іA> I-<A>dN\--<NV-<5A>dN\--<NV і-<zA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNrA> IA>--<A>dN\--<NV-<5A>dN\--<NV і-<zA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<A>dN\--<NV і-<A>dN\--<NV і-<6A>dN\--<NV і-<LA>dN\--<NV і-<cA>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<A>dN\--<NV і-<A>dN\--<NV і-<6A>dN\--<NV і-<LA>dN\--<NV і-<cA>dN\--<NV і-<DNr іA> I-< A>dN\--<NV-<7A>dN\--<NV і-<NA>dN\--<NV і-<{A>dN\--<NV і-<|A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNrA> IA>--< A>dN\--<NV-<7A>dN\--<NV і-<NA>dN\--<NV і-<{A>dN\--<NV і-<|A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<MA>dN\--<NV і-<dA>dN\--<NV і-<eA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<MA>dN\--<NV і-<dA>dN\--<NV і-<eA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> I-<fA>dN\--<NV-<}A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNrA> IA>--<fA>dN\--<NV-<}A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--< A>dN\--<NV-<!A>dN\--<NV і-<8A>dN\--<NV і-<OA>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--< A>dN\--<NV-<!A>dN\--<NV і-<8A>dN\--<NV і-<OA>dN\--<NV і-<A>dN\--<NV і-<DNr іA> I-< A>dN\--<NV-<#A>dN\--<NV і-<gA>dN\--<NV і-<hA>dN\--<NV і-<~A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNrA> IA>--< A>dN\--<NV-<#A>dN\--<NV і-<gA>dN\--<NV і-<hA>dN\--<NV і-<~A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<"A>dN\--<NV-<9A>dN\--<NV і-<:A>dN\--<NV і-<PA>dN\--<NV і-<QA>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<"A>dN\--<NV-<9A>dN\--<NV і-<:A>dN\--<NV і-<PA>dN\--<NV і-<QA>dN\--<NV і-<A>dN\--<NV і-<DNr іA> I-< A>dN\--<NV-<$A>dN\--<NV і-<iA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNrA> IA>--< A>dN\--<NV-<$A>dN\--<NV і-<iA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--< A>dN\--<NV-<;A>dN\--<NV і-<RA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--< A>dN\--<NV-<;A>dN\--<NV і-<RA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> I-<%A>dN\--<NV-<SA>dN\--<NV і-<jA>dN\--<NV і-<kA>dN\--<NV і-<A>dN\--<NV і-<DNrA> IA>--<%A>dN\--<NV-<SA>dN\--<NV і-<jA>dN\--<NV і-<kA>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--< A>dN\--<NV-<dN\--<NV і-<=A>dN\--<NV і-<TA>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--< A>dN\--<NV-<dN\--<NV і-<=A>dN\--<NV і-<TA>dN\--<NV і-<A>dN\--<NV і-<DNr іA> I-<&A>dN\--<NV-<'A>dN\--<NV і-<>A>dN\--<NV і-<VA>dN\--<NV і-<lA>dN\--<NV і-<mA>dN\--<NV і-<A>dN\--<NV і-<DNrA> IA>--<&A>dN\--<NV-<'A>dN\--<NV і-<>A>dN\--<NV і-<VA>dN\--<NV і-<lA>dN\--<NV і-<mA>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<A>dN\--<NV і-<UA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<A>dN\--<NV і-<UA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> I-<A>dN\--<NV-<)A>dN\--<NV і-<nA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNrA> IA>--<A>dN\--<NV-<)A>dN\--<NV і-<nA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<(A>dN\--<NV і-<?A>dN\--<NV і-<@A>dN\--<NV і-<WA>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<(A>dN\--<NV і-<?A>dN\--<NV і-<@A>dN\--<NV і-<WA>dN\--<NV і-<DNr іA> I-<A>dN\--<NV-<*A>dN\--<NV і-<BA>dN\--<NV і-<YA>dN\--<NV і-<oA>dN\--<NV і-<pA>dN\--<NV і-<A>dN\--<NV і-<DNrA> IA>--<A>dN\--<NV-<*A>dN\--<NV і-<BA>dN\--<NV і-<YA>dN\--<NV і-<oA>dN\--<NV і-<pA>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<+A>dN\--<NV і-<AA>dN\--<NV і-<XA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<+A>dN\--<NV і-<AA>dN\--<NV і-<XA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> I-<A>dN\--<NV-<-A>dN\--<NV і-<CA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNrA> I-<A>dN\--<NV-<-A>dN\--<NV і-<CA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNrA> IA>--<A>dN\--<NV-<,A>dN\--<NV і-<ZA>dN\--<NV і-<qA>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<,A>dN\--<NV і-<ZA>dN\--<NV і-<qA>dN\--<NV і-<A>dN\--<NV і-<DNr іA> I-<.A>dN\--<NV-<DA>dN\--<NV і-<EA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNrA> IA>--<.A>dN\--<NV-<DA>dN\--<NV і-<EA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<[A>dN\--<NV і-<\A>dN\--<NV і-<rA>dN\--<NV і-<sA>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<[A>dN\--<NV і-<\A>dN\--<NV і-<rA>dN\--<NV і-<sA>dN\--<NV і-<DNr іA> I-</A>dN\--<NV-<FA>dN\--<NV і-<]A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNrA> I-</A>dN\--<NV-<FA>dN\--<NV і-<]A>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNrA> IA>--<A>dN\--<NV-<A>dN\--<NV і-<tA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<A>dN\--<NV і-<tA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> I-<0A>dN\--<NV-<1A>dN\--<NV і-<GA>dN\--<NV і-<^A>dN\--<NV і-<uA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNrA> IA>--<0A>dN\--<NV-<1A>dN\--<NV і-<GA>dN\--<NV і-<^A>dN\--<NV і-<uA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<HA>dN\--<NV і-<_A>dN\--<NV і-<vA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> IA>--<A>dN\--<NV-<HA>dN\--<NV і-<_A>dN\--<NV і-<vA>dN\--<NV і-<A>dN\--<NV і-<A>dN\--<NV і-<DNr іA> I-<A> I-<A>h --< -<E^tNIA>--<A>h-A>N\-NJgIA>INEG"<$ I-<A>h --< -<E_NIA>--<A>h-A>N\-NJgIA>INEG"<$ I-<A>h --< -<E_NIA>--<A>h-A>N\-NJgIA>INEG"<$ I-<A>h --< -<E`rNIA>--<A>h-A>N\-NJgIA>INEG"<$ I-<A>h --< -<EaNIA>--<A>h-A>N\-NJgIA>INEG"<$ I-<A>h --< -<EaNIA>--<A>h-A>N\-NJgIA>INEG"<$ I-<A>h --< -<EbpNIA>--<A>h-A>N\-NJgIA>INEG"<$ I-<A>h --< -<EcNIA>--<A>h-A>N\-NJgIA>INEG"<$ I-<A>h --< -<EcNIA>--<A>h-A>N\-NJgIA>INEG"<$ I-<A>h --< -<EdnNIA>--< A>h-A>N\-NJgIA>INEG"<$ I-<A>h --< -<EeNIA>--< A>h-A>N\-NJgIA>INEG"<$h --< -<EeNIA>--< A>h-A>N\-NJgIA?INEG"<$h --< -<EflNIA>--< A>h-A>N\-NJgIA?INEG"<$h --< -<EgNIA>--< A>h-A>N\-NJgIA?INEG"<$h --< -<EgNIA>--<A>h-A>N\-NJgIA? INEG"<$h --< -<EhjNIA>--<A>h-A>N\-NJgIA?INEG"<$--<SNfA>--<SNf JgIN+O TNXI`IN+O TNI-<pN8INI-<A>-pN .INB+L-<NFIA>-NpNDBINB+L-<NFIA>-NpNDBINB+L-<NFIA>-NpNDBINB+L-<NFIA>-NpNDBINB+L-<NFIA>-NpNDBINB+L-<NFIA>-NpNDBINB+L-<NFIA>-NpNDBINB+L-<NFIA>-NpNDBINB+L-<NFIA>-NpNDBINB+L-<NFIA>-NpNDBINB+L-<NFIA>-NpNDBINB+L-<NFIA?-NpNDBINB+L-<NFIA?-NpNDBINB+L-<NFIA?-NpNDBINB+L-<NFIA? -NpNDBINB+L-<NFIA?-NpNDBINB+L-<NFIA?-NpNDBINB+L-<NFIA?-NpNDBINB+L-<NFIA?-NpNDBINB+L-<NFIA? -NpNDBINB+L-<NFIA?$-NpNDBI-<NrINI-<NpIN.I-<NNI-<NNI-<-<NI-<NI-<ZA>--< Nr і-<-<ZA>--< Nr і-< -<ZA>--< Nr і-<-<ZA>--< Nr і-<A>--< Nr-<Z і-<A>--< Nr-<Z і-<%A>--< Nr-<Z і-<+A>--< Nr-<Z і-<1A>--< Nr-<Z і-<7p NIA>--< Nr-<Z і-<=A>--< Nr-<Z і-<CA?--< Nr-<Z і-<IA?--< Nr-<Z і-<OA?--< Nr-<Z і-<UA? --< Nr-<Z і-<[A?--< Nr-<Z і-<apNIA?----< Nr і-<-<ZA>--< Nr і-< -<ZA>--< Nr і-<-<ZA>--< Nr і-<-<ZA>--< Nr і-<A>--< Nr-<Z і-<%A>--< Nr-<Z і-<+A>--< Nr-<Z і-<1A>--< Nr-<Z і-<7A>--< Nr-<Z і-<=p rNIA>--< Nr-<Z і-<=A>--< Nr-<Z і-<CA?--< Nr-<Z і-<IA?--< Nr-<Z і-<OA?--< Nr-<Z і-<UA? --< Nr-<Z і-<[A?--< Nr-<Z і-<aprNIA?-- INA>--<NzEvN^I-<Nv-<NVJgININ>I-<Nv-<NzJgNNvINI-<-< NI-<-<-< NINB+LI-<SNN8BI-<-< NI-<-<-< NINB+LI-<SNN8BIINA> INA>--<NVEwN^IINA> INA>--<NzEx0N^IN-<NJgI-<A?( I`I-<A?( I-<#(N8IA?(--<NVJg"I-<-<SpN I`I-<-<SpN INB+L-<NFI-<SNNDBINB+L-<NFNDBINB+L-<NFI-<TNNZIA>-NpNDBINB+L-<NFI-<TNNZIA>-NpNDBINB+L-<NFI-<T$NNZIA>-NpNDBINB+L-<NFI-<T:NNZIA>-NpNDBINB+L-<NFI-<TFNNZIA>-NpNDBINB+L-<NFI-<TVNNZIA>-NpNDBINB+L-<NFI-<TbNNZIA>-NpNDBINB+L-<NFI-<TlNNZIA>-NpNDBINB+L-<NFI-<TzNNZIA>-NpNDBINB+L-<NFI-<TNNZIA>-NpNDBINB+L-<NFI-<TNNZIA>-NpNDBINB+L-<NFI-<TNNZIA?-NpNDBINB+L-<NFI-<TNNZIA?-NpNDBINB+L-<NFI-<TNNZIA?-NpNDBINB+L-<NFI-<TNNZIA? -NpNDBINB+L-<NFI-<TNNZIA?-NpNDBINB+L-<NFI-<TNNZIA?--< NNpNDBINB+L-<NFI-<TNNZIA?--< NNpNDBINB+L-<NFI-<UNNZIA?--< NNpNDBINB+L-<NFI-<UNNZIA? --< NNpNDBINB+L-<NFI-<UNNZIA?,-NpNDBI-<NrININ>`-<U(pENuE~pNu`-<UDpENuEpNu`-<U\pENuEpNu`(-<UzpENu-<QpENuEpNu`-<UpENuEpNu`-<UpENuEpNu`-<UpENuE4pNu`(-<UpENu-<QpENuE^pNu`-<UpENuEzpNu`-<VpENuEpNu`6-<V,pENu-<QpENu-<QpENuEpNu`R-<V@pENu-<QpENu-<QpENu-<QpENu-<QpENuE"pNu`-<V\pENuE>pNu`-<VxpENuEZpNu`6-<VpENu-<QpENu-<QpENuEpNu`-<VpENuEpNu`D-<VpENu-<QpENu-<QpENu-<QpENuEpNu`-<VpENuEpNu`D-<VpENu-<QpENu-<QpENu-<QpENuEVpNu`-<W pENuErpNu`D-<W&pENu-<QpENu-<QpENu-<QpENuEpNu`-<W6pENuEpNu`-<WRpENuEpNu`-<WlpENuE pNu`(-<WpENu-<QpENuE6pNu`-<WpENuERpNu`D-<WpENu-<QpENu-<QpENu-<QpENuEpNu`-<WpENuEpNu`-<WpENuEpNu`6-<XpENu-<QpENu-<QpENuEpNu`-<XpENuE$pNu`D-<X&pENu-<QpENu-<QpENu-<QpENuEjpNu`-<X8pENuEpNu`D-<XTpENu-<QpENu-<QpENu-<QpENuEpNu`-<XnpENuEpNu`-<XpENuEpNu`6-<XpENu-<QpENu-<QpENuEpENuEpNu`-<j pENuEZpNu`6-<j&pENu-<QpENu-<QpENuEpNu`-<jpNu`-<rlpENuEZpNu`-<rpENuEvpNu`6-<rpENu-<QpENu-<QpENuEpNu`-<rpENuEpNu`D-<rpENu-<QpENu-<QpENu-<QpENuEpNu`-<rpENuE,pNu`D-<spENu-<QpENu-<QpENu-<QpENuErpNu`R-<spENu-<QpENu-<QpENu-<QpENu-<QpENuEpNu`-<s.pENuEpNu`-<sJpENuEpNu`6-<sjpENu-<QpENu-<QpENuE6pNu`-<svpENuERpNu`D-<spENu-<QpENu-<QpENu-<QpENuEpNu`-<spENuEpNu`D-<spENu-<QpENu-<QpENu-<QpENuEpNu`-<spENuEpNu`D-<spENu-<QpENu-<QpENu-<QpENuE\pNu`-<tpENuExpNu`-<t,pENuEpNu`6-<tDpENu-<QpENu-<QpENuEpNu`-<tZpENuEpNu`-<ttpENuEpNu`6-<tpENu-<QpENu-<QpENuE INA>--<NVE^N^I-<-<-< NA> IA>--<QNfJgNNHI` INI-<A>-N I;|,-<pNlA>=<-A>=<-A>=<-A>=<-A>=<-A>=<-A>=<-A>=<-A>=<-A>=<-A>=<-A?=<-A?=<-A?=<-A? =<-A?=<-A?=<-A?=<-A?=<-A? =<-A?$=<-pNI-<NrININNmI-<A>-Nr-<A>-Nr і-<A>-Nr і-<-<A?-Nr  іA? IA?--<FNJgI-<A?0 IA?--<(NA?--<GN JgI-<A?0 IA?--<(NJgI-<A?0 IA>--<A?-Nr і-<A?-Nr і-<,-<A>-Nr A>- A? -  іA? IA?--<FNJgI-<A?4 IA?--<'NA?--<GN JgI-<A?4 IA?--<(NJgI-<A?4 I-<A>-Nr-<A>-Nr і-<A>-Nr і-<HA>- -<A>-Nr -<A>-Nr  іA? IA?--<FNJgI-<A?8 IA?--<(NJgI-<A?8 IA?--<GNA?--<'N JgI-<A? I-<A>-Nr-<A>-Nr і-<A>-Nr і-<A?-Nr іA?-A>- -<  іA? IA? --<FNJgI-<A?< IA? --<'NA? --<GN JgI-<A?< IA? --<(NJgI-<A?< IA>-A>- іA>- і-<A>-Nr і-<A>-Nr і-<A>-Nr іA>- і-<A? -Nr і-<A>- A>- -<A?-Nr A?-  іA?$ IA?$--< NA?, INfI-<A>-Nr-<A>-Nr і-<A>-Nr і-<-<A?-Nr  іA? IA?--<FNJgI-<A?0 IA?--<(NA?--<GN JgI-<A?0 IA?--<(NJgI-<A?0 IA>--<A?-Nr і-<A?-Nr і-<,-<A>-Nr A>- A? -  іA? IA?--<FNJgI-<A?4 IA?--<'NA?--<GN JgI-<A?4 IA?--<(NJgI-<A?4 I-<A>-Nr-<y-<A>-Nr -<A>-Nr -<A>-Nr -<A?-Nr  іA? IA?--<FNJgI-<A?8 IA?--<(NJgI-<A?8 IA?--<GNA?--<'N JgI-<A?8 I-<A>-Nr-<A>-Nr і-<A>-Nr і-<A?-Nr іA?- і-<A>- A>- -<A?-Nr  іA? IA? --<FNJgI-<A?< IA? --<'NA? --<GN JgI-<A?< IA? --<(NJgI-<A?< IA>-A>- іA>- і-<A>-Nr і-<A>-Nr і-<A>-Nr іA>- і-<A? -Nr і-<A>- A>- -<A?-Nr A?-  іA?$ IA?$--< NA?, INf`-<pENu-<pENu-<pENu-<pENu-< pENu-< pENu-< pENu-<pENu-<pENu-<pENuE~pNu`-<pENu-<pENu-< pENu-< pENu-< pENu-<pENu-<pENu-<pENu-<pENu-<pENuEpNu`-<pENu-<pENu-<pENu-<pENu-< pENu-< pENu-< pENu-<pENu-<pENu-<pENuEݲpNu`-<pENu-<pENu-<pENu-<pENu-< pENu-< pENu-<pENu-<pENu-<pENu-<pENuELpNu`-<pENu-<pENu-<pENu-< pENu-< pENu-< pENu-<pENu-<pENu-<pENu-<pENuEpNu`-<pENu-<pENu-<pENu-<pENu-< pENu-< pENu-<pENu-<pENu-<pENu-<pENuE߀pNu`-<pENu-<pENu-<pENu-<pENu-< pENu-< pENu-<pENu-<pENu-<pENu-<pENuEpNu`-<pENu-<pENu-<pENu-<pENu-<pENu-< pENu-< pENu-< pENu-<pENu-<pENuEpNu`-<pENu-<pENu-<pENu-< pENu-< pENu-< pENu-<pENu-<pENu-<pENu-<pENuENpNu`-<pENu-<pENu-<pENu-<pENu-< pENu-< pENu-< pENu-<pENu-<pENu-<pENuEpNu`-<pENu-<pENu-<pENu-<pENu-< pENu-< pENu-<pENu-<pENu-<pENu-<pENuEpNu`-<pENu-<pENu-<pENu-<pENu-<pENu-< pENu-< pENu-< pENu-<pENu-<pENuEpNu`-<pENu-<pENu-<pENu-<pENu-< pENu-< pENu-<pENu-<pENu-<pENu-<pENuEpNu`-<pENu-<pENu-<pENu-< pENu-< pENu-< pENu-<pENu-<pENu-<pENu-<pENuEPpNu`-<pENu-<pENu-<pENu-< pENu-< pENu-<pENu-<pENu-<pENu-<pENu-<pENuEpNu`-<pENu-<pENu-<pENu-<pENu-<pENu-<pENu-< pENu-< pENu-< pENu-< pENuEpNuINB+LI-<NN8BIINA> INA>--<NzEN^INNdINB+LN8BINB+LI-<PNN8BIINA> INA>--<NVEHN^IINA> INA>--<NzEN^INNdIN>NJN(&$"pNF--Nu&^$^<gD>gDv6GeB|d<NCNu/ &H6< `NBg?<NMXJ@fNQp m A@p BQNuJf.Nu m TO 0g A+H TNup$ m NAXNu g"d m PPAg dp m &<NPTBA8-g gRA`S20gR+H0& f `h/?,JN$N<,_:&&fBCgmf$fJf gJg pNF&&`,$"p NF&` JmfAPN~NC.Nup m < NC?0<><NC,m @2-bAfB@BA`0<22<&m |G"m tCJmg4< `4<2<  $IBCJmg  KfSg RCBmlBl RC` RA(|mf `| fB m @><NC0><NC,_Nu>$H&N&dRS@k(RddzQ,gnNP m0HUQ+H"m$00 R@02SGk R@00QJgk - "- SfNuBSfNu - H SfNup m EAdf$&`&"Ce C$)` P#|#a#ad! !Jfg&E"G~dN SGg<.f" p00 gR`$k$" 0g2S@H2Q`"- H$`$k$`eJ,m Xx g:k&@`" @ g(m0T(TH&LXSgJfg&Jfg. `+ILNuB - ,g+@Nu"-g~/?"AN<g`+J<g@2g&Jk^JkZf Nf _ NuNZ _!^ Nu _Jkf Nu!^ Nu2 _JgkBBNu HNu ,g+J"J`p"`p m < NC;@zN$BmBmBm;|;|NfJmgDB@>< NCJmfp `p N$0<BGNC0<NCNJmfp `p N$`.JmFg(B@~ NCpN$pBGNCpNC0<NN$+H+h+h 0-HAB60+C60+C60+CBmSC;C;|BmBm0-rAr$m."j p,2Q"jp 2Q - A$!@A( A#$m `&m \4d5|5| 5| 67|7|7|7|7| 7| 7|7|7|7|ps"- hNB0* ;@#N-<N--NBm;|-<-<BBN0-<-<N-<-<-<N m pBXQLNu oHg oIg/:Nu ABBB0-S@g jTAC^`CxRA0H>1B@g0TR@Ac;G$m `&m \46N^46N^46N^Nup m Bd:$m `&m \"m d23C3B3A645| 5|5m NLp m -N"$ m0dBd< m0;B1A;AJmgpNE#N#NJmgpNENup m p2NENup m |g|g|f\*,HNzN#g&N$LJ@g|c|g|g|gp m N"f0JEf,}p m}0QNDNpNEpNENuN$p m m 8pN#kB m 8Jg2ApN#k,L|g |f" m 8 N p m m 8pN#k m 8JfJmf m 8pN#k m 8/ -&@cNPNCp mX$Hp"Qp m m `p `p m NAXN^jQNu>g~|g8SG|g|ffH`??<NMXJ@fN`??<NMXLNu/NJd*Hz$/<?*?<?NA Jk: _Nup@`p<`p; m J-g$ m 8pSGgQN.$m 8NN&m0-԰|g8SGkZ<SF/ ??<NMXNJ@g$W.???<NM\QXNuJGg"/ /?+?<@NA Jk߫NuN$$m 8 | ~N$m 8$ ~NBmJ@g ;| ;@N g +J;|Nup; m |fH m CJfg$ \f \fB(/- ?<;NA\apN%Bmja`|f`Բ|fp ~ NCa-- HNu|fHp ~ NCv NPT$m BAg < gRA`2HaL- 0gR+HNu|f a2`n|f aD`^|d>QA??< NMT2BBBCgBgRBRC`??<NAXa m \B` Amjmhd 0a *f."m G?JfSg< geaH`B`BmxaaV"m BABBBCRA< g4fRC| fB;Bx m ~NCaN| g` m"HNuJAfH灀~pNCLNuH灀~pNCLNuH灀~pNC~NC+@rLNuH灀 -r2H@~NC~pNCLNuHJ$m @E"H4~NC0~#NC40~$NC4 I~NC~NC2H@~#NC40~$NC mfP@P@4LNuHaL4HC4Aٴ|dN02aLNuaBpBAaA:0(2(~NCN%X m A:Bg/?<GNAP m "HJf|\B~NC m NCaJmvgaNuaH?< NMT,?<NAT:BDBBBCgBgRBRC|e`XE0H0*2*~NCaj0-~rt~'NCrCfraN0*2*R@RA4BCA m @B(aRD|eBmlLaPNuHa 2amj4VApBaJLNua 0-jt BAaR@QaNuHA0(mx2(~NCBmvLNuH m Jf S;H|C0)HmzBA| er@ i~NC;|vLNutp NEp NENutp NEp NENu"""FILE SELECTORSELECTEUR DE FICHIER UP HAUT DOWN BAS PREVIOUSARRIERE DIR. DIR. QUIT QUITTER RETURN OK      #=Wi{    Jmg`vNfN/ Bmp r(;|>-|f;|JGgIEGp BZB[QGEBBBCBEp J)g6BD 1@fzRBPCAdRD|gJ1@f46Q`46 mfz;|Jmgf,0<;@mJmgmg;|;EXNpN'@0-~NC0-~NCpBNCp BNC m 8p'JmgHR@ QBpBGNCJmgpr~NC m 8~NCpBGNC&_BCAJXgBBN'\RC| eN'RNu+m mBX+H,m ,Etg jhH &NLdEQ, n$Ng$<f~`Af`ޝR` n Xg` nJg`A Pg`A ## ###NuJj-D`JDg JkD (< C:"<RdЁJgjfJDgJg`S`B0QNu;B@'d  ^"m 8C0g|epS@QB"m 8Ep Q m 8C, $m 8E. g<.g<;g <EgRR`g<.g <EgR`HgP"<#g<-g&<+g&`f< `!<0e<9b`&F`&F<-g<+`LB .fRg<;g<#g <^g,`fJBg `0`а<0e<9bR`JBkf,g <Eg R`4<`4<gR< g`G <g|RB`vB-BNuE+000 t$^4"J m 80S@k|e0<QBNuBBBC NN< d$2 H@ H@J@f ЁeЂkRC`,HrNuSJCgBANurNuBBBBC NN< e <eB<d鈀RC| f,HrNuSJCgBANuBBBBC NN<dReRC|!f,HrNuSJCgBANu,HrNug< g<ae 0Nu<NuHBp NEp NEpNEpNErpNEpNG<-A~0NCRF|fA~NCLNue"H0g'"SfJg"SfL Nug&SfJgSfNu/Ng:|fJmf6BNѭ$m&J+K& N &B@Nu&0<NupQ m ACEG??JAjBAmdJBjBBmdJEkgme:-JFkgme<-AexgvBgrep0_@gGgCE0_@mlLmlFJCj0BCD@@e8g6@JDj0BDD@@e&g$@0Eme@g0Fme@gpNuXpNu&-+C CpNE C~NC -+@+@?                    ,(((".(.( $                                                                                                                                                                                                                                                                                                                                                                                                                     ((                                                2T$">,*&vd@>T2((>Jt  "\ d "Z(:    ^b* (($*HZx >h8 @ 2FD.0&(  "&&*T0$ 2"(  J> ,<F& (LNr^"nF0jVlxF@Z &:"*Hx$0 FZ4D TTT2T4f7x<=FGHIJKMNOPZ,dinsxHNzPxr"bbbb"b'x,16@J@Th^h 8\!F!!"d""#*#j# ##$$$$&$'%(&Z)'0*(0)1+2, 3-:.;/&<0D=1>D28E3JF4hG5bO6\P7&Q7R8X9Y:Z;[<b=c>d?le@BlAmAnBoCvDdwEvxFyGHIRJ(JKLNNOPQRbS8TTUVWNXXYZ[\]]]]]]^j^__<__`h`aa:a$a%bf.b/c8c89cBcCddLdMeVe6We`eafbjfkg tg4ug~gh`hhhhhhhhi(i"-i\2i<iFj PjDZj~djnjxk,kfkkllNlllm6mpmmmmmmmmnnDnjopr,r<stv(v2@vJvTv^vhvvvvw&w0wx,xlxxyyzyzzjz{ {Z{{|J&|0|:}:D}N}X~*Y~zZ~[2\]b:lJ^z0Zv:V  !R"n+,-.526N?@AIJ SfT]^_g8hTipqr{ |&}BzL,HR2N J f     8 %~ / 0 94 :P ;l < C D E M" N> OZ W X Y a b kd l u v ( D  \ x .  T p  4 z     Z v  ! ), *H 3 4 5 = > ?6 Gn H I J Q R [N \j e f o p. yt z  F b ~ & B ^  h , H d  6 |     $ \ x   # $ % -J .f 7 8 A B* CF Db K L U V W& XB _l ` a i j s> tZ uv } ~   : V  ` | 2 N  X t * F   & ^ z  ' ( ) 1> 2Z ; < = E F, GH O P Y Z [ cR dn e m n o w2 xN  X t 8 T p  4 l  " Z v : V r   ( !n + , - 52 6N ? @ I J SX Tt U ] ^ _ g8 hT ip q r s { |4 }P ~l   Z v  d ( D ` @ \ f%&/80T1p9:C D&MlNWXYa>bZkluvd6R˜´\xÔ.JĐFŚŶ   4l !"#0)L*h+DŽ,Ǡ-Ǽ3456,7H=d>Ȁ?Ȝ@ȸAGH I(JDK`Q|RɘSɴTU[\$]@^\_xeʔfʰghio p<qXrtsːyˬz{|}8Tp̨̌4Pl͈ͤ0ZZZZΚξ.>XXBr h"Ҙ#.$^%ӎ,-`.Ԑ/67hւֲ*ר P :ق0`ڨ۶zݮH|J~ Lpz#(#2D#<#Fpic.pi1,abc.neo, rscreen.neo,mIt is pointless proceeding unless you have read both READ_ME.DOC and READ_ME2.DOC Yes I have -> Desktop Show old file:Create new fileoType your name or other ID. Maximum of 8 letters. Don't use spaces or punctuation;Illegal filename-try again.CTI!Input m for male and f for female;mMfFBefore commencing the questionnaire, please check that your disk is not writeprotected, and that it is present in drive A: while this program is running. Click on 'ok' to continueOK(700,5)(000,5)(421,5)(000,5)(070,5)(000,5)q CALCULATING:(000,20)(700,20)fF RS232 PORT PRINTER PORTauxprt2Characteristics expressed in Standard tens (STENS)warmth intelligenceemotional stability, dominance, impulsiveness, conformityboldness sensitivity,suspiciousness imagination, shrewdness insecurity radicalismself-sufficiencyself-discipline,tension, extravert,anxiety, tough poise, independence leadershipI must click on one of theboxes labelled agree, disagree, or in-between, andthen click on confirm.I expect I shall send my data file to the author ofthis program, for a professional evaluation,It is nicer to have neighbours than to live inan isolated place.I am an energetic person.,Sometimes, the worries ofthe day keep me awake atnight,I try not to criticise otherpeople's judgement and tasteI don't mind insultingsomeone if they deserve itI don't mind telling jokesto an audienceIf my two neighbours werearguing in the street, Iwould let them get on withit, and not interfere.People tell me that I am aborn organiserI would prefer to buildthings rather than writepoems.I am more interested in artthan in politicsI get annoyed very rarelycompared to other peopleOne can judge people quiteaccurately from their appearance.,The working week at thisstage of civilisation is far too longI enjoy an occasional bet or gamble.I would prefer to playa good adventure game thana computer arcade game.,I sometimes lose my self-confidence when I amtalking to someoneI don't get worried ifsomeone doesn't like me.Money cannot buy happiness.,I always consider otherpeople when making any decisions,I like to join clubs andto take part in club activities.,I don't like to makeplans too far ahead.People tell me to slowdown in my day-to-day activities I never sulk.,I'd rather be a lighthousekeeper than work in aTourist Information CentreI would prefer to bean astronaut than amarriage counsellor.I've not had a great lifeso far.,I've got very strong willpower,The Royal Family does a good job.,I don't like to have tomake quick decisions thataffect other people,I like to play the clown occasionally.,I am a tidy person.,I don't like to be thecentre of attention,On a train journey, I would rather talk to afellow traveller thansit in silence.,I would rather go to ArtCollege than to TechnicalCollege,Never trust anyone whosmiles for no apparent reason.,It is better to bespontaneous than to thinktoo much before doing, something.I would rather lead than organise.,I often fantasise about my future.It is important to bepolite.,I get depressed when Iam criticised.If my boss/teacher asksfor me, I am usually pleasedrather than worried.This country needs moredo'ers and less thinkers.,The media in this countryis politically biased, evenwhen it claims not to be.,I don't like to play team games.,People think I am stubborn.,I have yelled/screamedwhen a loud noise has startled me.I wake up slowly in themorning.I would rather be an Arcticexplorer than a holidaycourier.I like to sell things.My friends neverdisappoint me.In a foreign restaurantI would eat any dish, evenif I didn't know what was in it.It is best not to show itwhen you are upset., `See the funny side` is a good motto for life.,Rules are for the obedienceof fools and for the guidance of the wise.,You should respect yourelders and betters.,I find it difficult tomake presentations to a large group.I would rather direct theefforts of a team than work with a team.If someone became angry withmy actions, I would try to calm them down rather than get irritated.Newspaper articles couldnever move me to action.I am not very good atremembering trivial detail.,I would rather be a farmerthan a bank clerk.People say I am absent-minded.,It takes an awful lot to get me down.I sometimes get excited inmanner and voice, to theembarrassment of my friends.I would rather be a playwright than a policeman,given the same salary.I have a few, close friendsrather than a wide circleof acquaintancesSometimes, I wish people would just leave me to geton with something.In business, one cannottake people's feelingsinto account when makingimportant decisions.I often daydreamPeople tell me I have atemper.,I would rather be a technician than a salesman.,Sometimes, I have offendedsomeone without realisingit until later, when someone else has told me.,People in general are notvery sensitive to the feelings of other people.,People who belch loudly inpublic disgust me.in conversation, I am alistener, rather than atalker.,I am at my happiest in acrowd of people, or at aparty.Whatever you achieve inlife, the important thingis to get on well with other people.,When arriving at a party,I feel quite nervous to begin with.,I don't see the point inengaging in social chit-chatI prefer to read a biographythan a romantic novel.Increasing crime is largelydue to the abolition ofcapital punishment in this country.,I have a basic trust in human nature.,The trouble with societytoday is that people donot set high enough goalsin their lives.,I only enjoy thoseactivities that have somesort of point or purpose.,Ambition is more importantthan friendship,Some days, nothing seems togo right, and then I getvery frustrated.I suffer from feelings ofguilt more often than theaverage person.,I like to know for certainwhat I shall be earning from month to month.I wholeheartedly look forward to going out socially.,I would enjoy working as anAgony Aunt on a newspaper.The detail is more importantthan the overview of aproblem.I have been told that I aman irritable person.I always sleep soundly,whenever I wish to.,In business, I would enjoydealing with people morethan I would enjoy keepingaccounts and records.,I never bear a grudge.I can block out externalnoise when I am trying to concentrate.I would never argue withmy boss/teacher.I don't tend to enjoysocial functions.,If I get into an argument,I usually seem to lose.,When dealing with problems,I usually plan aheadrather than think on my feet.,I find it easy to talk toa wide range of peopleabout many subjects.I am diplomatic and persuasive rather thanblunt and to-the-point.,I would rather be an actorthan a building surveyor.,If people's work doesn'treach my standards, Iwould usually tell them so.,I think I am good at gettingpeople to help me, withoutthem realising.,I enjoy the theatre, opera,ballet, and so on.My memory and concentrationare not so good as mostother people's.,I am not particularlyinterested in talkingabout emotions and feelings.I sometimes get a feelingof dread for no apparentreason.,I sometimes get depressedwithout due cause.It is a bad thing that Britain lost its empire.I am always very fashionablein the way I dress.,If I have a question atwork/school, I would ratherask someone than look up theanswer in a book/manual.I sometimes feel sorry for myself.,When under stress, I havesuffered indigestion orother physical complaints.I hate routine.,Given the same salary, Iwould rather be a solicitorthan a farmer.Despite looking forward toan event, when the timecomes, I often lose my enthusiasm.,On the whole, I feel thatI cope with life veryeasily.,I will speak to someonepassing me in the streetif there is something tosay that seems worthwhile.My life could be more exciting.,I don't think I will everfully grow up - I enjoybeing childish occasionally.I like to keep busy as much as possible.I consider myself to be an extravert.,I make friends easily.On TV, I prefer to watch acomedy than a current affairs programme.I would rather paint apicture than paint a room.I consider myself a verypersistent person.There are greater rewardsthan money in some jobs.I would rather read a novelthan an article by a radical politician.,I would prefer a packageholiday to planning a foreign tour as I go along.,When I have to be somewhereon time, I cannot relaxuntil I get there.I specially enjoy solvingproblems created by other people.,Society should adoptscientific principles, andnot look to traditionalbeliefs to solve its problems.I am a non-conformist.I have sometimes feltjealousy, and acted upon it.I like to impress peoplewith my memory for detail.I worry about the future.,I can take criticism.,I would rather be a photographer than a politician.,My dreams are quite vivid.Even if something appears tobe a bad idea, it is stillworth trying it out.I am proud of my achievements,in life,I would not like to be famous.I have a hobby that Ienjoy on my own.Generally, I do what I wantwithout too much regardfor other people.,I have strong principles.,I would never talk to astranger unless it was necessary.I enjoy seeing pompouspeople get their come-uppance.I have always preferredstudying English rather than Maths.,Born-again christians irritate me.I find that most people areinteresting to talk to.,I don't always speak upfor myself when I should.,It is important to bepolite, even with ignorantpeople.,People seem to regard meas a solid shoulder to cry on.The age of chivalry is dead -and good riddance!Progress tends to be a bad thing.I find it easier to followthe written word than the spoken one.,I like to push rulesto their limit.,I won't argue a point unlessI am totally sure of my facts.On occasion, little thingsstart to niggle me.,I usually put my brain ingear before opening my mouth,,I have collected money forcharity on more than one occasion.,I wish I was better at avoiding hassle.Look after number one issound advice for life.A little danger is exciting.I believe in doing things on impulse.,Variety is the spice of life.,It is important to keep to a moral code.,I have been described bymy friends as a conscientiousperson., I am shy.,`Pen` is to `write` as `Spade` is to: [a] shovel[b] dig[c] forkWhat is the next letter inthis series: a..c.._..[a] d[b] f[c] e`Mouse` is to `cheese` as`horse` is to: [a] nosebag[b] hay[c] milkWhat is the next numberin the series 13..16.._..[a] 17[b] 19[c] 11`Quiet` is to `whisper` as`noisy` is to: [a] scream [b] shout[c] talk`81` is to `9` as `25` is to:[a] 5[b] 125[c] 16Which of the following wordsis the odd one out?[a] hat[b] coat[c] hood`Big` is to `tall` as`building` is to: [a] house [b] small [c] kitchen`Butcher` is to `meat` as`compass` is to: [a] point [b] north [c] directionWhich word does not belongwith the others? [a] curve[b] bend [c] corner`Page` is to book as `leaf` is to:[a] tree[b] twig [c] trunkWhich word does not belongwith the others? [a] ladder [b] stairs[c] ramp`rqp` is to `STU` as `fgh` is to:[a] IJK[b] ijk[c] KJIThis is the end of theCTIPQ. I have answered allthe questions as honestly as I could.,*.CTI, CTIPQ Response File SelectorKPlease write-enable disk in drive A: Press a mouse key to continue.YPrinter not ready - please check power and connections. Press mouse key to continue.>P>T>X>\>`>l>p>t>x>|>>`/`Window 102** %$%pb)$.F&zV!*t'(z-%%<*:!!2!D!x) (PPP(PP((#|"##&&#X## n#%B%H%N$*$l$$$^$z%V&%^&.'J$!$*.CRH~#3K cf2* cf(* cf*3ֱd/a _pL~Nup`/<?<#?<NMPNu3By yN# yV#t!|3xNuJyxg yV!ytNuH~OK,up(yJupg8aHpNELNa./JygJyfp)`pNE L~NsNL~Nspap@aBC:,2JEg2,RCl6mp a.p a(JEg2,gHAA9A2JAg*l8l:l4gel6geHADybEybBl0alHF0a*69:Cydx3$y)JH#By09AVA aZa taFa By~0,2ga8a Xa<09.9#3`Ha /a Nu2,2g@f09@2?,?,?,0Bl03a (BlPE0,2S@Ha22,4SAa&QaR@86,6SC:<B@2a <a0,B@BAa?,?,a>,? 2?,0Bl0BlP$H:,<<,>BCBBJyg 8B`(HD fDf a`Gga>aDRBEeRCFeBy9_08a02aRNu/9~,9A0`4l<yb 6l>yb4,8l@6,:lB9@@B9@89ABC9A:aXaB@NuH9DJygLL:LE`:LDE0a t0a 4LNu309`By@.9gP#3IL$lH&J4,<>•yIL6<.9g>Hf6)JH8,<>LSD4Q0,2,a)HL)ID`RC CfA290B02<J0g0l0QJyf aa09ڰyf$3AB@ gR@ @mByB@Nu @fAB@ gR@ @mB@`^0<`20<`*0<`"0<`0<`0<` 0<`(yNu09Nu9Xp"R@ @m9|Bl Bl.0,9@,@9@*9|Nu0,9@,U@9@*Nu0,9@,HR@9@*Nu3Nu3ByNu3Nu yfXJyfNJyfDH(yJlg.lf$9l0, R@ @mB@9@ 4"aLNu3H2,*"lD.9N<,,l*SF:9SE6KGR8,SD0yJkXaJl.g2$I4 0*NfxTJTMQBfSJQQ9|.`8Jl.g02$I4 0xTJQBfSJQQBl.LByNu<>JyfJl2gRFRG9tp8tp:><NVF"yNuMVJyg* yg@H@`@H@`@H0, gNuaJ,l8, g,l HB80Ȱyg0 2DgSDgSDLSD:lSM29SASC<9>,4SG4 :&Ig0$NTJTKQSKJDk0$N6QQg0$NTJTKQQQ`H0HS@Jyg" yg<HF<.`,.`,.""QLNuSCSB8,<Jyg"0,@@ :$H4QQ` ,@ :$H$QQNuH?4,4B@va~a2aBaLNuH4,46,6B@BAaValBAaRAl6fa aLNu?0,4S@atJyg2,A02Nu2,HABA 2Nul4dl6d a B@Nu0<Nu9@9Aa)HL)IDNu0,H@0,Nul4dPl8HNul6d,4SGSEJyg8$H4 QQ`8$H$ QQNuH Ag(:B@BAa:4,<<69>aLaDGDCaX`0,29R@t4g 2,`a~`F0,g 2,S@`p0,4S@9@`0,2,gSA`PJl0f\2,6SA`>092,RAt6g 0,`"Jl0gSA`0,BA` B@2,`a`BlJyk3/<a Nu9|JlgBy9| yg/0,a Nu0, 9@Nu0, 9@Nu0, 9@0,a)N 0, a)NNu0, 9@`0, 9@Nu0, 9@Nu9@>JygGOOl` lGla)N Nu9@ >JygGOOl?`lOGlaJ)NNuB@` p`p9@PNu9|0NuBl0Nu0,2,`l4l@l6l8aB@Jyg8D d< Nu(HD d< Nu0,SG6y8lSL yfl$I: FJf.UVhQQ gZAlBG` fUhQ`UVhQ` yf$I4 : vFJfF]^hTJQYMYNRHSEjQ gAlBG`SJBfUJ` f]hTJQ"`]^hTJQ `$I4 : vFJfF]^hTJQQMQNRHSEjQ gNAlBG`SJBf]J` fUhTJQ`UVhTJQ`(y0,29R@t4gn9@ yfB0,ѬDL`DJyf L` L29SAI ,D4,SBgAR@Q)@DLNua a`H`hBz ( `f#zNu3~0X` p lLJyg 2,B0Nu2,HABA NuHJzgS@@ yzXd yg*H?,?,a:aaa20abLTABh0,l@2,lBJyfJl2gR@RAHE4, 6,8, gC1B1C g,Gt)6QGG tSXQAJg H L/9N#N #NLNu>< y"yN""""""""""""""""""""""""""""""""QNu h&  $ "    @$4 8 HL B:   6, Xf B    f6 d 8 8d"N8 dJ ":z<$0L  ( `8>FL @ &N ,c  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~lll6666(>h<&|(fl0fF8l8tv00`00000 f<f<0 0`0 ~~0  0fff~fff<< xflxpxlf``````~|||ff|```|v|ff|ffffff>ff>|``lvfff 8``flxlfl|ffffff>xl```<`<|00<006ffff>ff$<ll8lfff>|~ 0~00p008  8` $$B~<``<Bffff>f;f<>f;p<>f;<~;<``<<pffff>Bfff>|B<@@<4Xfff4XbRJF<>f;< |)B*R$HH$H$ $H4X<~;4Xc~~~~Ɵ|~~c>  UUUU3333*@\z:Lft &lPZNYMXTYMXTXMULYMULXENCREc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~fffllll>`<|fl0fF8l8pvp88pf< 80 0 ~~`0 0```nff>fff~fff<<f<flxpxlf``````~fv~~nfffffff<ff<f>``|fff|<```<>fff>ff>|``|ffff8<p``flxlf8<|fffffff>|f```>`<|~ffff>fff<|lf<|~ 0~0p p` 44b~f><>f>p<>f><~><```<<pffff>ffff>|f<``<:0|00~ff<<6f|ff|`0|000` <~> 8< 4X|fff4Xfvnf<>f><000| 6kÆ6n֟6ll6l66l4X<~>4Xc~~~~Ɵ|~~c>UUUU3333 )f )fc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ffffffffffff>~``|>~|ffl 06ff8|ll88ppv  `0880`ff<<<<80 8pp8~~~~p88p<~ff 8|~<<~fff~~ffff|~ff~|ffff~|<~ff````ff~<x|nffffffn|x~~``||````~~~~``||``````>~``nnffff~<ffff~~ffffff~~~~ff~<``````````~~fffvv~~nnfff<~ffffffff~<|~ffff~|````<~fffffffj|6>~``p8~|~~ffffffffff~<ffffffff<<Ƃfff<<<>~ff~>```|~fffff~|<|`````~>>~fffff~><~ff~``~>~~>~ffff~>~|```|~fffffff88<< |x88<<l<~fffffff<~fffff~<|~fffff~|``>~fffff~>|~f``````>~`p<~|~~fffffff~>fffff<<Ƃff<<<~|~~ 00~~880000880000b<$fB<~ff````ff~< 8fffffffff~> <~ff~``~>>~ff~>ff<>>~ff~>`0<>>~ff~>6<>>~ff~><|`````~> 8ff<~ff~``~>`0<~ff~``~>ff88<<~`0fffffff~>ffffffff~>~|ff<~ffffff~<ffffffffff~<<~f``f~<80000000ffff~<~>~ff~> 88<< <~fffff~< fffffff~>2zL<~fffffff2zLffv~~nfff<>>~ff~>~<~fffff~<~00ff~<~~```~~` #&,0n ` #&,2f2?6ll6l6lذ2zL<>>~ff~>2zL<~fffff~<=~ffnnvvff~=~fn~vf~~~~`0<~ff~~ffff2zL<~ff~~ffff2zL<~ffffff~<ff |zz |Ƃ||Ƃ|[_UQ???<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOLHO?NNNNN.??>|>??| !!& d&!! d  #'ONNNNN0NNNNNNNNNNO&#NNNNN `00```00    00```00`8~ߧL<<<<~=2<<<<<<<1u=.1+yN' N)N! 1c u1>!a}' a' EqXhq uluiuuukG|qzvSpBuff mouse.spr@PH~## f^# ,H#b#^3\H#f#j @d,SFBQ/aP _pL~Nup`6:A(BABHBBBHBNuxAvCNBGRESEgJPfBQQNu<h dBi` hl3F<( hAd3h`hlDFh3F<h dBi` hl3F<( hCd3h`hlDFh3F<( i@3F"ii3FD<( iB3Ffii3F2RG`>ByVA:ANu?a2BJPg>8(:BdBDB<(>CdBFCBBAPAgJPfRB Bf3VNuhbheܼhb־he`arBBJPg0(@2(HA2(A3VNuJy f>0:2:4:6:zaJJGg"E0HCAJQfJGfNuSGH>:$h&J(z0(@0(i@0:fi"@0)Di"U@:@T@2)ifSA6:(<<E2:P@A3 JEg2)̲hfS@2(@A3 3 Jiga L`:0:S@k>g0z2z2:JEg^> fxp` 8*0+JGk80T\Qg8 8T0\QQNu0zR2zP4:NJEg|> fxpr`8*0+2+JGk802T\T\Qg 8 802T\T\QQNuJEg2C> f xprtv`8*Q0246JGk280246T\T\T\T\Qg8 80246T\T\T\T\QQNu$yNJy f6"z<:v>:SG2:4:a`FCSF04QQNuJy f:2:\4:\$z&a>:.4:PBCSB2:DSA&z06QQNuzorz l4:zl`zo89 zoNzl6:zl>zo::3 3 3 3 <>B3 C3 By Nu3 NuH@<`(H@JgByVBy ,` HBy ,BBD3 A@# (J@jLJPg`BPJy ga4( 6( 8:hhaaJy ,f(1Bhh6agRCJ@gZ @xlREmL BlD3 3 3 3 "3 &3 $1@ 1A1B 1C1D1EJPf0`hgJy g H aL04:̴h m4( 0( h2:z@l8`86:h m6( 0( h2:z풲@l:`:aJHzn(<(6GcaaHaa`R4( 6( 8:hhaaaaad4:6:8:zzaaaa@p`B@3VLNuBy ,B@`aJPf 3VNu4HA62ABByV3 ,B@aJ@fhJy fFH y (C<0:v2:t4:r6:pBDBGa y (Ca$z"aaLB@By , zTBP3VNup`ByV3 ,B@ABaj y (BPJ@fJy f"h$I0(H&J2(zf4(zf?(z6(fSB6Q`BxC::SEUASB<>MTB0,Q>MB 06,QQQ8hSL>(SG:z:6j0 2QQ` y g6< zBA&J$KBDBB0 g RDff Q2QQ`Cg&I0 6QQ>B@Nu0 8LD&I(J8D DNuJy gJy fJyXj?<%NNTNuKEI.BB|64<"MBAxJQgilig m &LBE4)6RERAQf SE4SFQ`JFkr4QNu0HANu3 BNu3 fAp0QpNuByVaa aVBNuABCDJAk`Ac.azFd z>e3 2az,e z(d3 Cc$zd ze3 ze zd3 BNu3 3 3 3 `ڱf zNu# NuByVBy?<NNT3 g* @g3 3( `"3 3( `3 3 3( 3 09 @(3 0<X y f@3 a6By a@aaBy a Ap2<BQQBAa\a@BCa 2<a p3 yPBP3pNu8<0a8žDOdRSESF0:S@k.g04QQ` $QQ` $$QQ`~0S@@LSESF0:S@k.g05#QǗQ`J %#QǗQ`6 %#%#QǗQ` f0AzFef$Ha&JL$Ia4:J(CSFxGgd:ESMgSM0:g @gf K"Jg0H@B@::g& Gg>4QQ` >$QQ`>$$QQ3VNu$DU5(C44K:IABIa랖E.KSDSE0:"g* @g<2QQ` <"QQ`<""QQ Nu DU5(fLA:<Qi680:HKMJAjrUdJBjtVdJEkgUe:JFkgVe<AgkޜBgkDCADDB0HVH:@0HKCDLXAIBa,K0\QQ`^&I(J>028AFDT\T\QQ`6&I(J>02468ABCFDT\T\T\T\QQpNupNuBy f3 # aBNupNu/?<&NN\Nu <+`#-NuByVByBylBy 3X 9.# ޱfAb#PBP yV# 730:HA20SA3b20SA3d y# ,bNuJg yV Ӹ zԔ ӴNu???/  f"zv@d)Ag3@@((f`H0(HA2)(HBJ@lB@` zچo0:ڀJAlBA` zto2:n23A"_420NuH?~HM,VNL~NsByVJAf 3XyXk@f<3Z3h` ByVJAfByXyXd 0<a3VBNuByV3h3j3Z3V3ZBNu z:0z٠2(zٚNu z&0(Nu 9Nga `ByVAC~|JQgkJPf|02)g1A4)g hg|1B6)gV$zܲJy gP8:ܮL 2@gB&@Lr@ b41CKE0!KBD1D1D1D1D` JhfBP|BQACRG GfZ0:PgJFga:۲$h&J0(@0:ۺh 2:۶h AH0:ۤ:@UM2AK3 :(|EJEg2( hzpfS@2:^h g2(@I3 3 6:DSCaBL`zC(xBABBBCJQg f0a~CRD f3V3ZNuByVNu zJCf,BABB6<8< y gJy fKLSCSDByV3^3`AB3b3dK0L1D3VNuByV z\zIJzd0zָzָd1B3VNu0< zޜBBQNu zގJAg AdSAICdEd 0000BNu <Nu AdaRJPg4(6("zH2<JQf PQBBNuQeigdieigdDAABNug& g 0m 9b><Nu ae >EB`:By NuDBJy f A^B`AFTB# 3 3 3 NuByA0<;BXQAB0<YBXQA0<BXQNuByAgMSA4 BVI*z(MBn-MBn 6<a (fOMˌ>,K̬ INupAgaaKH@aNuJUgr2- 0HH2-AANuJBfBVNu BfVNuVNuBCAf `rvan,LBya Q`vAf `rva@,MByaQ`Ag?a2a2BC` aarvaByJBf V`<Q`jAgxaByBft=BCfv=C=D<`03NuJyf(zv`fNu3 3 Bf ?aa43 Nu(zF::g~y fr3Ӵ By A^"yNC}x g> 0@w2Aw@g,vH@HAtJB@BA陰AgbR@`S@@Q0 UUQ3 >:g^Byl<SGAE@0f6Q3l`6(f2(0fBA0BI5IRA AeBA1A`0:g(y f3 z0:20UHQ00:.g0:*k ByVa0:ȸg0:ȲgByACEȞ~JPg ^,VG63G83BFGB[BBRFFgB:ôEg64`"HG&GK:GK:GK:K:G:<4|(K <`(KpB>9޹#,GREEgB>Ĵg4G> I:G*H>3ANu0<NuH0M .EFABa$I A=A2a٢&J24ABa$H A=A2aـ:9 09 H=@ :ESMM8EL<=A=A>=I=I 46.8. J"K2: H0g0 `0 2QLFe Qx`GSDjxSBg Qv` 0.n d0.n SnfBNuByV͝Jg PbE RI:r09 HI>42(A<9 N:9 8LSE$H&I 2H@6C H402g`6Qͽeg`3VNu  0fL&p@b&  $ (h0 "  @    8  Ɯ0    : ApJ0gS0fQ3FGI4:gyDdydDzgB<:tf Q3H`,f2PAt2ItRAta`M|$zzJVgVg MQ`vK6.:20kJn g@ gJ@`@BDgz0 D`eBDLA0@0@4J   g@RBA0HAb<=CTC=C0Jng(Jn f"Az00@p@gHfp;@ mB@aJng4K mB4`B@a`Mf Jn g n g =n`BV`gE?420H JXC=CJfKH;|a8`0 f=|K ;|a` f=|a` fBA20=A =B`zgr020TC=CE Edn2VAJfBn `H f=| `2 f `$ f@?@ g@ gaf` f2KHBU` f2BnBm ` f2BnBU` f@A``KE|g-eKQ3: zN-d0f0 @gZ24YmY9HghHtR@A`THBA4mjBA` 2c2g0P@A`$BA,mjBA` AcrAA-fP m-0ka`<gB@a`.B`(+HB@p20;AX@B-Nuan cifb#JX3BByDBAM0g =@=@=@=| <BnBnMRA Af#>3:NuBy:ByN3F3HBCp5BQC\pSBQp C.BQI$|8Gt Bf a` t QNu,?@NuAg&SA0:3FAFAPAB(NuAgSA0:3FAB0NuByTb0.0000000 BAD FLOAT TRAP Hz?<&NN\A8NuA #NuHk C"qNJg@CL"qNCNsJgfpNspNspNs&<B(<4VxNs/<B/aXP//<HajP&(<4VxNs/<H/a2P//<BaDP&(<4VxNsv(<4VxNs//aP"<4VxNs//a4P"<4VxNs//aP"<4VxNsJg//aP"<4VxNsNsC/ rg < gQBB)aX"<4VxNs4Vxg/Cdf  _SNsH| ##JEf2JDk.|ex?//a>O JDf (.fB L>Ns<Ae?<`<1e?< `?<Hz/aO "@ -fR I 0g,g<.fJEfpdH<eNs4UBe0|p H?Hz/:aO A"z -f.E2jr`|erg <.gSAfBJDjAg <0g$H`"JE+0< e )B `0B zp L>NsJ@g BBvAb`BC4\?Hzq/:LahO Aa"z8 -fEg<.g<0g` Jp02jr`|er.EJAgg <0g$ISAfJDj"JJCfBE-0`>/a .XNs/a X"<4VxNs//a PgpNspNs//a Pf`//a Pm`//a Po`//a |Pn`//a nPl`/a#aF./9a jP"<4VxNs "<4VxNs/a*X"<4VxNs/a X"<4VxNsNVH..a LN^Nu//a P"<4VxNsNVH..,. a LN^Nu/a X"<4VxNsNVH..a LN^Nu/a X"<4VxNsNVH..a LN^Nu/a X"<4VxNsNVH..Np LN^Nu/a X"<4VxNsNVH..a LN^Nu/a.]B/a ,P"<4VxNs/a X"<4VxNsNV/..N .N^Nua "<4VxNs.//a P@//<Aa Pf//a P/aXNupNua//<Aa P"<4VxNs/a X"<4VxNsNV/..a .N^Nu/a# @.a./9a P/<B/a >P"<4VxNs/a X"<4VxNsNV/..aZ .N^NuNVH-n Jnnp` nop`0.R@8BGB/.N (Pl n -R /.NX-@B/.N (Po.`/<D/.N~P-@SG/<A/.N (Pm`/<D/.N FP-@RG/<D/.N (PlG|0H/N fX-@`/<D/.N FP-@RFDm/<B/.N FP//.N P-@/<D/.N (Pm -|ARGJGl4 n 0R n .R JDlD|` n 0R SFGnBF`j/.N X:0@0"n R Gf n .R 0H/N fX-@//.NP-@/<D/.N~P-@RFDm n BR .JLN^NuNVH KIBnBn`R n  g n  g n -gB@`p=@ n -g n +fR`$ n .fRn` nJngRnR nJg n eg n EfB n eg n EfDR n -gB@`p=@ n -g n +fR` nR nJfB.a-@.N=@Jng 0.D@n`0.ܐn=@/.?.a:T/N~P-@.N -@Jng .JL0N^NuNVJnl,-|A`/<D/.N FP-@RnJnm`*-|A`/<D/.N~P-@SnJnn .N^NuNV-|`D/<D/.N~P-@/. nH@H/N fX/N P-@R n 0m n 9o .N^NuNVHB/.N (PfB`B/.N (Pl/.NX-@z`BEBG`RG/<B/.N FP-@/<A/.N (Pl`SG/<B/.N~P-@/<@/.N (Pm/<Y/.N~P-@/.N X-@ .-@G@0@HJEg .JLN^NuNVH..,. N LN^NuNVH..,. NLN^NuNVH..,. N LN^NuNVHJl| .D-@`BFJfB`^~` .-@R .f` .-@S. g .-@@ JFg .JLN^NuNVH .<JgJFlB`V .:|oJEg <` <`0..F`RFJFm`SFJFnJEg D. JLN^NuNVH..,. N LN^NuNVH..N LN^NuNVH..,. N LN^NuJj Jjf NufNuJNuNuJg NugR kjklf`>k^g>k^g2k8<d,&B<ރeNuRid~S<Nu.NuJNu<oD&B<ރeNukgvgPk<<d&B꫞kBSbHGއ[kgNu~Nu<oD&.<`DgjD`JfJ<NuHFHG`k~Nug(gvEDiBHGHFFkTiHGDL&:ƞHGHF6BŞd&BރSE&HCBGHEk:څS>:.gNugRghEDvi^E]HE:BB8HD&HC؃HF&؃BDHDHGHFHEބj gNuSiex@ބއdRgNu~NujJ<NuNVH*nBGBF`RHH @ +fR` -fRRF` H@G 0m 9oJFg0D@>0JL N^NuNVHJl| .D-@`BFJfB`^~` .-@R .f` .-@S. g .-@@ JFg .JLN^NuNVH .<JgJFlB`V .:|oJEg <` <`0..F`RFJFm`SFJFnJEg D. JLN^NuNVH..,. NR LN^NuNVH..,. N$LN^NuNVH..,. NH LN^NuNVH..,. N LN^NuNVH..,. N@ LN^NuJj Jjf NufNuJNugR kjklf`>k^g>k^g2k8<d,&B<ރeNuRid~S<Nu.NuJNu<oD&B<ރeNukgvgPk<<d&B꫞kBSbHGއ[kgNu~Nu<oD&.<`DgjD`JfJ<NuHFHG`k~Nug(gvEDiBHGHFFkTiHGDL&:ƞHGHF6BŞd&BރSE&HCBGHEk:څS>:.gNugRghEDvi^E]HE:BB8HD&HC؃HF&؃BDHDHGHFHEބj gNuSiex@ބއdRgNu~NujJ<Nu/./.NP-@B/./.NP/NPl/.N`X.B/.NPlD/NX-@ .JLN^NuNVH..,. NTLN^NuNVHJl| .D-@`BFJfB`^~` .-@R .f` .-@S. g .-@@ JFg .JLN^NuNVH .<JgJFlB`V .:|oJEg <` <`0..F`RFJFm`SFJFnJEg D. JLN^NuNVH..,. N LN^NuH~,<AB'ebc FGNCD<c|`8|*< Art`ڄܐ(&䣞j.XRQN .Jg .<ANJgL~Nu/Npi /,.<AN,NgSh~L@Nu/Npi*/,.<AN,NgSh~,.NL@Nu/Jg0Ri0Npi2/,<AN/./N,NX,Nu.<`.<A`Jj Jjf NufNuJNuJj a<NuNJHNL8Np?<`$?<`?<`<bTJNuBgJk<8cH~$<cP<c <L~TNu,<>.NXDxB΄,<CN,.N$(< .BJkFD<c~䯾o$`D<c~DDl`z,k^g>k^g2k8<d,&B<ރeNuRid~S<Nu.NuJNu<oD&B<ރeNukgvgPk<<d&B꫞kBSbHGއ[kgNu~Nu<oD&.<`DgjD`JfJ<NuHFHG`k~Nug(gvEDiBHGHFFkTiHGDL&:ƞHGHF6BŞd&BރSE&HCBGHEk:څS>:.gNu<Jj~`~<L~Nu.<AOJNuH~?g$,<;ANi`D<o< l",k^g>k^g2k8<d,&B<ރeNuRid~S<Nu.NuJNu<oD&B<ރeNukgvgPk<<d&B꫞kBSbHGއ[kgNu~Nu<oD&.<`DgjD` p|T0@6D,6 :"P :   < *80 ( J X$ fBJ|, ((T *6 *8??ǀ? `?qQ'<q"'9!"(9q?K/"$(b( "(`" K>?BH""$( ("/BǞ?A"qȞqǜpG'A?<<`??08p <xxp @Ϝ0cɟ6`s ρ0~Ϝ0c3 ?p3> ϟ0`Ç>>"""""""("("(*** """"'"'"'"""ppp"""r r r ?????<``?``8LJLJ8xχχ0xxp<><><>|<|<|<<<<88|||<|<~~Ɓ9<<<<||   <33330ffffffffffffffffff9ffffff  f>f>f`~`~`~~~~fff~f~)~~~~ff  <38 3 f>f>f>`````````fff`f`||````ffǏǏ8px?3xp>>>`<`<`<<<<<>cc3333;0;0 3 3ww0303?0?0 3 30303?>?> > >kk03037070 6 6cc33333030 3 3cc303033cc??DfUD3"PAwGFPNEO!<69>aLaDGDCaX`0,29R@t4g 2,`a~`F0,g 2,S@`p0,4S@9@`0,2,gSA`PJl0f\2,6SA`>092,RAt6g 0,`"Jl0gSA`0,BA` B@2,`a`BlJyk3/<a Nu9|JlgBy9| yg/0,a Nu0, 9@Nu0, 9@Nu0, 9@0,a)N 0, a)NNu0, 9@`0, 9@Nu0, 9@Nu9@>JygGOOl` lGla)N Nu9@ >JygGOOl?`lOGlaJ)NNuB@` p`p9@PNu9|0NuBl0Nu0,2,`l4l@fUD3"AP Fpppp????????<<pxpx8080<<pxpx8080<<pxpx00DD<<pxpx00DDppx8x8<<pxpx??||ppx8x8<<pxpx??||<<??p~p~||??<<??p~p~||????????pp~~????pp~~??88<<??pp88<<??pp88<<??pp88<<??pp88??~~??88??~~??88????88????88??88??88??~~??88??~~????????????~~??~~????????ppppppx8x8??????ppx8x8??????ppx8x8<<??pp??ppx8x8<<??pp??x8x8<<????p~p~??x8x8<<????p~p~??AA88<<??pxpx8?8?AA88<<??pxpx8?8?~~??~~??p~p~??~~~~??~~??p~p~??~~~~<<xx88??9988<<<<8989<<||88~~~~yyyy~~~~xxyy~~~~yy||??99??<<8?8????????? `???? ```c8<8<8888<<99c<<`99fffaffff `?? `99fgffg?? ` `ffff99c` a~~~~yyssac8<8<99>|>|8?8? a|>|>yyssa~~yy??||<<x9x9<<99>>yyyy>>yy99yyyyyyyy99yyyyyy|>|>yyyyxxyyyy>y>yyy>>yyyyyy99yy||99||||8?8?8<8<<<99<<<<<><>|<|<????????ßÁǃ))ÁÁ9999ßà ??pp pp??????DfUD3"PAwGFPNEO!??ǀ? `?qQ'<q"'9!"(9q?K/"$(b( "(`" K>?BH""$( ("/BǞ?A"qȞqǜpG'A?<<`??08p <xxp @Ϝ0cɟ6`s ρ0~Ϝ0c3 ?p3> ϟ0`Ç>>"""""""("("(*** """"'"'"'"""ppp"""r r r ?????<``?``8LJLJ8xχχ0xxp<><><>|<|<|<<<<88|||<|<~~Ɓ9<<<<||   <33330ffffffffffffffffff9ffffff  f>f>f`~`~`~~~~fff~f~)~~~~ff  <38 3 f>f>f>`````````fff`f`||````ffǏǏ8px?3xp>>>`<`<`<<<<<>cc3333;0;0 3 3ww0303?0?0 3 30303?>?> > >kk03037070 6 6cc33333030 3 3cc303033cc?? CAREEER THEMES INVENTORY AND PERSONALITY QUESTIONNAIRE This CTIPQ is a personality questionnaire, designed to discover what attitudes and interersts you have, and so advise on appropriate careers. The programme will ask you 174 questions about you and other people's perceptions of you. Following this, a personality profile will be generated which is shoiwn on the screen, and can be printed to your printer and to the disk (for your future reference. Please note that professional evaluation of your profile, should only be carried out by a qualified psychometric tester or occupational psychologist. They can compare your profile with a database of other profiles of people successful in a range of careers. If you wish to have your profile professionally evaluated, please return this disk to me, together with a note telling me the name(s) of the files you wish to have professionally evaluated. I will send you an ASCII report on this disk which you can read either on-screen or by printing out. This report will give a 2 or 3 page summary of your personality, together with a number of recommended careers, and a list of others to avoid! Due to the response I have so far received from my own friends and acquaintances, I have to charge a fee of 5 to cover wear and tear and my admin support (she has to do this in her own time!) n.b. I do not expect to make a profit from this! Your disk containing the CTIPQ programme and variable files should be returned to me, together with your address, 5, plus a note of which file(s) you wish to have evaluated. I will do my best to return your report to you within one week. My address is: ROBERT GROVES BSc(hons),M.I.P.M. 61 St. Mary's Road, Stowmarket, IP14 1LP CTIPQ The proram CTIPQ.PRG asks questions designed to discover your attitudes and interests. There are no right or wrong answers because you have the right to your own views. When prompted you should input your name or other identifier, up to a maximum of eight letters. A personalised file holding your responses will then be created. There are three possible responses to each question statement. Using the mouse, point to one of the three buttons marked "agree", "in between", or "disagree" depending on your view. When the arrow is pointing to the appropriate button, click either mouse key. The button will then flash. To enter this response, you should then click on the confirm button. When answering keep the following points in mind: 1. Give the first natural answer that occurs to you. A rate of 6 responses a minute seems to give the most accurate evaluation. i.e. you should finish the exercise in about half an hour. Don't worry about contradicting yourself - it is preferable to strike a balance where the statement gives less information than you would like. 2. Try to give the "in between" response only when absolutely necessary - perhaps once every 4-6 questions? 3. Your answers to individual questions are not stored on the disk: only aggregated scores. If you return this disk to me for evaluation purposes, I undertake that your personal information will be kept confidential. Under the terms of the Data Protection Act, no electronic or physical personal data will be retained by me. 4. If you are not honest and truthful in your responses, the profile will be inaccurate and of little worth to you. 5. On completion of the questionnaire, should you decide to send it to me for evaluation (see further details on the file read_me.doc) please enclose the original disk, around 5 per data file to cover my costs (admin support, postage, other wear and tear - willing to discuss lower fees for multiple evaluations going to same address), and do not forget to include the return address! All enquiries should be addressed to: Robert Groves BSc MIPM 61 St. Mary's Road, Stowmarket IP14 1LP wfUD3"PAwWDpNEO!0pq߀P~fppjfppq0088QQQQ||@@88<<@@@@@@@@xx8811xxxsxs889c9cHHǏǏDD@@EEDD  ppDQDQEE@@DDD1D1}}HHDODOxx8899NNDDxx<<  DDAA((DDxx88ÞÞ8@8@}}QDQDEEDQDQ@@UUQ>8~~>>#a000000 #b000000 #c7770007000600070055200505552220770557075055507703111103 #d #E 98 12 #W 00 00 0C 02 1E 0D 08 A:\*.*@ #W 00 00 0C 01 1E 11 00 @ #W 00 00 0A 0F 34 09 00 @ #W 00 00 0E 01 34 09 00 @ #M 00 00 00 FF A NEW AGE PDL@ @ #M 00 01 00 FF B THE BEST PD!@ @ #T 00 03 02 FF TRASH@ @ #F FF 04 @ *.*@ #D FF 01 @ *.*@ #G 03 FF *.APP@ @ #G 03 FF *.PRG@ @ #P 03 FF *.TTP@ @ #F 03 04 *.TOS@ @ . `!.. READ ME d`%AUTOVIEWPRG t`jSOURCE BAS  Autoview PD by Steven Gooding 20th May 1993 You are free to copy and distribute this program as long as: This text file accompanies the program No alteration is made to the program No profit is made on the program Autoview PD remains the copyright of Steven Gooding and any deviation from the above conditions will breach that copyright and could result in the withdrawal of this program from the public domain and jeopardise any future releases. Inspiration: After meticulously searching all my P.D. catalogues for a program which would display a text file on boot up, I was quite surprised when I didn't find one. So, instead of just giving up, I decided to write my own. And so this program came to be. How to use: Place the Autoview program in an auto folder. Write your document in pure ascii and name it 'READ.ME'. This must be saved to the root directory of your disk and must not exceed 65000 bytes in length. Control: You can scroll the document up and down by lines or pages using the arrow keys. Control+C will terminate. Configuration: This program should work on all ST's and STE's with TOS 1.62 or less and works in both colour and mono. I'm not sure about Mega ST/STE's or funny monitors such as A4 or VGA. Thanks go to Tony Greenwood, David Seager and Rockafella Blue. ******************************************************************************* Please send donations, bug reports, complaints and compliments to: Steven Gooding 141 Fawcett Road Southsea, Portsmouth Hampshire, PO4 0DQ. ******************************************************************************* `jg`Pack-IceI *Lhk,L҈a*oMGLA "grѓg f``GP$]t***Ԋ**EL ;H ;C&NN&&Sj&n".扑&&SjN%a*d"ra$dCv !a"H@@Vҩ%QnNuf%Nurf%AQNuCtaTxr1 Hka1 Ag"CvtaTr1 HaBq jD`rptadpt?aBC@!!Q`R   ICE!h҈`XdK`NLr-yf`Sto|ic ]mpiler V 1.0 by Francois Lionet00!,0֕957*[Ү69.8;򋥰ɮ{jys*f{ɖܴ4Vx38pp+0PU33ss77sMKK U㍠ ];*lVJg`uCBYA P$&Jfa( HzС '@31 f B, NA\K4?]ytx@CB2M"-+z$Ӭ.B# LrXg rp$;@A[d:yIeNNT;@ġ 58\{(*d.ʛZu , MIK H k]ƕ oĂ2|#Ehק`+00.MGd+K.+S2' U6+k:B4wԁ:8 ( B(LAA;~@p"Qr:~ 9;. w` k[@1$Hm`d# bsA4Cp", $N *-BG&$(./fgPfff~`Yuf=`ݒ&Rd~gi{z|kfB`&`&&`JG+N{ <6H+O ) Ph XM E+J hş& p0Flu$H`${\TkdQ E%Lq1ɀ@Q[0L 8_DN@ }}AI9ڀtC F|=ȄC,+I~$;&DB,$ +( "dBe L5֠&WX/,ްN,_s[j@?G (ND;n" gPj$na|%t'b_ E CB ̈+R-R -RA;5 VpANE~'NGw;h$X+ydC!M!,L ;| &&O,Et~D"u >$RB@N" M|L%PhEQ)~ D+HqL/yzO8/X9BaM09w`0x_{r6;p `upR`p.> ֔0D.0 (piq\JDgSX{,628FTrvXAiLf  f2T3 /!YA5A Q00 R1RJ*Vf2ůTd0` fRNB`2G dDT`[l":"BG j@N1 *W5(W-5 g g '3wi3  Px2SJH"J )ÿЩ"#RNG$I$ _Jg` ggՒ`?`L"O#|JBpNG~NCpNE j-c#wA! \`0e B1ms"- hNB#?!y@ZҳG p,6qp 0-f I@?K /,;SXDHz&NN\Jf4t0BgNA/_1 /Ig/:g7sBNsq@NOvP娪"PPWR U&'H #Dm:kBi(>PR: (h<)*B~- CYfWA b nk2fsavec.basLrun`"= dir$ + "\DviousoffCl 2u3G5i 40mo 1new:accload"*"Gdefaulenvv list`~LP21d %c(C 81(2d345B6V7 8١19Lf20:\yۢrjh".aӤwrtfx H) =B⃇t7+84Y0Kzqk b/FUK]A lx$2 vMn<G\80Z jtcf C) F'~wH#:3׌{[+7!jXz9pLJpd:eccSb#Bx+LlWfmA"--ͫ9YY|)Il/l-x&^$^<}D>xXDGeBdTXFNSF QwSG`ѝ[07- U-ސLqn mBׂ,e"^2^/g pxSA7ő?/ v B$BovV"_2fmu/ &Hмf{Qp )@f{BglNM\6<&8nn\=%NNT. ^;5Ѳ^ndS@B!0cpv?8CECʘ~gdf `RB|Y/& HYB[VF IYe"̰[e ?Npob2)dJ?m-00ghP%^%WPuՓJkm$n;~nv#vs/@c>@p BA.R=4(gQ& 0pqgYpNE=feRаk&/BNI3flk3m\t΍632OneA0JPxXPeA f{T#Pa#c0n(g(&]TnA8-2RA`?20;R[10& XGhL?,J N<q:&&f[2Sf$fgJg 7a&&`,$6,F&`tI*P&y.3RE1SFg ,?F"~k0f BGP

$H&N&ܘR(R#ŸUWdzĄ+,gn1G0UQUo+e0\ G2koR@0AQJgkǬ* lTIX8H \fW_Ǔ̿2Xv &7V(:dքe -nA8y*#8,^.DIt1& C tvi% eBd> EA>df$&`&"I) CR$)` P#[XAFGakd! !ގg&E"G~dN SGg<.f3Ӳ0 1gR`ج" 0m2S@Hm`vH$k$`eJXx g:k&@`"&u@g(-a0[(TH&LXSh1g&J?g.ʹk+I=A&oB\ ,g`ՏV g 4|@Sk"0/Bş YP!p0x3pi JB¿KJ–˔$p?^ 0 E_ R>roߗ#ջ j+k>g~ܨ=8SG5Qff`Fb`?W<"[d*Hz}/$20 ?! ׃:}!5>rp@z [a+l  V7+Y0*Pq#,R,g+pBm9H',γE@6 -*upBXxHQ oIg/:ru ]sv@Q-Ȳ ?'R@xN<#H/A Ϝ;"ttA  gn؍2n d2˓Iw w/e&#//CxXRʸdvUK>ABBrBS@g jTA6?^`CxRA0H>1Q'B@TR@Ac;G x:67ܔ . L *  S92Y Jg&r)b;Cg x`B--~,d0ѶMT2'N bHbBAd>Bd:23C3&K=% L("XrO6SNq6V2lr" ^7,] DEd"F4u~q4((C}$It2،+4w51fJh*#psߌہB-VN^Pp,V?/?=NAyJ,%$^4g4?d2SB2NJmn . \Q IBRp5Yr#gD-N|˗p4`p0` p3`p1_V2/&g bSCܷj$l0x Xc"`"qަV/Sr(>-5PGgIrB.BZB[|GE UBEp J)6BD 1XzRBPCAdRD J1@f/،"6 lrzf,MN%b}@T9;d;EAXNp̓\k3XDp B=p'HR@'wb9g8 &_x~VJXgBB{exkK ejnA*T.gXv9y6r45g Z '34要FЬJIjj)H2-bAgQvBA`2t&|GZtCJ `42l$IBєI> KfSg G8mkBl[RRSRA(^mfi/Lr f #B@Qt>#;,_܀j!/dP"g:fhf6B"(4ѭ$mFJ+K& N 7f 8&0<supQ:Jzt 4*"\182" ,<F&4|F@" ?  ( ^b* (($*T*zVl$n DEQ<uEL #4(+&5 J87feDAX'YKHU` Autoview=PD . Copyright 993 S#ven GoodREAD.ME_Formattg tex> ;dPrM/6`q`oWindow 10 *в! ΢rX$̚pr8br䲊U`F)$y.F%&KŦts$'(б\a4V-y%!%.R-<*:gaNBKƜ!,2D!xq^)a .o @{+D8W$u xKUw-qSސ%`Мm QV;p`.P7u4"(.rWXePʏң?A ݂(("BU &X*#/wn:#BBHNV**lT U($zlVT%^&S.y'J:!$\d*.CR= ?C|ĺ0%ig[12* (* cf*Ȧd/ _H@5`/.h#*MPfj<s9NI0n#!| l!xg V!tfI`Q~OK*u%upgwHYp(M_./oÒ!tfp)`pNE NL~Nspp2BC{*#Nva|³n02 Dg;IRzm.P>ʳu!خ.m(JEgͻ</ )p y)pfeBfNA&X]?,TNM]!#s3YX8]vTx˄xȶV3]n33,Bg?NN\Y7B"BYg["l\C!kHIY2468:<⯏ p{c]|xxAHw@I}J[."Q\2m*@T8_B9C 4je2m 8k!KL5e~HADdEulHF0v'*6j:C&dsx3MW$,T_Y4qƘmaVAهaZftrF5 avV3R C(KEm2Hȑ2m &m8:.t=<oevBCBB 8BT(ydfD=!2Gf>vDRBEgoöF1?u0Rf/~bq:rsݛ&SGl(_#?_#)x4.(; 6W>{bi%8@@:Z.!@B7C8DBC۱:VYjH:ӗwLx`:LDE0E t0& 4eZskevWP#38,}$&&JeoYP•wIМL6Jbv$>H\6)JHa>-43svu6RC C"~7pvBP2:J%6?0fN0+ Ls@/jod%90sqV@[?3v ?4}@^gf2sj*T"ը5jK͌laF9XDpOJ&om Pa{*6UiQ,H]#+9+S.Y̒3lҩ#X8NjDVw4E$9= R@۠e+ 4"T­scf%*ZL.-<,/*SF: E6KGR$5l0GXoSv(n0B*NrTMY:(.-+8u.7;2sQ0x~Z_PlSJdQ֗.%ft"rOFRG<ж»H>>з8tp:>Y`<̻NhVFڛMiVE*w^d0Hu`55HTܵ`J xg, s׽DGܣD?X/8 xj:F"ue p0ʈxkRAt6u"UdSH Bfj a`\XF6J(hn3`5ņuK/F& N x3bAWC@S0e d*ۣ <Q- xb ZȆ . > Ɩ)X 0l?idLlOGJ)N@jpp̀P9|s-"1rs=44@P68jB@ۂD j(HD9v+Y[UvAF u)Yzg5$ HC*B%>̂#]_ЮƽǺHgmJ.0uQS(e872% st$phd'd3 |`\TȊ\ZðJ7U %J8'fn[M6c2`AbB*9A,YJB`v9BnͲd;0oaE0`K:Ʋ? Pk]0gPaڑ fabu*5[`fЊ-6y*!U ""2V89DchUR.xDlN:<:H[BBQCCP6Qm?H@vX󇾩KU!tLͷSC e$<\X꠩OVA8.ąe]X <8+[(73Jk8d0T*:&FA5[kTa {mLH \aEB0B 0&HUBF `@6'5p ̔-ϩ62JtAT"-&J,$ H_SG6y.8l L+"˺U#7b*9.CLZg,Ƽnx'T0`€&YMY|WQ֝UE]WL."Khd' e$I4 : vFJfF]^xAQMQNRHSEjB <NlBGgSJf]J㱰 rfzTUVKTJQ(#lZ)t4kn9Cd1fBDfuRD-f 3LL ΪNL2LSAI DhSBƏgAk){D `;jhBa ( `t#R3\c~0X` p IL  IB0HABA biIJd"@@UzXdc^ Ki*X?(K:u20aboTAb>BhS0<@2nBJ6$wJl2R@RA HE4 6< "yN\/ "QNuP:v h&\h $/Q0uY"0ĆB a@$4 C$ HL B:  6,;XfzfB  _ c6 d 88d"s8 dJ ":z<$0L5( `8>FL @ &N ,QV 66(>h<&|(tbHvKV{3;'|ܔ7?jkھq]}|heߺxwx0 x>{re}ne7 x.ps!xnWp͞o^;[Ǎ7o}\I|@h%oKݦo^p%8+ 5`ַ$$B7(Px ضo܁(v<3+f 6YH~@#w-޷X^c6+[B^@@<[f` b4^X@3xsa݌}jbRJF8ax|)B*R)UH$ $H(~;;@2/ (xI]spxq0˾?ux a=f9‍Mf;p7%f|l\dY i8Kچu8W p.]\T744b.|A r-O h\$V\i)r7`-f` FM9/~`r~r?x!Vl{F7p>+\r ``r:S?Q6p|`0|`l]ؽlV㈴xfvnf>f!3l@ 0`0PE :|kÆ6n֟@R!PvEl m9P<=*lfF~ý~j9]}wU*K *N\~- Vhce[Ʒfc8/x\UVq30gY^t<1x{@,W=d;[2~f<{q?&?+9a}P>` ca9{Ɔ ` ' zOO /ΞcX~Ɵ|hc>O j{ހ )fzc   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~(;x'xA6EVf]C|ڜXl66ppv&8] !`07o8Yg9')YÖ xt;n^!nݡ[RRK@ 6k&88&+&k3ʀlXvn]c<&ӊgK+00rV;f- ,-0n&|` #&,2f2?`6]l6lذ>>;Yenv =n~vKH~|"~~h0 A^~E6'zLZ^~f~off5 x.C| d)zz lRK[Ƃ, 3[_UQs%F&l88j2/n> %<#?u aӒk!`gLHO5\xC².7LxLs8lVL f> v|>??2/|qMH,wV'& d&!!  9d< @[ #'O{fjNO&#3N VX `00@6F8~ߧL;&~r&!a}' a' EqXhq uluiuukG|qO,z|.YSpBuff ϫ mouse.spr_-tP Zܾ?=[~#m#{ ^#,HFbYff^{\3#fnyj @d,SFB_/3P _pL~+?-[e(ct A߄+]HB~x«vNBGRES1+mBQ=Ʀ.Xܣ A1Z܇G3Al1V<]dBa` ڠjhF3``SlDF *@V"*VDT fi3F?22}kRGY>6и:ۄn? p}'>-&:B-DB>C[qBFCBBPA!UU9B BۮGbmeܼ&b;5e̬rBB|j@g'HAA3l> E6z9gJ "E0HCMrFAJQDj9SGH>ߎ$˜&J(z@+ա&G?d@07Dp"U@:@T@ψ@fS3Cܢ2ؤ^L` f2;7Qva-LO`', ¨t2![34}RcPƉl|~r`<0w2+*Fmx)0[&T`nhcpWv72Q]+$EB2Cf xptv`8*_Qa쎛JGk2{ 8$>v`1`;SI" 8sxߏV _wӐ6"<̀+vSGa3P A`FW4m9Z4V:V\\Ԫ&>z.@ PBCSB2?DSA&z06?W3޾or !4:zl`o8 oN6l6Rl>zo::3D [$3J<>y36C3BC <Nu;+<`(8@'-`6αVLlEA@ (jRWɸ`PYK0 3zY,f< h,dXZW_Mf E8JBf S`2XwJT8 #:`dJf /p`[$zx^M8:L 2Vز"@Lr@ bKE0!IcyEXy1GO`"G6UgRCgZhxeREm| BlM#B 06,@ 8SL>SG:z:6j_ 22xؔ6< zr&J$KBD0g RDff /2/.Y2ۘCv0 6QWDp>B@[ LD&I(J8_ D([eg7f7<Xj%I0KE?I.BB|ߟ<"MxKl3 g m &LB6RERA-f SE4SF,`lr4q7Hm ]g .S40ºOq`ـ%uC:,wJAXƉ`Ac.孠JFP>e:2舔,'>(h@^Cc$Dd }e#,e zdU=3:PF3y]I`څs<6'NTUgh~q\"רɮlo F21(j90l V(]X,^@3;f){6u6@^e fAp\CtBA؀\= ˫ pBPK8<<3sVa"یCGC{D zz"3vNJEM.0<C>h ,"؀ hChDŢKMHJGs4|sŻ>8žDOߍRG 4ޢo` 6A$x ~0'@LJS@ɝa.:5qрJ7Zx6 %#|ǗdzH x^f0AzFe~fzt&&JLg$J4:J(CSFxGفNgyZ98+fEc"(8ꤱPX 1$dTLh^Q`^2a59NZF$Waxv|vVTQˋPgQ 7b1[JZ`܁ɁQc9_v[B/xtKKue+ U JHu0U4,0246<П9Cxyz{7֤L"hijk:\QXBYQY`Qd2222׍:E}GSME0:7f`kcCt4!k.y+@Q&k FTZ-ʂҸBLe$ SskJ k;Hl.R4k K"J˓g8vtϟ>*KFk_ŀW"Yj&k|n{bͲh0HCHBHAH@: jk$6 4 2 0 :3333Qg.BCzA[:m*QaQ̗T?#ZYoCvBB<~aig2TSGgR@Fedك $6ȀJ4<A] {E p< j$H<"$ӲLF B">mG+y4( dPa(e$$~3z4$OCk44:dqsBDE.`SD|"*.2n`<"Aêx DU5)nLA:<Q68:#mJA~rUJBjtVdJUU:J}UVe<░*eCIDCADDB?FV:@3HKC^DLX Ig,K`zٚ&/g.vN e[^wkG)~|SòG'0`']RӥDg g:E6)VܲP8)L 2՚&@}xr@ 4%KE0!KD*l` mj\q|vcQRG G˧Zm2CJF,._$&Jl+ 3AH֔ۤ:@UM2K :|EJEg' _p+S@PQBӴQe- Seid}".Vg&D g0m h+9b1ae gAPg.j-f&4;X,Dgk B0@`xgDAy t _gզB̫`<:՘?iBEi*EՆ˗RAIJC&Rn(XR@ Y_fBRpѭCHCFczp5",!3J4=vxfpTRd&-rBB]dΜ9 YtgAHfx50#jbbU`\bT@"mvc>Eϋ3:uDBy f fq}bFTB#nҨr+lYv؁;jBeYjACYBX6x_4Īa9YI,M8 q8<[z1Jj<< P[xR*g;7nra؜,ιT<NExK6KBʏ *zIB`(M&}V*i-/G U/éS6<*(WNSC0`ªNJ5D*:w2Tj,k(T JAk:)J̻ٱt :=MRBUI 3GL@ &PDW1T3aJmF"NކQzSA OM]>',K̬ IpҢHobaUgr +0HH2-I2(EG/eᡵqV`Cx^n,L] wL T@,MioaP"?o2BC` xrv;8[VQd"ȲjWx]?č0N^tdCgvb=D w0WrUfvvfF0 Bf ?燅~4y6V\(zF`::y~Xܪr:Ӵ*&"=^"7Nf}x g> G@2Aw@vH@H/tJے陰Agb&`S@@0 UUl~˸3ن>"Gg^l<SG4&ƞ@mfƆ6U3l`6Bf-ìtABI5I%b|ˋA1`g(gRf3B e"UHx0&.g*k 3㰦Q0:ȲְmCEȞ~g ^,Vv]8YB֚!B[BBRFFB:ô64"HM&c]fdpƶ:M8;::j4|!K 4(K)F\#J,GREE◎Ba3Ĵs4G>k ynG*H>3A0#l0Ĺ4 .EF$Iޢ&J2#AB冁  t4aـpź :ESMM8E7<[>=I48 J"K1: H0'D`0 2QLFe/:`GSDjxSBg Qv %UHd)D SnlBƅ͝J eKP[fȈEe RI:r0HIV>2V(A<^2:N:hY 8LSE$H&IY2H@6C ? H402P`6?ͽeg`lVgWx "fL&!Bp@b& $(h%d"  @dB~8 dG0i! ],e \ : nopJOgSe nj9gF4zܸyDzAgB<:tf դ3]4`,fsPs2IRAtkU|$nozJVPVog MRvK6.:fk.ghVX8J7`@z0 DeBDLi(D4J ` ,Q|RB-)0HKbeKQԟ zN~d|0Rf0qbgZ2YY99fhH`#tU b)T^Z4`` gc2bK0P@v `$`^d|jS`bPcr2 P m /ka<;hNF\_HBap5}1\pS#p C .BQ~$|8t BpfШC` t AQg,_?1 1Fn!I,PAB(U0:3FABuǠ:e&:Z <]p\4B+R@ @ f?JzGz@IFa,By<3N:} db-B30NUGASAAj~pJpg00Nu|  " 4  <٠. C8Lionpoulos@d ~ Auto Text Viewer Source Code, (c) 1993 Steven Gooding ~Nnͦ::ަ:::f,:A$():s,: Autoview PD;(); . Copyright ;(); 1993 Steven Gooding:#,READ.ME:,:Formatting textPx(#)#: FB LA: LA:O4#, TA$( LA): LA:N~xZ:OY @C:, @C: TA$( @C LA) ;:*:Os: :B$:: 2SJ 2SH LAA:P:R 2SP LA FBA:P:J 2SK LA/AA:B 2SK LAA:RȢ 2SM LA FBAA:RҢ 2SM LA FBAB:ܘO\NP,::,:A$(A)@P,::A$(A);