NNNNNN[p NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNN"O`  @! #+-//3@5`79;=?A C@EGIKMO/S@U`WY[]_a c@e`gkmoq s@vwy{} @` @ ` @ ` ` @ ` ǀ ɠ @ ` ׀ ٠  @` @`!Aa   !Aa!!#A%a)F-/3A5a79;=?A!CAEIKMw{}!q1!Aa!Aa!Aaǁɡ!Aaׁ١!O`  @! #+-//3@5`79;=?A C@EGIKMO/S@U`WY[]_a c@e`gkmoq s@vwy{} @` @ ` @ ` ` @ ` ǀ ɠ @ ` ׀ ٠  @` @`!Aa   !Aa!!#A%a)F-/3A5a79;=?A!CAEIKMw{}!q1!Aa!Aa!Aaǁɡ!Aaׁ١!CONV_WP rDOCUMENTS }PRINTERS '1ST_PRNTDOT `1ST_PRNTPRG ё1ST_WORDPRG M1ST_WORDRSC p:CONTROL ACC Y5 Y<DESKTOP INF v'FINANCE2BAK Xu( README v TIME INF SyTUTORIALDOC z?'1ST_WORDCFGPRINTER DOC n#*GUIDE DOC 7FINANCE2DOC Y#+. CALC ACC We111INCOME DOC dCLOCK ACC ae1>FINANCE DOC }CLIPBRD { /DATAB 8D0LETTERS GEW BAK a{!. s.. CON_WP PRG NX g ,gHl2?<N\`VHl?</,N^ HlNX=@?</,N\J@g?./.N \`?./.Nr\NN^NuNVBnHlNJXHgpHlN?<N~\=@ nfT?<?<!?,?,?,?,Bg?</,N ?<?< ?,?,?,?,Bg?</,N r`tBgHl?<NRX`NXN^NuNV-|z-|' .м'-@`" l"|| f l"(|| f l"(||.gX l"(||:gB l"(||!g, l"(||?g l"(||;f> l" l"|R . l"R". l"|`R l" l"R". l"|R . l"R". l"|S` l"|| f l"(|| fl l"(|| fV l" l"(|| f2`R . l"R . l"|| gS`` l" l"(|| f>` l"R". l"|R . l"|| gS` l"|| f:Bn` .6.HЃ l" Rn0.n m0. S@HѮ` l"|| f l" R . l" `P l"||f SR`2 l"|| lS` l" l"|RR .mHl?<N `\` .o .S)@N^NuNV-|z-|' .м'-@`v l"|| fh l"(|| fR l" l"R". l"|R . l"R". l"|` l"|| fD l" l"(|| fR . l"|| gS` l"|| f8Bn` .6.HЃ l" Rn0.n m0. S@HѮ`2 l"|| lS` l" l"|RR .mHl>?<N\` .o .S)@N^NuNVBn`0.RnAn0 n m9|9lHlHlHlnN8 N^NuNV?,BN T?,NTN$BgN TN^NuNVHlHlHlHl/,N?,?,?,?,?<?<?<?<BgN?,?,?,?,?<?<?<?<?<N^?,?,?,?,?<Bg/,NN^NuNV?,?,?,?,?<?<?<?<?<N?,?,?,?,?<?<?<?<?<NN^NuNVN9@HlHlHlHlNV9@HlHlHlHl?<BgNNJHlNXJ@fHl?<N\BgN THlBgBgNP @fHl?<N\BgN TBBgN \NhN4N^NuNuNVHlHlDN PHlHlN PB.HlHlDNZPHnHnHlDN =@ nfN0.g$HnHl4N PHnHlDNP0<``0<N^NuNV?<N DT=@0.|A n n|: n|\0.R@? .T/?<GN P/.N X @oHl/.N P` nB(/. /.N PN^NuNV/.N NX=@`Sn0.g$ n(@H|\g .H|:f nB/. /.N PN^NuNV=|`00.H H@|0 n 0.Sn0.H =@ nn n B(0<=@Rn0.`0.Rn0.Rn n  n fN^NuNV=| `H ./ < /N\X м0 n 0.Sn ./ < /N. X-@ n n B( 0<=@Rn0.`0.Rn0.Rn n  n fN^NuNV/NX9@g0<`0<N^NuNV?.?<LNXN^NuNV/ A&H`0+ |g/ N*X A"Ҽm?.NT&_N^NuNV/ &n/ NDXJ@g0<`00+ |g /+NXBk ?+ N,TJ@g0<`0<&_N^NuNVH&n0+ |f0<`.0+ |gL0+ |f0<`l0+ |g?<B?+ N0P?/+?+ NP @f0<`6k -K k o?<B?+ NP n!@&Bk0<LN^NuNVH$.". BnJlVnDJlRnDvd`Bbd nmDdD-@-A LN^NuNV/BnJlRnDJ lRnD 0. -@0.n0. nngD -n N^.JNuN^NuNV nl <`?.?./. ?<BNn -@ m .`?<?.B?<BND -@?<?.B?<BN* -@ nf .Ю -@ `$ nf .Ю -@ `0.g <`b . oHn . /?.?<@N Bg?./. ?<BN ]|9@g <` `Bl . N^NuNV/.?<INr\N^NuNVBn`&0.AV0nf0.AVBPRn nLmN^NuNV?>.=|0AV"HPgXHf0(>N^Nu)IR)JN)_JNA"lR$lN/,JNuNVH0&n$n -KfSg` .L N^NuNV n "n fN^NuNVH0&n$n >.-K0SGJ@gg` .L N^NuNVH0&n$K`Rf L N^NuNV n R @H=@ n g n g n f n R @H=@`0.N^NuNV=| nxg nXf n f0<`f n0m n9n0.|0=@`2 nam0.|a| =@` nAm0.|A| =@0.n o0<``0.N^NuNVBnBHnNX=@ n-f0<=@ nRH=@?.?.N*X=@ @g2 ./0.H/N 6.HЃ-@ nRH=@` g n 0.g .D` .N^NuNV?< /</.N@ HN^Nu)IR)JNHl)_6Hl6" <sNB"lR$lNNuNV)n:)nB .мZ)@F9|dBl9| n 9PN n 0A)H:A)HBA)HFA)H>N^NuNV9|eBlBl9nNXN^NuNV9n 9n Bn nR2.RnA|0g`9|9|Sn0.9@9nNN^NuNV0. Sn J@g6 nH| f?< ?<NpX nRH??<NXX`N^NuNV0. Sn J@g nRH??<N*X`N^NuNV0. Sn J@g nRH??<NX`N^NuNVH0&n $KAb-H nf?./ N4\=n`H nf?./ N`\=n`* nf?./ Np\=n` -KBn?.NFTJ@f ndH| f |o@ H-@/./.?.?<@N( 9@Hg0<`0,n/./<?.?<@N 9@ @g0<`hRnR -@`R``` 6.ƼЃ$@ H-@/./.?.?<@N =@9@Hg0<`Bl0.L N^NuC  9|C"2"2 2"2"2"22"2"2"22"2x9|Nu Gib zu konvertierende Datei ein. CON[3][Nicht genug Speicherplatz | vorhanden. ][OK][3][Nicht genuegend Platz | auf der Diskette.][OK][3][Datei|nicht vorhanden][Abbruch] 07201030305800 1 2 # F0110030 9[......................................................................]001 [3][ Lesefehler! ][Abbruch][1][ Datei gleichen | Namens vorhanden. ][ OK | Abbruch ][3][ Fehler bei Eroeffnen der | Ausgabedatei ! ][Abbruch][3][ Fehler beim Schreiben ! ][Abbruch][3][ Pfuffer fuer Konvertierung | zu klein! | Deshalb vorzeitiger Abbruch ][Sorry][3][ Pfuffer fuer Konvertierung | zu klein! | Deshalb vorzeitiger Abbruch ][Sorry]con_wp.rsc[3][Resource-File CON_WP.RSC|kann ich nicht finden.][OK][3][Schwerer Fehler!|Resource File nicht O.K.][EXIT] *.*\[3][Es ist nicht genug Speicherplatz vorhanden][OK]CON:AUX:PRT: `B o"h# ##,Oc.N//Bg?<JNA Bb3N 8NzNV?./. ?<NAN^ _ONNV/./. ?.?<?NAN^ _O NNV/./. ?.?<@NAN^ _O NNV?.?. /. ?<BNAN^ _ONFUGGED_UP ?Hz~(/,HNVNAT-HPHyHzL?<N:X~)Hy?<PHy |NNX~*N yN~+N^,_X>Nupress ...SCRUB_IT ?Hz~2/,HNVNA>-HPBn~3 .=@~4~40.nl~5~60.R@=@~7~80.2|CrA!0p @V0.2|CrA!0p @VC0.2|CrA!0p @]C~9~:0.2|CrA!0p`@W~;C~<0.2|CrA!0p{@W~=C~>0.2|CrA!0p|@^~@CBd 0.2|Cr CA!~A`~BN^,_X> _XNCOPY_FILE ?Hz~K/,HNVNA-HP~L~L?.NR~MHy1&?<N&=@~Np/?.?<N~O?.0<H/Hy! N,-@~P .JjH~Q~RHyHz?<N:/.NHz?<N:N\X~SNH~T~U`~U .ro ~V/.N~W?./.Hy! Nʰg*~X~YHyHz8?<N:N\X~ZN~[~\ .Jf~]N^,_X> _XNerror writing output file on input fileerror A0B1|A01|~`A#p31f~a~a091f@d~b~cpHy?N>X~dHy?<EN>X~eHyN\XHyN\XHyN\X~fHyHz?<N:N\XHyN\X~gHyHz?<N:N\X~hHyHz?<N:N\X~iHyHzL?<N:N\X~jHyN\XHyN\XHyN\X~kHyHz?<N:X~lHy?<PHy NNX~mp31$p9 31h091$y1hn>~n~n091$2|C?291$CPtA 0A1%Ry1$`~op9 R@2|C?rA1%~pHy1&BgN31"~q091"J@k&~rHyHz?<N:N\X~s`F~t~t~uHyHz?<N:?91"NHz?<N:N\X~vN~w~xHyHzh?<N:X~yHy?<PHy NNX~zp31$p9 31h091$y1hn>~{~{091$2|C?291$CPtA 0A1%Ry1$`~|p9 R@2|C?rA1%~}Hy1&BgN|31 ~~091 J@k(~HyHzv?<N:N\X><`P><><><HyHz?<N:?91 NHz?<N:N\X><N><><?91"?91 N><?91"N ><?91 N><HyHz?<N:N\X><Hy?< N>N\X><HyHzZ?<N:X><Hy?<PHy |NNX><p9 }rYAVp9 }ryAVCBdBy1f><`r><pHy?N>X><Hy?<EN>X><HyN\XHyN\XHyN\X><HyHzx?<N:N\XHyN\X><HyHz2?<N:N\X><HyHz?<N:N\X><HyHz?<N:N\X><HyHz?<N:N\X><HyN\XHyN\XHyN\X><HyHz6?<N:X><HyNX><HyNN Press mission of OSS.OSS and CCD. Use by per-are copyright (c) 1986,Portions of this product(c) 1987 G. Hungerford Clean another file? Clean copy successful opening outputopened output fileDestination (ajax'ed) file: opening inputerror opened input fileFile to Clean : and bleaches 'em to spaces non-printable characters Cleans and shines all Butch's File Cleanser~,GxvGRI1j/??<NM(PRDQNu |a<aHy1?<NNxvI1j/??<NMPRDQBgNA |` |` |aJah o`< |j` |ta. |a8 oaa: o `/ |a _/ |a _"f/ |a _`V"nH .g |%`Jk |` |aL/ .f^Xt AH aLQa/ |at&<'HǏf CgJfr `t20/ax$HG faf |aP _a`/2<$aR _tv"0 :e^H a2LYCQNu31/ |a _?ga `2Nu<|H瀀091Ry1 |1LNu Bus errorAddress error accessing Attempt to divide by zeroValue out of rangeInteger overflow[3][][ Abort ]Error in Called by PROCEDURE FUNCTION MAIN PROGRAMat line at PC *unknown*Nu/,HNVrN?<MHnHn~HnvHnrN@"n2"n2"n2"n 2=n~0.N^,_ _ON/,HNV0N0. rAg p=@2` Hn0Hn0Hn0Hn0Nl=@pd=@2=n p=@ n n0.@rA1Rn`p=@?.2Bg?< BgHnHnHndHnLHn4BgN=n0.N^,_ _TN/,HNVN=@?.Nx=n ?<fBg?<BgHnHn"n/ Hn"n/ BgN?.NxN^,_ _O N/,HNV8N=@:?. Nx?. HnlHn3|NAXNu _4` _t6 Bo r aSB`2aNH?V _r ar a/L?VNu _r aN _4` _t"x0HgJJjDxvCzp cRЀ`|e W0R"f`6 _4` _t2xJAjDAxvCp0 2H@0RJAfJg<-RBlCSBr aQSCaQN _4v` _46"_JBjtClBSCr aQSBk aQN _v` _60@d Ct`CtClBSCr aQSBavQNFALSETRUE _6kfv2_t Cc"4YBv` _6kfv"_t Cc4QBvSBkr a(QSCC" A0 9c^a JgYC`NH F"oA/ NL FNuBy(_ _/ C( g  f,t4(H / /?(?<@NA LJkffNu4(SBraQNu(gN fH ??<NAXLNu f H ??<` f H ??<` f NuHy` HyZ0< LNREWRITE required prior to WRITE or PUTDisk or directory fullBy _$_"Wp )f)H/ NL4NH/ NLp)`By _"WJyf8J)f )f)H/ NL )g)J)fJgBy )g J)fBiNz`zBy _$_"WptvH/ Hy2a0292XL- -fJf^p`4  fJg*`N0eH  bBԂi\(؄iV؄iRԄiNԁRCJ)f  g )f) 0e 9c~Jg&JgDJf 6Höf4N$NHy0<` Hy0<NBy _$_0"Wt )gJ&JRJ)f4H/ Hy2aP292XL )gJ)f RBBe`ưBe`N&|2H/ ?< NA\Hy?< NA\LS@kQ3N Bad digit in number encounteredOverflow during READ of numberBy(_ _/ C (g ( fxJ(f t4($IH / /?(?<?NA LJk,g*fJg  f"J` g  Wf NuJgJ(f P Nu!|Nu4(SBa@J(f8Jg. fJ(f"gr W1Agp f W1A1AQNu(gVJ(fD f&H`?<NAT f?< ?<NAXp LNu fH`?<NATLNuHyp0<` HyL0< LNReset required prior to Read or GetAttempt to read past end-of-file _ hNVf 0(gr"OD@Hd2S@k "Q` _"y e HyNN#3#3 .f -|`-| nNн3f y3NStack overruns heap09Nu _3NByNu[3][][ Abort ]Copyright 1986, CCD and OSS, Inc. .  @R "&&&.: 2 8Z                                 8@F D"2 T &( 0&  >        p2J X D   ( 0"L2 v  rr$R V CON_WP Konvertiert ASCII-Files ins Wordplusformat Copyright by S.A.D. 3/87 It's hip to be square designed by Ch. Hoofe Tel.: 030 / 693 93 25 Lnge des ASCII-Files Verfgbarer Speicherplatz Verfgbarer Platz auf dem Laufwerk Umbruch : WEICH TEXT Name des Wordplusfiles : ________.___ppppppppppp3Anzahl der Leerstellen bei TAB: _9 Wiederholung OK $\]8^|}~ /01XY'Zij &"F a> 7 " > Z  v    -      -      -  k  v !~+  :* V* ' 'rAJAX - cleans (!) all non-printables from text files, into ASCII format. CONV WP - converts ASCII files into 1st-Word format. CONV WP KRAUTSPEAK '88, or "Uh-huh?": Below are a number of useful(?) hints on the German screen-prompts. Name des Wordplusfiles - name of output file. (You should have already selected your input TEXT file from the item selector displayed before the title screen). Anzhal der leerstellen - TAB spaces wanted on left margin of 1st Word Plus file. OK - Run. WEIDERHOLUNG - Quit. . .. DEMO DOC  RIC DOC -vPRINT DOC x$0PRINT2 DOC %TEST DOC &0800000000066 1 2 9[....................................................]  SPECIALFEATURES The1ST_PRNT.DOTfileonthisdiskwasspeciallywrittenfor theSTARLC10for1ST_WORDPDtoprovidefeaturesnotdirectly availablewiththatwordprocessorprogramme.  ENLARGEDCHARACTERS Thelastthreecharactersofthecharactersetbehindthis windowviz.23and-(FDtoFF),werenotusedsoIhaveused themascommandcodesfordoublesizeandquadruplesize characters. Clickingonthe2willresultinallsubsequent charactersbeingprintedoutdoubleheight,doublewidth Clickingonthe3willresultinallsubsequent charactersbeingprintedoutquadrupleheight,quadruple width. Clickingonthe-willresultinallsubsequent charactersbeingprintedoutinnormalsizeprint.In otherwordsitcancelsthecommands1and2.  TYPESTYLES Similarly,theeightcharactersfromU.CPhitoU.C.Nu (E8toEF)havebeenusedascommandcodesforchangestoType Style--Pica,Elite,CondensedandExpanded. CLICKINGON:RESULTSIN U.C.PhiDraftPica(10cpi) U.C.ThetaNLQPica(10cpi) U.C.OmegaDraftElite(12cpi) L.C.DeltaNLQElite(12cpi) L.C.PhiDraftCondensed(17.2cpi) U.C.OmicronNLQCondensed(17.2cpi) U.C.EpsilonDraftExpanded(6cpi) U.C.NuNLQExpanded(6cpi) NoteU.C.PhiisusedtocancelandresettodraftPicaorU.C. ThetaforNLQPica. Thus,whenprintedout:- ThisshouldbeNLQPica ThisshouldbeNLQElite ThisshouldbeDraftCondensed ThisshouldbeDraftExpanded ThisshouldbeNLQExpanded Thisshouldbesuperscriptitaliccondensed  Thisshouldbeunderlinedsubscriptcondensed  NotethatthesefeaturesarenotWYSIWYGandcaremustbe takeninlayout.Youonlyget18characterstoalinewithquad sizeprinting. Tryprintingthismemoout. Impressiveinit?     F.A.SHELMERDINE G6WZG 31st.MAY1990 . .. 1ST_PRNTDOT `DEMO DOC 8PRINT DOC WiQREADME 1ST 'jSCREEN TXT lSTARLC10HEX z0STAR LC-10 G6 WZG  EGFHxG H 4 5 x4 5xxSTGSHTSTGSHT---x- !@# %A&* (xWP )WPx *xWM +WMx ,xWP -WPx .xMW /MWx R}R R{Ra^ R{R R@R R}R R\Re^ eR~R R}R R~R R[R R]R R @R R{R R[Ro^ R|R R|Ru^ R|R yR~R R\R R]RcR| R#R R\R R~RfR @R {R }R ~ R|R R\Ra_o_ R]R R[Ra~o~ R\R R|R R~R yR~RY R@R R~R89U1U0 xWP WPx xWM WMx xWP WPx xMW MWx=_+_>_<_ppG6 WZGkkkkhhhafewIMAGESfor youtoplaywith. AlthoughIhavenotgotanINSTALL.PRGforFW+the066030001040000132006000002008000 11 2#1 F0110030001 9[...................................................]0110  THEG6WZGPRINTERCONFIGURATION HavingpurchasedaSTARLC-10PrinterIfoundthattherewas noPRINTER.CFGfilewithmy1STWORDPLUSwhichperformed correctlyandIwouldhavetowritemyown.Asoneofthe faciltiesIrequiredwastoproduceheadingsinlargetypeI decidedtoprovideaccesstothisdirectfromtheGEMdesktop. Further,theLC-10hasfourfountsviz.Courier,Sanserif,Orator withsmallcapitalsandOratorwithlowercasecharacters,which arenotreadilyaccessiblefrom1STWORDPLUS.Idecidetoprovide accesstothesealso.TocompletethefacilityIincludedaccess toDraftPica,NLQPica,DraftElite,NLQElite,DraftCondensed, NLQCondensed,DraftExpanded,NLQExpanded,plusProportional SpacingOn/Off.Someoftheselatterfeaturesareaccessablevia theADDRULERoptionbutIwantedtobeabletousetheseoneven singlewordinalineoftextandalsocompoundthemsothatI couldcallup,forexampleNLQExpandedOrator.Thesearenow availablebypointingandclicking. Themeansofaccessingthesecommandsaregivenbelowand areshownintheaccompanyingSCREEN.TXTfile.Thelattershould bedisplayedasascreen,withouttheWordProcessorloade,then printedoutbyALT/HELPandkeptasanAIDEMEMOIRE. Havingcompletedtheprojectforusewith1stWORDPLUS,it waslogicaltoextendittoprovidethesamefacilitieswiththe popularPublicDomainFIRSTWORDprogram.  ENLARGEDCHARACTERS Thelastthreecharactersofthecharactersetbehindthis window,viz.2,3,and-(FDtoFF)havebeenusedtohold commandcodesfordoublesizeandquadruplesizecharacters. Clickingon2willresultinallsubsequentcharactersbeing printedoutdoubleheight,doublewidth. Clickingon3willresultinallsubsequentcharactersbeing printedoutquadrupleheight,quadruplewidth. Clickingon-willresultinallsubsequentcharactersbeing printedoutnormalsizeie.itcancelscommands2and3. THUS:- ThisisDoubleSize AND ThisisQuadSize  TYPEFOUNTS Thefourpreviousvisiblecharacters(F9toFC)startwith andextendtothecharacterswhichcommandEnlargedCharacter printing(seeabove).Thesefournowfacilitateselectionof theCourier(normal),Sanserif,Oratorwithsmallcapitals,and OratorwithlowercaseTypeFountsinNLQ. ClickingonSelectsTheCourierFount ClickingonSelectsTheSanserifFount ClickingonSelectsTheOratorSmallCapsFount ClickingonSelectsTheOratorLowerCaseFount    TYPESTYLES Similarly,theeightcharactersfromtheGreekPhionwards, (E8toEF)havebeenusedascommandcodesforchangestoType Style...Pica,Elite,CondensedandExpanded. CLICKINGONRESULTSIN DraftPica(10c.p.i.) NLQPica(10c.p.i.) DraftElite(12c.p.i.) NLQElite(12c.p.i.) DraftCondensed(17.2c.p.i.) NLQComdensed(17.2c.p.i.) DraftExpanded(6c.p.i.) NLQExpanded(6c.p.i.) NotethatPhiorThetaareusedtoresettoPicaDraftorNLQ. CHARACTERSPACING TheupperandlowerhalvesoftheIntegralsignlocatedat F4andF5respectivelynowswitchonandoffproportional characterspacing. Clickingonswitchesonproportionalspacing. Clickingonswitchesoffproportionalspacing. Toaccessthesecommandcharacters,thebottomofthewindow shouldbemovedupslightly. NotethatthesefeaturesarenotWYSIWYGandcaremustbe takenwithlayout.Youonlygetaround18characterstoaline (dependingonrulersetting)withquadsizeprinting. Thecommandcharactersarenotprintedout.Theycantherefore beinsertedanywhereinalineoftextafterjustification withoutaffectifthepitchofthetypeyouarecallingupisthe sameasthatoftherestoftheline. YouwillseewhenyouprintthisDEMOoutthat,nomatterif youprintoutinDraftorNLQmode,youcanhaveDraftCourier Pica,NLQCourierPica,DraftSanserifPica,NLQSanserifPica, NLQOrator scPica,NLQOratorlcPica,allinthesametext withoutaffectingjustification. SimilarlyNLQCourierElitecanbemixedwithNLQOratorElite andNLQSanserifElitewithoutproblems. ThesamegoesforNLQCondensedcourierand,forexample,Draft CondensedSanserifetc.AndyoucanstilladdBold,Italics,0990000000064 1 2 9[..................................................] 1STWORDPD G6WZGCONFIGURATION Examplesofprintsizesavailableonthesamepagewiththe G6WZGPrinterconfigurationfortheSTARLC-10Printer. Quadsizeprint Doublesizeprint ExpandedNLQprint Expandeddraftprint StandardPicaprint StandardEliteprint CondensedNLQprint Condenseddraftprint Subscriptprint Condensedsubscriptprint 0990000000064 1 2 9[..................................................] 1STWORDPD G6WZGCONFIGURATION Examplesofprintsizesavailableonthesamepagewiththe G6WZGPrinterconfigurationfortheSTARLC-10Printer. Quadsizeprint Doublesizeprint ExpandedNLQprint Expandeddraftprint StandardPicaprint NLQPicaprint StandardEliteprint NLQEliteprint CondensedNLQprint Condenseddraftprint Subscriptprint Condensedsubscriptprint F.A.SHELMERDINEG6WZG 1stJune1990  0660103030566 9[....................................................]  Thisisasimpletestdocumenttotesttheprinterfile. Thislineisinboldtype. Thislineisinitalicstype. Thislineisinbolditalictype. Thislineisinlighttype. Thislineisinnormalunderlinedtype. Thislineisinboldunderlinedtype. Thislineisinsuperscript(???notWYSIWYG) Thislineisinsubscript(ditto) . '.. NL101_5 DOT (@ASCII HEX )RNL101_5 HEX 1(INSTALL PRG <%TAXAN HEX F%STARLC10DOT P7STARLC10HEX Q)G6_WZG HEX `\0.ARGETYPDOT hARGETYPHEX i-G6_WZG DOT 7`uMTARLC10DON vTARLC10HEN w-STARNL10HEX #*FINAL HEX 01ST_PRNTDOT i~STAR NL-10 (S.T.D.COMMS 1.4)  EGFHxG H 4 5 x4 5EFxxSTGSHTSTGSHT---x- !@# %A&*R|^R|v-><-   0123456789#R#$R$@R@[R[\R\]R]^R^`R`{R{|R|}R}~R~C,R}R{aR^R{R@R}R\eR^eR~R}iR~iR^R~R[R]R @R{R[oR^R|R|uR^R|yR~R\R]cR|R#R\R~fa'i'o'u'R|R\a_o_R]R[aR~oR~R\R|AAOR~'yR~YR@R~=_+_>_<_:-R[**************************************************************** * * Teletype Printer Driver Configuration Table * * This file contains tables defining the code sequences * to be sent to the printer to perform various functions * and to access the characters from codes in the Atari * character set. * **************************************************************** * * Name of printer * =============== * Teletype * * Miscellaneous configurable variables * ==================================== * * 1: printer type, 0=dot matrix, 1=daisy wheel * Note, if the printer type is 0, the following 4 variables are never used. * 2: unit width of one character * 3: unit height of one line * 4: Approximate middle of carriage after formfeed * 5: Carriage shift for bold overstrike * 6: 1 if pause between pages * 0, 0, 0, 0, 0, 0 * * Printer characteristics * ======================= * * This table specifies the printer command sequences. * * 0 * Character width 1, D, A * Linefeed WITH return * 2 * Forward print * 3 * Reverse print * 4 * Vertical tab to line * 5 * Absolute horizontal tab * 6 * Draft bold on * 7 * Draft bold off * 8 * Near Letter Quality (NLQ) bold on * 9 * NLQ bold off * A * Draft italic on * B * Draft italic off * C * NLQ italic on * D * NLQ italic off * E * Draft light on * F * Draft light off * 10 * NLQ light on * 11 * NLQ light off * 12 * Draft superscript on * 13 * Draft superscript off * 14 * NLQ superscript on * 15 * NLQ superscript off * 16 * Draft subscript on * 17 * Draft subscript off * 18 * NLQ subscript on * 19 * NLQ subscript off * 1A * Draft underline on * 1B * Draft underline off * 1C * NLQ underline on * 1D * NLQ underline off * 1E * Formfeed 1F, D * Horizontal initialisation * 20 * Vertical initialisation * 21 * Termination: printer reset 0 * NULL termination byte * * Translation Table * ================= * * This table provides translation from single Atari input bytes into * multiple printer codes, and is useful for printing extraneous * characters such as accented characters etc. All characters are * subjected to translation, but if there is no entry in the table for * a particular code, then the original code is sent to the printer. * * The entries must be arranged in ascending order of Atari input * code. The table is NULL terminated. * * If the table entry contains just the character code, it means * that the character in not printable. 0 * NULL: print a space 1, 7C, 8, 5E * Up arrow: | backspace ^ 2, 7C, 8, 76 * Down arrow: | backspace v 3, 2D, 8, 3E * Right arrow: - backspace > 4, 3C, 8, 2D * Left arrow: - backspace < 5 * No close box 6 * No size box 7 * No full box 8 * No tick 9 * No clock A * No bell B * No musical note E * No LH Atari symbol F * No RH Atari symbol 10, 30 * LCD 0 11, 31 * LCD 1 12, 32 * LCD 2 13, 33 * LCD 3 14, 34 * LCD 4 15, 35 * LCD 5 16, 36 * LCD 6 17, 37 * LCD 7 18, 38 * LCD 8 19, 39 * LCD 9 7F * No triangle 80, 43, 8, 2C * Capital C cedilla: C backspace , 81, 75 * No lower case u umlaut 82, 65 * No lower case e acute 83, 61, 8, 5E * Lower case a circumflex: a backspace ^ 84, 61 * No lower case a umlaut 85, 61, 8, 60 * Lower case a grave: a backspace ` 86, 61 * No lower case a boll 87, 63, 8, 2C * Lower case c cedilla: c backspace , 88, 65, 8, 5E * Lower case e circumflex: e backspace ^ 89, 65 * No lower case e umlaut 8A, 65, 8, 60 * Lower case e grave: e backspace ` 8B, 69 * No lower case i umlaut 8C, 69, 8, 5E * Lower case i circumflex: i backspace ^ 8D, 69, 8, 60 * Lower case i grave: i backspace ` 8E, 41 * No capital A umlaut 8F, 41 * No capital A boll 90, 45 * No capital E acute 91 * No lower case ae dipthong 92 * No capital AE dipthong 93, 6F, 8, 5E * Lower case o circumflex: o backspace ^ 94, 6F * No lower case o umlaut 95, 6F, 8, 60 * Lower case o grave: o backspace ` 96, 75, 8, 5E * Lower case u circumflex: u backspace ^ 97, 75, 8, 60 * Lower case u grave: u backspace ` 98, 79 * No lower case y umlaut 99, 4F * No capital O umlaut 9A, 55 * No capital U umlaut 9B, 63, 8, 7C * c cent: c backspace | 9C * No pound sterling 9D, 59, 8, 2D * Yen: Y backspace - 9E * No esszet 9F, 66 * No lower case swash A0, 61 * No lower case a acute A1, 69 * No lower case i acute A2, 6F * No lower case o acute A3, 75 * No lower case y acute A4, 6E, 8, 7E * Lower case n tilde: n backspace ~ A5, 4E * No capital N tilde A6, 61, 8, 5F * Lower case a underline: a backspace _ A7, 6F, 8, 5F * Lower case o underline: o backspace _ A8 * No inverted ? A9 * No top left corner AA * No top right corner AB * No 1/2 fraction AC * No 1/4 fraction AD * No inverted ! AE * No << AF * No >> B0, 61, 8, 7E * Lower case a tilde: a backspace ~ B1, 6F, 8, 7E * Lower case o tilde: o backspace ~ B2, 4F, 8, 2F * Capital crossed O: O backspace / B3, 6F, 8, 2F * Lower case crossed o: o backspace / B4 * No lower case oe dipthong B5 * No capital OE dipthong B6, 41 * No capital A grave: print A B7, 41 * No capital A tilde: print A B8, 4F * No capital O tilde: print O B9 * No umlaut BA * No acute BB * No dagger BC * No paragraph symbol BD * No copyright symbol BE * No Registered symbol BF * No Trademark symbol C0, 79 * ij ligature: print y C1, 59 * Capital IJ ligature: print Y C2 * No Hebrew... C3 C4 C5 C6 C7 C8 C9 CA CB CC CD CE CF D0 D1 D2 D3 D4 D5 D6 D7 D8 D9 DA DB DC DD * No section mark DE * No dropped circumflex DF * No infinity E0 * No alpha E1 * No esszet E2 * No Greek... E3 E4 E5 E6 E7 E8 E9 EA EB EC ED EE EF F0 * no equivalence sign F1, 2B, 8, 5F * +-: + backspace _ F2, 3E, 8, 5F * >=: > backspace _ F3, 3C, 8, 5F * <=: < backspace _ F4 * No integral top piece F5 * No integral bottom piece F6, 3A, 8, 2D * Division sign: : backspace - F7 * No twiddly = symbol F8 * No degree symbol F9 * No superior bullet FA * No inferior bullet FB * No square root sign FC * No superior n FD * No superior 2 FE * No superior 3 FF * No macron 0 ******** 3-24-86 *********************************************** * * STAR NL-10 Matrix Printer Driver Configuration Table * ( converted from STAR SR-10 Table 3-21-86 ... ) * ( changes: 1B,34 --> 1B,78,1 ; 1B,35 --> 1B,78,0 ) * * This file contains tables defining the code sequences * to be sent to the printer to perform various functions * and to access the characters from codes in the Atari * character set. * **************************************************************** * * Name of printer * =============== * STAR NL-10 (S.T.D.COMMS 1.4) * * Miscellaneous configurable variables * ==================================== * * 1: printer type, 0=dot matrix, 1=daisy wheel * Note if printer type is 0 the following 4 variables are never used. * 2: unit width of one character * 3: unit height of one line * 4: Approximate middle of carriage after formfeed * 5: Carriage shift for bold overstrike * 6: 1 to pause between pages 0, 0, C, 0, 0, 1 * * Printer characteristics * ======================= * * This table specifies the printer command sequences. * If the top bit of a code is set, then this indicates the position * of a parameter passed to the printer. The code whose top bit is set * in this table is added to the parameter passed before being sent to the * printer. It is not used in all command sequences, only in those where * the printer requires a variable value such as the length of a vertical * tab. * * 0 * Character width 1, D, A * Linefeed WITH return * 2 * Forward print * 3 * Reverse print * 4, * Vertical tab to line * 5 * Absolute horizontal tab 6, 1B,45,1B,47 * Draft bold on 7, 1B,46,1B,48 * Draft bold off 8, 1B,78,1,1B,47 * NLQ bold on (NLQ off, Doppelanschlag & fett on) 9, 1B,48 * NLQ bold off A, 1B,34 * Draft italic on B, 1B,35 * Draft italic off C, 1B,78,1,1B,34 * NLQ italic on (NLQ off, Dopp.&italic on) D, 1B,35 * NLQ italic off E, 1B,45 * Draft light on F, 1B,46 * Draft light off 10, 1B,78,0 * NLQ light on (=normal print style) 11, 1B,78,1 * NLQ light off 12, 1B,53,0 * Draft superscript on 13, 1B,54 * Draft superscript off 14, 1B,47,1B,53,0 * NLQ superscript on (NLQ OFF, Dopp.&sup. on) 15, 1B,48,1B,54 * NLQ superscript off 16, 1B,53,1 * Draft subscript on 17, 1B,54 * Draft subscript off 18, 1B,47,1B,53,1 * NLQ subscript on (NLQ off, Dopp.&sub. on) 19, 1B,48,1B,54 * NLQ subscript off 1A, 1B,2D,1 * Draft underline on 1B, 1B,2D,0 * Draft underline off 1C, 1B,2D,1,1B,78,1 * NLQ underline on 1D, 1B,2D,0 * NLQ underline off 1E, C * Formfeed *1F, 12 * Horizontal initialisation *20, 1B, 42, 0, 0, B * Vertical initialisation: VT to line 0 21, 1B, 40 * Termination: printer reset *22, 8 * BACKSPACE 23, D * CARRIAGE RETURN *24, 1B, 43, 71 * form length in lines 25, 1B, 41, 80 * set line feed to N units 26, 1B, 2A, 5 * start graphics (mode 6) 0 * NULL termination byte * * Translation Table * ================= * * This table provides translation from single Atari input bytes into * multiple Epson printer codes, and is useful for printing extraneous * characters such as accented characters etc. All characters are * subjected to translation, but if there is no entry in the table for * a particular code, then the original code is sent to the printer. * * The entries must be arranged in ascending order of Atari input * code. The table is NULL terminated. * 0 * NULL: print a space 1, 1B,52,0, 7C, 8, 5E * Up arrow: USA | backspace USA ^ 2, 1B,52,0, 7C, 8, 76 * Down arrow: USA | backspace USA v 3, 2D, 8, 3E * Right arrow: - backspace > 4, 3C, 8, 2D * Left arrow: - backspace < 5 * No close box 6 * No size box 7 * No full box 8 * No tick 9 * No clock A * No bell B * No musical note E * No LH Atari symbol F * No RH Atari symbol 10, 30 * LCD 0 11, 31 * LCD 1 12, 32 * LCD 2 13, 33 * LCD 3 14, 34 * LCD 4 15, 35 * LCD 5 16, 36 * LCD 6 17, 37 * LCD 7 18, 38 * LCD 8 19, 39 * LCD 9 23, 1B, 52, 0, 23 * # from USA fount 24, 1B, 52, 0, 24 * $ from USA fount 40, 1B, 52, 0, 40 * @ from USA fount 5B, 1B, 52, 0, 5B * [ from USA fount 5C, 1B, 52, 0, 5C * \ from USA fount 5D, 1B, 52, 0, 5D * ] from USA fount 5E, 1B, 52, 0, 5E * ^ from USA fount 60, 1B, 52, 0, 60 * ' from USA fount 7B, 1B, 52, 0, 7B * { from USA fount 7C, 1B, 52, 0, 7C * | from USA fount 7D, 1B, 52, 0, 7D * } from USA fount 7E, 1B, 52, 0, 7E * ~ from USA fount 7F * No triangle 80, 43, 8, 2C * Capital C cedilla: C backspace , 81, 1B, 52, 2, 7D * Lower case u umlaut from German fount 82, 1B, 52, 1, 7B * Lower case e acute from French fount 83, 61, 8, 1B, 52, 0, 5E * Lower case a circumflex: a backspace USA ^ 84, 1B, 52, 2, 7B * Lower case a umlaut from German fount 85, 1B, 52, 1, 40 * Lower case a grave from French fount 86, 1B, 52, 4, 7D * Lower case a boll from Danish 1 fount 87, 1B, 52, 1, 5C * Lower case c cedilla from French fount 88, 65, 8, 1B, 52, 0, 5E * Lower case e circumflex: e backspace USA ^ 89, 65, 8, 1B, 52, 1, 7E * Lower case e umlaut: e backspace French umlaut 8A, 1B, 52, 1, 7D * Lower case e grave from French fount 8B, 69, 8, 1B, 52, 1, 7E * Lower case i umlaut: i backspace French umlaut 8C, 69, 8, 1B, 52, 0, 5E * Lower case i circumflex: i backspace USA ^ 8D, 1B, 52, 6, 7E * Lower case i grave from Italian fount 8E, 1B, 52, 2, 5B * Capital A umlaut from German fount 8F, 1B, 52, 4, 5D * Capital A boll from Danish 1 fount 90, 1B, 52, 9, 40 * Capital E acute from Norwegian fount 91, 1B, 52, 4, 7B * Lower case ae dipthong from Danish 1 fount 92, 1B, 52, 4, 5B * Capital AE dipthong from Danish 1 fount 93, 6F, 8, 1B, 52, 0, 5E * Lower case o circumflex: o backspace USA ^ 94, 1B, 52, 2, 7C * Lower case o umlaut from German fount 95, 1B, 52, 6, 7C * Lower case o grave from Italian fount 96, 75, 8, 1B, 52, 0, 5E * Lower case u circumflex: u backspace USA ^ 97, 1B, 52, 1, 7C * Lower case u grave from French fount 98, 79, 8, 1B, 52, 1, 7E * Lower case y umlaut: y backspace French umlaut 99, 1B, 52, 2, 5C * Capital O umlaut from German fount 9A, 1B, 52, 2, 5D * Capital U umlaut from German fount 9B, 63, 8, 1B, 52, 0, 7C * c cent: c backspace USA | 9C, 1B, 52, 3, 23 * Pound sterling from UK fount 9D, 1B, 52, 8, 5C * Yen from Japanese fount 9E, 1B, 52, 2, 7E * Esszet from German fount 9F, 66 * Lower case swash f: print f A0, 61, 8, 27 * Lower case a acute: a backspace ' A1, 69, 8, 27 * Lower case i acute: i backspace ' A2, 6F, 8, 27 * Lower case o acute: o backspace ' A3, 75, 8, 27 * Lower case u acute: u backspace ' A4, 1B, 52, 7, 7C * Lower case n tilde from Spanish fount A5, 1B, 52, 7, 5C * Capital N tilde from Spanish fount A6, 61, 8, 5F * Lower case a underline: a backspace underline A7, 6F, 8, 5F * Lower case o underline: o backspace underline A8, 1B, 52, 7, 5D * Inverted ? from Spanish fount A9 * No top left corner AA * No top right corner AB * No 1/2 fraction AC * No 1/4 fraction AD, 1B, 52, 7, 5B * Inverted ! from Spanish fount AE * No << AF * No >> B0, 61, 8, 1B, 52, 0, 7E * Lower case a tilde: a backspace USA ~ B1, 6F, 8, 1B, 52, 0, 7E * Lower case o tilde: o backspace USA ~ B2, 1B, 52, 4, 5C * Capital crossed O from Danish 1 fount B3, 1B, 52, 4, 7C * Lower case crossed o from Danish 1 fount B4 * No lower case oe dipthong B5 * No capital OE dipthong B6, 41 * No capital A grave: print A B7, 41 * No capital A tilde: print A B8, 4F * No capital O tilde: print O B9, 1B, 52, 1, 7E * Umlaut from French fount BA, 27 * Acute: print ' BB * No dagger BC * No paragraph symbol BD * No copyright symbol BE * No Registered symbol BF * No Trademark symbol C0, 79, 8, 1B, 52, 1, 7E * ij ligature: y backspace French umlaut C1, 59 * Capital IJ ligature: print Y C2 * No Hebrew... C3 C4 C5 C6 C7 C8 C9 CA CB CC CD CE CF D0 D1 D2 D3 D4 D5 D6 D7 D8 D9 DA DB DC DD, 1B, 52, 2, 40 * Section mark from German fount DE * No dropped circumflex DF * No infinity E0 * No alpha E1, 1B, 52, 2, 7E * Esszet from German fount E2 * No Greek.... E3 E4 E5 E6 E7 E8 E9 EA EB EC ED EE EF F0, 3D, 8, 5F * Equivalence: = backspace _ F1, 2B, 8, 5F * +-: + backspace _ F2, 3E, 8, 5F * >=: > backspace _ F3, 3C, 8, 5F * <=: < backspace _ F4 * No integral top piece F5 * No integral bottom piece F6, 3A, 8, 2D * Division sign: : backspace - F7 * No twiddly = symbol F8, 1B, 52, 1, 5B * Degree symbol from French fount F9 * No superior bullet FA * No inferior bullet FB * No square root sign FC * No superior n FD * No superior 2 FE * No superior 3 FF * No macron 0 `%r&o + ЫЫO// Bg?<JNA IK"Z~|N". H0@C;g,. H0@C:g. H0@C|g G` F g FN^Nu GN^NuNV/./. /.tN /.tN\X g/HztNPN^Nu[3][Error writing binary file]NVtN\=H/. 0nCA"_  n R"HA: 0n"F/ n T/tNpP/. HztN:P/. /.tN:PN^Nu\NVHxtNXN^NuNVHxG/./. tN N^NuNVJmftNT F;HN^NuNVtNN^NuNV/-NXN^NuNV/./-NBPN^NuNV/./-NPHx /-NBPN^NuNVHx$/N:P-H fA+H GN^Nu/. /./.NT o nN^Nu GN^NuNV n H0@/NrX-H n`H G-H F-H`Z F-HA-H`HA-HA-H`4A+HN^Nu`$NRWA`/.Hz@NP gB nCN-HJg/HxPHxHz/N+H m-H`/.HzNP g$ nCN-H nC-H`/.HzNP f/.HzNP f G` F g2JfA-H` A-H nCN-H`N n"Ff*HxA/.NPHxX f, nHhHx> n/NP"_" g AN^Nu nX/NX nHh nHh nX"H G""_""_" GN^NuNV n C fHx /.NP/. /.NP n C f/.N`X g F` G g /.NX n h g AN^Nu n N^NuNV n Jg n R H0@//.NBP`N^NuNV/.NX-H nC f8/.NX-H nC f n-H`/./.NP nCf8/.NX-H nCf n-H`/./.NP nN^NuNV n hCf n Cg G` F g AN^Nu nC n "N^NuNV n-HS J o@/.NX-HCf`$ nR"H n C f``"n G "n nf GN^Nu nN^NuNVJf mN^Nu n hN^NuNV nC G"N^NuNV n h g/.NX g AN^Nu GN^NuNV n h"FN f nCA"AN^Nu n h-HCg nCA" nN^Nu/.N`X gX nP"P n hm>/-NX nHh n/ nX/HxN "_" nP"H G"`^/.N>X g n/NXN^Nu nP"P n hm/.N X g F` G g AN^Nu nX"P nP$H PR-H nH0@CNN^NuNVHx? n/Hx nX/N-HJo nC n" nC G"`6 nC G"Jf nCA"` nC n" nP"H G" n hN^NuNV n hCN f nCA"AN^Nu/.N`XNz g/.N>X g F` G g n//. NP n N^Nu nX"P nP$H PR-H"n n  nC F" nP"PAm/.NX g F` G g AN^Nu n N^NuNV/.N`X g8 nX P-H"n nP P"H G  n//.NP`rHx@ n/ nP/ nX/N-HJl nC n"`2"n nP Pl nCA"` nC G" nP/ nC G""_" n hN^NuNVHzNX. H0@/NXN^NuabortedNVNHxL. H0@/NPN^NuNV m-HJg/.NX n h -H`NN^NuNV/.NX/. NXN^NuNV"n nN//N:PN^NuNV/./N:PN^NuNV n CCN-HHxH/.NP-HJf GN^Nu nR"HA  n"FN g nR"HA  n-HJg" n S o nR"H G ` nN^NuNVS nH0@-H nCfS nH0@-H nCfHxI/.NP GN^NuNVHxHHxNPN^NuNV"nA _ @N^NuNV n Jg, n H2@. H0@f n N^NuR n ` GN^NuNV n H2@ nH0@f$ n Jf GN^NuR n R n` n H2@ nH0@ IN^NuNV n-H nS oH nR"H n R H0@  g` nS o nR"H G ``"n G  nN^NuNV"nAzn"nAam F` G g"nA IN^Nu nN^NuNV"n F I-HR nJg`"n n IN^NuNV n Jg@ n R H0@/NrX/ nRH0@/NrX"_g GN^Nu` nH0@"GW @N^NuNV G-HJgtHnHnHnHnNJngT/NX///HnHnHnHnN//NP-H nCf /NX nN^NuHx NX glHxNXCN-H nC f A -HJg8 nCfNCN-H` nCf /NX nN^NuNVHmA"_"AX/A"_"AP/A"_"AHh A<"_"AHhAJ"_"AHhAR"_"A+HHx NXXAf"R/.HzHmN -H`/.HzHmN -H`n"mAlC mR"H n"/.NX-H`$NF H<^>``JfHz1Hz2NP+HJf m+HN^NuCON:WrawCON:RNV nJg< nH0@/NNX g nR"H G  nN^NuR n` nN^NuNV n-H/.NX-H/././. NP"_" nN^NuA 0g C" ӑ`Nu *, **************************************************************** * * Epson LX-80 Matrix Printer Driver Configuration Table * * This file contains tables defining the code sequences * to be sent to the printer to perform various functions * and to access the characters from codes in the Atari * character set. * **************************************************************** * * Name of printer * =============== * Epson LX-80 (NLQ) * * Miscellaneous configurable variables * ==================================== * * 1: printer type, 0=dot matrix, 1=daisy wheel * Note if printer type is 0 the following 4 variables are never used. * 2: unit width of one character * 3: unit height of one line * 4: Approximate middle of carriage after formfeed * 5: Carriage shift for bold overstrike * 6: 1 to pause between pages * 0 , 0, 0, 0, 0, 1 * * Printer characteristics * ======================= * * This table specifies the printer command sequences. * If the top bit of a code is set, then this indicates the position * of a parameter passed to the printer. The code whose top bit is set * in this table is added to the parameter passed before being sent to the * printer. It is not used in all command sequences, only in those where * the printer requires a variable value such as the length of a vertical * tab. * * 0 * Character width 1, D, A * Linefeed WITH return * 2 * Forward print * 3 * Reverse print 4, 1B, 42, 80, 0, B * Vertical tab to line (FX or LX) * 5 * Absolute horizontal tab 6, 1B, 45 * Draft bold on 7, 1B, 46 * Draft bold off 8, 1B, 45 * Near Letter Quality (NLQ) bold on (LX80) 9, 1B, 46 * NLQ bold off A, 1B, 34 * Draft italic on B, 1B, 35 * Draft italic off C, 1B, 78, 0, 1B, 34, 1B, 47 * NLQ italic on D, 1B, 48, 1B, 35, 1B, 78, 1 * NLQ italic off * E * Draft light on * F * Draft light off 10, 1B, 78, 0 * NLQ light on 11, 1B, 78, 1 * NLQ light off 12, 1B, 53, 0 * Draft superscript on 13, 1B, 54 * Draft superscript off 14, 1B, 78, 0, 1B, 53, 0 * NLQ superscript on 15, 1B, 54, 1B, 78, 1 * NLQ superscript off 16, 1B, 53, 1 * Draft subscript on 17, 1B, 54 * Draft subscript off 18, 1B, 78, 0, 1B, 53, 1 * NLQ subscript on 19, 1B, 54, 1B, 78, 1 * NLQ subscript off 1A, 1B, 2D, 1 * Draft underline on 1B, 1B, 2D, 0 * Draft underline off 1C, 1B, 2D, 1 * NLQ underline on 1D, 1B, 2D, 0 * NLQ underline off 1E, C * Formfeed 1F, 12 * Horizontal initialisation * 20, C * Vertical initialisation 21, 1B, 40 * Termination: printer reset 0 * NULL termination byte * * Translation Table * ================= * * This table provides translation from single Atari input bytes into * multiple Epson printer codes, and is useful for printing extraneous * characters such as accented characters etc. All characters are * subjected to translation, but if there is no entry in the table for * a particular code, then the original code is sent to the printer. * * The entries must be arranged in ascending order of Atari input * code. The table is NULL terminated. * 0 * NULL: print a space 1, 1B, 52, 0, 7C, 8, 5E * Up arrow: USA | backspace USA ^ 2, 1B, 52, 0, 7C, 8, 76 * Down arrow: USA | backspace USA v 3, 2D, 8, 3E * Right arrow: - backspace > 4, 3C, 8, 2D * Left arrow: - backspace < 5 * No close box 6 * No size box 7 * No full box 8 * No tick 9 * No clock A * No bell B * No musical note E * No LH Atari symbol F * No RH Atari symbol 10, 30 * LCD 0 11, 31 * LCD 1 12, 32 * LCD 2 13, 33 * LCD 3 14, 34 * LCD 4 15, 35 * LCD 5 16, 36 * LCD 6 17, 37 * LCD 7 18, 38 * LCD 8 19, 39 * LCD 9 23, 1B, 52, 0, 23 * # from USA fount 24, 1B, 52, 0, 24 * $ from USA fount 40, 1B, 52, 0, 40 * @ from USA fount 5B, 1B, 52, 0, 5B * [ from USA fount 5C, 1B, 52, 0, 5C * \ from USA fount 5D, 1B, 52, 0, 5D * ] from USA fount 5E, 1B, 52, 0, 5E * ^ from USA fount 60, 1B, 52, 0, 60 * ' from USA fount 7B, 1B, 52, 0, 7B * { from USA fount 7C, 1B, 52, 0, 7C * | from USA fount 7D, 1B, 52, 0, 7D * } from USA fount 7E, 1B, 52, 0, 7E * ~ from USA fount 7F * No triangle 80, 43, 8, 2C * Capital C cedilla: C backspace , 81, 1B, 52, 2, 7D * Lower case u umlaut from German fount 82, 1B, 52, 1, 7B * Lower case e acute from French fount 83, 61, 8, 1B, 52, 0, 5E * Lower case a circumflex: a backspace USA ^ 84, 1B, 52, 2, 7B * Lower case a umlaut from German fount 85, 1B, 52, 1, 40 * Lower case a grave from French fount 86, 1B, 52, 4, 7D * Lower case a boll from Danish 1 fount 87, 1B, 52, 1, 5C * Lower case c cedilla from French fount 88, 65, 8, 1B, 52, 0, 5E * Lower case e circumflex: e backspace USA ^ 89, 65, 8, 1B, 52, 1, 7E * Lower case e umlaut: e backspace French umlaut 8A, 1B, 52, 1, 7D * Lower case e grave from French fount 8B, 69, 8, 1B, 52, 1, 7E * Lower case i umlaut: i backspace French umlaut 8C, 69, 8, 1B, 52, 0, 5E * Lower case i circumflex: i backspace USA ^ 8D, 1B, 52, 6, 7E * Lower case i grave from Italian fount 8E, 1B, 52, 2, 5B * Capital A umlaut from German fount 8F, 1B, 52, 4, 5D * Capital A boll from Danish 1 fount 90, 1B, 52, 9, 40 * Capital E acute from Norwegian fount 91, 1B, 52, 4, 7B * Lower case ae dipthong from Danish 1 fount 92, 1B, 52, 4, 5B * Capital AE dipthong from Danish 1 fount 93, 6F, 8, 1B, 52, 0, 5E * Lower case o circumflex: o backspace USA ^ 94, 1B, 52, 2, 7C * Lower case o umlaut from German fount 95, 1B, 52, 6, 7C * Lower case o grave from Italian fount 96, 75, 8, 1B, 52, 0, 5E * Lower case u circumflex: u backspace USA ^ 97, 1B, 52, 1, 7C * Lower case u grave from French fount 98, 79, 8, 1B, 52, 1, 7E * Lower case y umlaut: y backspace French umlaut 99, 1B, 52, 2, 5C * Capital O umlaut from German fount 9A, 1B, 52, 2, 5D * Capital U umlaut from German fount 9B, 63, 8, 1B, 52, 0, 7C * c cent: c backspace USA | 9C, 1B, 52, 3, 23 * Pound sterling from UK fount 9D, 1B, 52, 8, 5C * Yen from Japanese fount 9E, 1B, 52, 2, 7E * Esszet from German fount 9F, 66 * Lower case swash f: print f A0, 61, 8, 27 * Lower case a acute: a backspace ' A1, 69, 8, 27 * Lower case i acute: i backspace ' A2, 6F, 8, 27 * Lower case o acute: o backspace ' A3, 75, 8, 27 * Lower case u acute: u backspace ' A4, 1B, 52, 7, 7C * Lower case n tilde from Spanish fount A5, 1B, 52, 7, 5C * Capital N tilde from Spanish fount A6, 61, 8, 5F * Lower case a underline: a backspace underline A7, 6F, 8, 5F * Lower case o underline: o backspace underline A8, 1B, 52, 7, 5D * Inverted ? from Spanish fount A9 * No top left corner AA * No top right corner AB * No 1/2 fraction AC * No 1/4 fraction AD, 1B, 52, 7, 5B * Inverted ! from Spanish fount AE * No << AF * No >> B0, 61, 8, 1B, 52, 0, 7E * Lower case a tilde: a backspace USA ~ B1, 6F, 8, 1B, 52, 0, 7E * Lower case o tilde: o backspace USA ~ B2, 1B, 52, 4, 5C * Capital crossed O from Danish 1 fount B3, 1B, 52, 4, 7C * Lower case crossed o from Danish 1 fount B4 * No lower case oe dipthong B5 * No capital OE dipthong B6, 41 * No capital A grave: print A B7, 41 * No capital A tilde: print A B8, 4F * No capital O tilde: print O B9, 1B, 52, 1, 7E * Umlaut from French fount BA, 27 * Acute: print ' BB * No dagger BC * No paragraph symbol BD * No copyright symbol BE * No Registered symbol BF * No Trademark symbol C0, 79, 8, 1B, 52, 1, 7E * ij ligature: y backspace French umlaut C1, 59 * Capital IJ ligature: print Y C2 * No Hebrew... C3 C4 C5 C6 C7 C8 C9 CA CB CC CD CE CF D0 D1 D2 D3 D4 D5 D6 D7 D8 D9 DA DB DC DD, 1B, 52, 2, 40 * Section mark from German fount DE * No dropped circumflex DF * No infinity E0 * No alpha E1, 1B, 52, 2, 7E * Esszet from German fount E2 * No Greek.... E3 E4 E5 E6 E7 E8 E9 EA EB EC ED EE EF F0, 3D, 8, 5F * Equivalence: = backspace _ F1, 2B, 8, 5F * +-: + backspace _ F2, 3E, 8, 5F * >=: > backspace _ F3, 3C, 8, 5F * <=: < backspace _ F4 * No integral top piece F5 * No integral bottom piece F6, 3A, 8, 2D * Division sign: : backspace - F7 * No twiddly = symbol F8, 1B, 52, 1, 5B * Degree symbol from French fount F9 * No superior bullet FA * No inferior bullet FB * No square root sign FC * No superior n FD * No superior 2 FE * No superior 3 FF * No macron 0 STAR LC-10 (G6 WZG)  EGFHxG H 4 5 x4 5EFxxSTGSHTSTGSHT---x- !@# %A&*R|^R|v-><-   0123456789#R#$R$@R@[R[\R\]R]^R^`R`{R{|R|}R}~R~C,R}R{aR^R{R@R}R\eR^eR~R}iR~iR^R~R[R]R @R{R[oR^R|R|uR^R|yR~R\R]cR|R#R\R~fa'i'o'u'R|R\a_o_R]R[aR~oR~R\R|AAOR~'yR~YR@R~=_+_>_<_:-R[******** 5-26-90 *********************************************** * * * STAR LC-10 Matrix Printer Driver Configuration Table * * ( converted from EPSON LQ-800 Table 26 MAY 1990 ) * * ( by F.A.SHELMERDINE G6 WZG ) * * * * This file contains tables defining the code sequences * * to be sent to the printer to perform various functions * * and to access the characters from codes in the Atari * * character set. * * * **************************************************************** * * Name of printer * =============== * STAR LC-10 (G6 WZG) * * Miscellaneous configurable variables * ==================================== * * 1: printer type, 0=dot matrix, 1=daisy wheel * Note if printer type is 0 the following 4 variables are never used. * 2: unit width of one character * 3: unit height of one line * 4: Approximate middle of carriage after formfeed * 5: Carriage shift for bold overstrike * 6: 1 to pause between pages 0, 0, C, 0, 0, 1 * * Printer characteristics * ======================= * * This table specifies the printer command sequences. * If the top bit of a code is set, then this indicates the position * of a parameter passed to the printer. The code whose top bit is set * in this table is added to the parameter passed before being sent to the * printer. It is not used in all command sequences, only in those where * the printer requires a variable value such as the length of a vertical * tab. * * 0 * Character width 1, D, A * Linefeed WITH return * 2 * Forward print * 3 * Reverse print * 4, * Vertical tab to line * 5 * Absolute horizontal tab 6, 1B,45,1B,47 * Draft bold on 7, 1B,46,1B,48 * Draft bold off 8, 1B,78,1,1B,47 * NLQ bold on (NLQ off, Doppelanschlag & fett on) 9, 1B,48 * NLQ bold off A, 1B,34 * Draft italic on B, 1B,35 * Draft italic off C, 1B,78,1,1B,34 * NLQ italic on (NLQ off, Dopp.&italic on) D, 1B,35 * NLQ italic off E, 1B,45 * Draft light on F, 1B,46 * Draft light off 10, 1B,78,0 * NLQ light on (=normal print style) 11, 1B,78,1 * NLQ light off 12, 1B,53,0 * Draft superscript on 13, 1B,54 * Draft superscript off 14, 1B,47,1B,53,0 * NLQ superscript on (NLQ OFF, Dopp.&sup. on) 15, 1B,48,1B,54 * NLQ superscript off 16, 1B,53,1 * Draft subscript on 17, 1B,54 * Draft subscript off 18, 1B,47,1B,53,1 * NLQ subscript on (NLQ off, Dopp.&sub. on) 19, 1B,48,1B,54 * NLQ subscript off 1A, 1B,2D,1 * Draft underline on 1B, 1B,2D,0 * Draft underline off 1C, 1B,2D,1,1B,78,1 * NLQ underline on 1D, 1B,2D,0 * NLQ underline off 1E, C * Formfeed *1F, 12 * Horizontal initialisation *20, 1B, 42, 0, 0, B * Vertical initialisation: VT to line 0 21, 1B, 40 * Termination: printer reset *22, 8 * BACKSPACE 23, D * CARRIAGE RETURN *24, 1B, 43, 71 * form length in lines 25, 1B, 41, 80 * set line feed to N units 26, 1B, 2A, 5 * start graphics (mode 6) 0 * NULL termination byte * * Translation Table * ================= * * This table provides translation from single Atari input bytes into * multiple Epson printer codes, and is useful for printing extraneous * characters such as accented characters etc. All characters are * subjected to translation, but if there is no entry in the table for * a particular code, then the original code is sent to the printer. * * The entries must be arranged in ascending order of Atari input * code. The table is NULL terminated. * 0 * NULL: print a space 1, 1B,52,0, 7C, 8, 5E * Up arrow: USA | backspace USA ^ 2, 1B,52,0, 7C, 8, 76 * Down arrow: USA | backspace USA v 3, 2D, 8, 3E * Right arrow: - backspace > 4, 3C, 8, 2D * Left arrow: - backspace < 5 * No close box 6 * No size box 7 * No full box 8 * No tick 9 * No clock A * No bell B * No musical note E * No LH Atari symbol F * No RH Atari symbol 10, 30 * LCD 0 11, 31 * LCD 1 12, 32 * LCD 2 13, 33 * LCD 3 14, 34 * LCD 4 15, 35 * LCD 5 16, 36 * LCD 6 17, 37 * LCD 7 18, 38 * LCD 8 19, 39 * LCD 9 23, 1B, 52, 0, 23 * # from USA fount 24, 1B, 52, 0, 24 * $ from USA fount 40, 1B, 52, 0, 40 * @ from USA fount 5B, 1B, 52, 0, 5B * [ from USA fount 5C, 1B, 52, 0, 5C * \ from USA fount 5D, 1B, 52, 0, 5D * ] from USA fount 5E, 1B, 52, 0, 5E * ^ from USA fount 60, 1B, 52, 0, 60 * ' from USA fount 7B, 1B, 52, 0, 7B * { from USA fount 7C, 1B, 52, 0, 7C * | from USA fount 7D, 1B, 52, 0, 7D * } from USA fount 7E, 1B, 52, 0, 7E * ~ from USA fount 7F * No triangle 80, 43, 8, 2C * Capital C cedilla: C backspace , 81, 1B, 52, 2, 7D * Lower case u umlaut from German fount 82, 1B, 52, 1, 7B * Lower case e acute from French fount 83, 61, 8, 1B, 52, 0, 5E * Lower case a circumflex: a backspace USA ^ 84, 1B, 52, 2, 7B * Lower case a umlaut from German fount 85, 1B, 52, 1, 40 * Lower case a grave from French fount 86, 1B, 52, 4, 7D * Lower case a boll from Danish 1 fount 87, 1B, 52, 1, 5C * Lower case c cedilla from French fount 88, 65, 8, 1B, 52, 0, 5E * Lower case e circumflex: e backspace USA ^ 89, 65, 8, 1B, 52, 1, 7E * Lower case e umlaut: e backspace French umlaut 8A, 1B, 52, 1, 7D * Lower case e grave from French fount 8B, 69, 8, 1B, 52, 1, 7E * Lower case i umlaut: i backspace French umlaut 8C, 69, 8, 1B, 52, 0, 5E * Lower case i circumflex: i backspace USA ^ 8D, 1B, 52, 6, 7E * Lower case i grave from Italian fount 8E, 1B, 52, 2, 5B * Capital A umlaut from German fount 8F, 1B, 52, 4, 5D * Capital A boll from Danish 1 fount 90, 1B, 52, 9, 40 * Capital E acute from Norwegian fount 91, 1B, 52, 4, 7B * Lower case ae dipthong from Danish 1 fount 92, 1B, 52, 4, 5B * Capital AE dipthong from Danish 1 fount 93, 6F, 8, 1B, 52, 0, 5E * Lower case o circumflex: o backspace USA ^ 94, 1B, 52, 2, 7C * Lower case o umlaut from German fount 95, 1B, 52, 6, 7C * Lower case o grave from Italian fount 96, 75, 8, 1B, 52, 0, 5E * Lower case u circumflex: u backspace USA ^ 97, 1B, 52, 1, 7C * Lower case u grave from French fount 98, 79, 8, 1B, 52, 1, 7E * Lower case y umlaut: y backspace French umlaut 99, 1B, 52, 2, 5C * Capital O umlaut from German fount 9A, 1B, 52, 2, 5D * Capital U umlaut from German fount 9B, 63, 8, 1B, 52, 0, 7C * c cent: c backspace USA | 9C, 1B, 52, 3, 23 * Pound sterling from UK fount 9D, 1B, 52, 8, 5C * Yen from Japanese fount 9E, 1B, 52, 2, 7E * Esszet from German fount 9F, 66 * Lower case swash f: print f A0, 61, 8, 27 * Lower case a acute: a backspace ' A1, 69, 8, 27 * Lower case i acute: i backspace ' A2, 6F, 8, 27 * Lower case o acute: o backspace ' A3, 75, 8, 27 * Lower case u acute: u backspace ' A4, 1B, 52, 7, 7C * Lower case n tilde from Spanish fount A5, 1B, 52, 7, 5C * Capital N tilde from Spanish fount A6, 61, 8, 5F * Lower case a underline: a backspace underline A7, 6F, 8, 5F * Lower case o underline: o backspace underline A8, 1B, 52, 7, 5D * Inverted ? from Spanish fount A9 * No top left corner AA * No top right corner AB * No 1/2 fraction AC * No 1/4 fraction AD, 1B, 52, 7, 5B * Inverted ! from Spanish fount AE * No << AF * No >> B0, 61, 8, 1B, 52, 0, 7E * Lower case a tilde: a backspace USA ~ B1, 6F, 8, 1B, 52, 0, 7E * Lower case o tilde: o backspace USA ~ B2, 1B, 52, 4, 5C * Capital crossed O from Danish 1 fount B3, 1B, 52, 4, 7C * Lower case crossed o from Danish 1 fount B4 * No lower case oe dipthong B5 * No capital OE dipthong B6, 41 * No capital A grave: print A B7, 41 * No capital A tilde: print A B8, 4F * No capital O tilde: print O B9, 1B, 52, 1, 7E * Umlaut from French fount BA, 27 * Acute: print ' BB * No dagger BC * No paragraph symbol BD * No copyright symbol BE * No Registered symbol BF * No Trademark symbol C0, 79, 8, 1B, 52, 1, 7E * ij ligature: y backspace French umlaut C1, 59 * Capital IJ ligature: print Y C2 * No Hebrew... C3 C4 C5 C6 C7 C8 C9 CA CB CC CD CE CF D0 D1 D2 D3 D4 D5 D6 D7 D8 D9 DA DB DC DD, 1B, 52, 2, 40 * Section mark from German fount DE * No dropped circumflex DF * No infinity E0 * No alpha E1, 1B, 52, 2, 7E * Esszet from German fount E2 * No Greek.... E3 E4 E5 E6 E7 E8 E9 EA EB EC ED EE EF F0, 3D, 8, 5F * Equivalence: = backspace _ F1, 2B, 8, 5F * +-: + backspace _ F2, 3E, 8, 5F * >=: > backspace _ F3, 3C, 8, 5F * <=: < backspace _ F4 * No integral top piece F5 * No integral bottom piece F6, 3A, 8, 2D * Division sign: : backspace - F7 * No twiddly = symbol F8, 1B, 52, 1, 5B * Degree symbol from French fount F9 * No superior bullet FA * No inferior bullet FB * No square root sign FC * No superior n FD * No superior 2 FE * No superior 3 FF * No macron 0 ***************************************************************** * * * * * * * STAR LC 10 PRINTER CONFIGURATION * * ==================================== * * Written for 1stWord.PD by F.A.SHELMERDINE G6.WZG * * ( Includes large characters & variable Type Styles ) * * This file contains configuration details for the printer * * described below. To modify the printer configuration, * * you must: * * * * (a) Read the chapter PRINTER CONFIGURATION in your User * * Manual - THOROUGHLY! * * * * (b) Edit this file using 1st Word Plus to make the * * required changes (all values are HEXADECIMAL). * * * * (c) Run the INSTALL program to install the new driver. * * * * Consult your User Manual for details of how to load your * * custom driver from the 1st Word Plus desktop, and how to * * make it your default printer. * * * * Copyright (C) 1986, GST Holdings Ltd * * * ***************************************************************** * Printer name * ============ * * For display above the font table on the * 1st Word Plus desktop (max 32 characters) STAR LC-10 G6 WZG * Configuration variables * ======================= * * These six variables define certain printer * configuration details required by 1st Word Plus: * * (1) 1 for microspacing daisywheel, else 0 * (2) Character width in printer units (daisy) * (3) Linefeed height in printer units * (4) Mid-carriage (daisy) pixels/inch (matrix) * (5) Bold offset in printer units (daisy) * (6) 1 to pause printing between pages, else 0 0, 0, C, 0, 0, 1 * Printer characteristics * ======================= * * This table defines values to be sent to the * printer by 1st Word Plus to control its operation. * * An entry consists of: * * (1) Function number (these must be kept in order) * (2) Command bytes (hex commands and placeholders) * * A placeholder has the top bit set and is substituted * by an actual value by 1st Word Plus when printing. * * Lines preceded by an asterisk are commented out. * 0 * Character width 1, D, A * Carriage return and line feed * 2 * Forward print * 3 * Reverse print * 4, * Vertical tab to line * 5 * Absolute horizontal tab 6, 1B, 45, 1B, 47 * Draft bold on 7, 1B, 46, 1B, 48 * Draft bold off 8, 1B, 78, 1, 1B, 47 * NLQ bold on 9, 1B, 48 * NLQ bold off A, 1B, 34 * Draft italic on B, 1B, 35 * Draft italic off C, 1B, 78, 1, 1B, 34 * NLQ italic on D, 1B, 35 * NLQ italic off * E * Draft light on * F * Draft light off 10, 1B, 78, 0 * NLQ light on 11, 1B, 78, 1 * NLQ light off 12, 1B, 53, 0 * Draft superscript on 13, 1B, 54 * Draft superscript off 14, 1B, 47, 1B, 53, 0 * NLQ superscript on 15, 1B, 48, 1B, 54 * NLQ superscript off 16, 1B, 53, 1 * Draft subscript on 17, 1B, 54 * Draft subscript off 18, 1B, 47, 1B, 53, 1 * NLQ subscript on 19, 1B, 48, 1B, 54 * NLQ subscript off 1A, 1B, 2D, 1 * Draft underline on 1B, 1B, 2D, 0 * Draft underline off 1C, 1B, 2D, 1, 1B, 78, 1 * NLQ underline on 1D, 1B, 2D, 0 * NLQ underline off 1E, C * Formfeed *1F, 12 * Horizontal initialization *20, 1B, 42, 0, 0, B * Vertical initialization 21, 1B, 40 * Termination: printer reset *22, 8 * Backspace 23, D * Carriage return *24, 1B, 43, 71 * Form length in lines 25, 1B, 41, 80 * Set line feed to N units 26, 1B, 2A, 5 * Start graphics (mode 5) * 27 * Reserved 28, 1B,78,0,12,1B,57,0,1B,50 * Draft Pica (10 cpi) 29, 12,1B,57,0,1B,50,1B,78,1 * NLQ Pica (10 cpi) 2A, 1B,78,0,12,1B,57,0,1B,4D * Draft Elite (12 cpi) * 2B * NLQ Elite (12 cpi) 2C, 1B,78,0,1B,57,0,1B,50,F * Draft Condensed (17.2 cpi) * 2D * NLQ Condensed (17.2 cpi) 2E, 1B,78,0,12,1B,4D,1B,57,1 * Draft Expanded ( 6 cpi) * 2F * NLQ Expanded ( 6 cpi) * 30 * Black ink * 31 * Magenta ink * 32 * Cyan ink * 33 * Yellow ink 0 * NULL termination byte * Translation Table * ================= * * This table is used to translate the ST * character codes for output to the printer. * * Each entry consists of: * * (1) ST character code (these must be in order) * (2) The (possibly null) byte string to be output * * ST character codes with a NULL translation * string are printed as spaces. * * ST character codes NOT in the table are sent * directly to the printer without translation. 7F *  - N/A 80 * - N/A 81, 1B, 52, 2, 7D, 1B, 52, 0 * - German 82, 1B, 52, 1, 7B, 1B, 52, 0 * - French 83, 61, 8, 5E * - a BS ^ 84, 1B, 52, 2, 7B, 1B, 52, 0 * - German 85, 1B, 52, 1, 40, 1B, 52, 0 * - French 86, 1B, 52, 4, 7D, 1B, 52, 0 * - Danish 1 87, 1B, 52, 1, 5C, 1B, 52, 0 * - French 88, 65, 8, 5E * - e BS ^ 89, 65, 8,1B,52,1,7E,1B,52,0 * - e BS French 8A, 1B, 52, 1, 7D, 1B, 52, 0 * - French 8B * - N/A 8C * - N/A 8D, 1B, 52, 6, 7E, 1B, 52, 0 * - Italian 8E, 1B, 52, 2, 5B, 1B, 52, 0 * - German 8F, 1B, 52, 4, 5D, 1B, 52, 0 * - Danish 1 90, 1B, 52, 9, 40, 1B, 52, 0 * - Norwegian 91, 1B, 52, 4, 7B, 1B, 52, 0 * - Danish 1 92, 1B, 52, 4, 5B, 1B, 52, 0 * - Danish 1 93, 6F, 8, 5E * - o BS ^ 94, 1B, 52, 2, 7C, 1B, 52, 0 * - German 95, 1B, 52, 6, 7C, 1B, 52, 0 * - Italian 96, 75, 8, 5E * - u BS ^ 97, 1B, 52, 1, 7C, 1B, 52, 0 * - French 98, 79, 8,1B,52,1,7E,1B,52,0 * - y BS French 99, 1B, 52, 2, 5C, 1B, 52, 0 * - German 9A, 1B, 52, 2, 5D, 1B, 52, 0 * - German 9B * - N/A 9C, 1B, 52, 3, 23, 1B, 52, 0 * - UK 9D, 1B, 52, 8, 5C, 1B, 52, 0 * - Japanese 9E, 1B, 52, 2, 7E, 1B, 52, 0 * - German 9F, 66 * - f A0 * - N/A A1 * - N/A A2 * - N/A A3 * - N/A A4, 1B, 52, 7, 7C, 1B, 52, 0 * - Spanish A5, 1B, 52, 7, 5C, 1B, 52, 0 * - Spanish A6, 61, 8, 5F * - a BS _ A7, 6F, 8, 5F * - o BS _ A8, 1B, 52, 7, 5D, 1B, 52, 0 * - Spanish A9 * - N/A AA * - N/A AB * - N/A AC * - N/A AD, 1B, 52, 7, 5B, 1B, 52, 0 * - Spanish AE * - N/A AF * - N/A B0, 61, 8, 7E * - a BS ~ B1, 6F, 8, 7E * - o BS ~ B2, 1B, 52, 4, 5C, 1B, 52, 0 * - Danish 1 B3, 1B, 52, 4, 7C, 1B, 52, 0 * - Danish 1 B4 * - N/A B5 * - N/A B6 * - N/A B7 * - N/A B8 * - N/A B9, 1B, 52, 1, 7E, 1B, 52, 0 * - French BA * - N/A BB * - N/A BC * - N/A BD * - N/A BE * - N/A BF * - N/A C0, 79, 8,1B,52,1,7E,1B,52,0 * - y BS French C1, 59 * - Y C2 * - N/A C3 * - N/A C4 * - N/A C5 * - N/A C6 * - N/A C7 * - N/A C8 * - N/A C9 * - N/A CA * - N/A CB * - N/A CC * - N/A CD * - N/A CE * - N/A CF * - N/A D0 * - N/A D1 * - N/A D2 * - N/A D3 * - N/A D4 * - N/A D5 * - N/A D6 * - N/A D7 * - N/A D8 * - N/A D9 * - N/A DA * - N/A DB * - N/A DC * - N/A DD, 1B, 52, 2, 40, 1B, 52, 0 * - German DE * - N/A DF * - N/A E0 * - N/A E1, 1B, 52, 2, 7E, 1B, 52, 0 * - German E2 * - N/A E3 * - N/A E4 * - N/A E5 * - N/A E6 * - N/A E7 * - N/A E8, 1B,78,0,12,1B,57,0,1B,50 * - DRAFT PICA E9, 12,1B,57,0,1B,50,1B,78,1 * - NLQ PICA EA, 1B,78,0,12,1B,57,0,1B,4D * - DRAFT ELITE EB, 12,1B,57,0,1B,4D,1B,78,1 * - NLQ ELITE EC, 1B,78,0,1B,57,0,1B,50,F * - DRAFT CONDENSED ED, 1B,57,0,1B,50,F,1B,78,1 * - NLQ CONDENSED EE, 1B,78,0,12,1B,4D,1B,57,1 * - DRAFT EXPANDED EF, 12,1B,4D,1B,57,1,1B,78,1 * - NLQ EXPANDED F0, 3D, 8, 5F * - = BS _ F1, 2B, 8, 5F * - + BS _ F2, 3E, 8, 5F * - > BS _ F3, 3C, 8, 5F * - < BS _ F4 * - N/A F5 * - N/A F6 * - N/A F7 * - N/A F8, 1B, 52, 1, 5B, 1B, 52, 0 * - French F9 * - N/A FA * - N/A FB * - N/A FC * - N/A FD, 1B, 68, 1 * - Double size FE, 1B, 68, 2 * - Quad size FF, 1B, 68, 0 * - Cancel 0 * NULL terminator superscriptitalics,orsubscriptboldinanyoftheaboveby meansoftheFKeys. OtherfeaturesincludePaper-outsensorON/OFFtoenable printingtothebottomofthepagewhenfeedingsinglesheets, andUnidirectional/Bidirectionalprinting.Themeansofaccessing theseandalltheabovecommandsareshownintheaccompanying SCREEN.TXTfile. TryprintingthisDemoout.  F.A.SHELMERDINE. G6WZG 7thJune1990   R~R yR~RY R@R R~R+_>_<_ R[Rhhh0380000000064 11 21 9[..................................................]0010  1STWORD G6WZGCONFIGURATION Examplesofprintsizesavailableonthesamepagewiththe G6WZGPrinterconfigurationfortheSTARLC-10Printer. QuadOrator Quadsizeprint Doublesizeprint ExpandedNLQprint Expandeddraftprint Oratorsmallcapsprint Oratorlowercaseprint StandardPicaprint NLQPicaprint StandardEliteprint NLQEliteprint SanserifNLQprint CondensedNLQprint Condenseddraftprint Subscriptprint Condensedsubscriptprint PLUS Proportionalspacingon Proportionalspacingoff F.A.SHELMERDINEG6WZG 1stJune1990  ION in your User * * Manual - THOROUGHLY! * * * * (b) Edit this STAR LC-10 PRINTER CONFIGURATION FOR 1stWORD This Folder contains the following files :- IST_PRNT.DOT This should be copied in to the Root Directory of 1stWORD to replace the original 1ST_PRNT.DOT File. DEMO.DOC A WP File which describes the use of the Control Characters when displayed on the screen and demonstrates their effect when printed out. PRINT.DOC A WP File which demonstrates some of the different sizes of print avaiable. SCREEN.TXT An ASCII File which should be loaded without 1stWORD then printed by using ALT/HELP. This produces an AIDE MEMOIRE indicating the use of each Character Code, which can be kept above the keyboard. STARLC10.HEX The source HEX file. README.1ST This ASCII File. The advantage of this programme is that no additional memory is consumed. Any DOT file of less than 1024 bytes will take up 1024 bytes of memory. This DOT file is 927 bytes long. This programme may be circulated without charge provided that all documentation is retained complete. Whilst no problems have been experienced to date, no liability is accepted for loss or damage resulting from it's use. F.A.SHELMERDINE. 14 ELTON DRIVE G6 WZG HAZEL GROVE 31st.Aug 1990 STOCKPORT Tel.0625 87 3989 CHESH SK7.6EP be kept in order) * (2) Command bytes (hex commands and placeholders) * * A placeholder has the top bit set and is substituted * by an actual value by 1st Word Plus when printing. * * Lines preceded by an asterisk are commented out. * 0 * Character width 1, D, A * Carriage return and l G6 WZG CONFIGURATION FOR STAR LC-10 PRINTER ADDITIONAL COMMANDS = Paper-out sensor off. = Paper-out sensor on. = Unidirectional printing = Normal bidirectional printing. = Draft Pica type style ( 10 cpi ) = NLQ Pica type style ( 10 cpi ) = Draft Elite type style ( 12 cpi ) = NLQ Elite type style ( 12 cpi ) = Draft Condensed type style ( 17.2 cpi ) = NLQ Condensed type style ( 17.2 cpi ) = Draft Expanded type style ( 6 cpi ) = NLQ Expanded type style ( 6 cpi ) ----------------------------------------------------------------- = Proportional Spacing ON = Proportional Spacing OFF = Courier Font ( Normal ) = Sanserif Font = Orator Font with lower case letters as small capitals = Orator Font with lower case letters = Double height, Double width characters = Quadruple Height, Quadruple width characters = Return to normal size characters DISPLAY AS TEXT FILE AND PRINT USING ALT/HELP pt on 17, 1B, 54 * Draft subscript off 18, 1B, 47, 1B, 53, 1 * NLQ subscript on 19, 1B, 48, 1B, 54 * NLQ subscript off 1A, 1B, 2D, 1 * Draft underline on 1B, 1B, 2D, 0 * Draft underline off 1C, 1B, 2D, 1, 1B, 78, 1 * NLQ underline on 1D, 1B, 2D, 0 * NLQ underline off 1E, C * Formfeed *1F, 12 * Horizontal initialization *20, 1B, 42, 0, 0, B * Vertical initialization 21, 1B, 40 * Termination: printer reset *22, 8 * Backspace 23, D * Carriage return *24, 1B, 43, 71 * Form length in lines 25, 1B, 41, 80 * Set line feed to N units 26, 1B, 2A, 5 * Start graphics (mode 5) * 27 * Reserved 28, 1B,78,0,12,1B,57,0,1B,50 * Draft Pica (10 cpi) 29, 12,1B,57,0,1B,50,1B,78,1 * NLQ Pica (10 c0660103030566 9[...................................................] ******** 3-24-86 *********************************************** * * * STAR NL-10 Matrix Printer Driver Configuration Table * * ( converted from STAR SR-10 Table 3-21-86 ... ) * * ( changes: 1B,34 --> 1B,78,1 ; 1B,35 --> 1B,78,0 ) * * * * This file contains tables defining the code sequences * * to be sent to the printer to perform various functions * * and to access the characters from codes in the Atari * * character set. * * * **************************************************************** * * Name of printer * =============== * STAR NL-10 (S.T.D.COMMS 1.4) * * Miscellaneous configurable variables * ==================================== * * 1: printer type, 0=dot matrix, 1=daisy wheel * Note if printer type is 0 the following 4 variables are never used. * 2: unit width of one character * 3: unit height of one line * 4: Approximate middle of carriage after formfeed * 5: Carriage shift for bold overstrike * 6: 1 to pause between pages 0, 0, C, 0, 0, 0 * * Printer characteristics * ======================= * * This table specifies the printer command sequences. * If the top bit of a code is set, then this indicates the position * of a parameter passed to the printer. The code whose top bit is set * in this table is added to the parameter passed before being sent to the * printer. It is not used in all command sequences, only in those where * the printer requires a variable value such as the length of a vertical * tab. * * 0 * Character width 1, D, A * Linefeed WITH return * 2 * Forward print * 3 * Reverse print * 4, * Vertical tab to line * 5 * Absolute horizontal tab 6, 1B,45,1B,47 * Draft bold on 7, 1B,46,1B,48 * Draft bold off 8, 1B,78,1,1B,47 * NLQ bold on (NLQ off, Doppelanschlag & fett on) 9, 1B,48 * NLQ bold off A, 1B,34 * Draft italic on B, 1B,35 * Draft italic off C, 1B,78,1,1B,34 * NLQ italic on (NLQ off, Dopp.&italic on) D, 1B,35 * NLQ italic off E, 1B,45 * Draft light on F, 1B,46 * Draft light off 10, 1B,78,0 * NLQ light on (=normal print style) 11, 1B,78,1 * NLQ light off 12, 1B,53,0 * Draft superscript on 13, 1B,54 * Draft superscript off 14, 1B,47,1B,53,0 * NLQ superscript on (NLQ OFF, Dopp.&sup. on) 15, 1B,48,1B,54 * NLQ superscript off 16, 1B,53,1 * Draft subscript on 17, 1B,54 * Draft subscript off 18, 1B,47,1B,53,1 * NLQ subscript on (NLQ off, Dopp.&sub. on) 19, 1B,48,1B,54 * NLQ subscript off 1A, 1B,2D,1 * Draft underline on 1B, 1B,2D,0 * Draft underline off 1C, 1B,2D,1,1B,78,1 * NLQ underline on 1D, 1B,2D,0 * NLQ underline off 1E, C * Formfeed *1F, 12 * Horizontal initialisation *20, 1B, 42, 0, 0, B * Vertical initialisation: VT to line 0 21, 1B, 40 * Termination: printer reset *22, 8 * BACKSPACE 23, D * CARRIAGE RETURN *24, 1B, 43, 71 * form length in lines 25, 1B, 41, 80 * set line feed to N units 26, 1B, 2A, 5 * start graphics (mode 6) 0 * NULL termination byte * * Translation Table * ================= * * This table provides translation from single Atari input bytes into * multiple Epson printer codes, and is useful for printing extraneous * characters such as accented characters etc. All characters are * subjected to translation, but if there is no entry in the table for * a particular code, then the original code is sent to the printer. * * The entries must be arranged in ascending order of Atari input * code. The table is NULL terminated. * 0 * NULL: print a space 1, 1B,52,0, 7C, 8, 5E * Up arrow: USA | backspace USA ^ 2, 1B,52,0, 7C, 8, 76 * Down arrow: USA | backspace USA v 3, 2D, 8, 3E * Right arrow: - backspace > 4, 3C, 8, 2D * Left arrow: - backspace < 5 * No close box 6 * No size box 7 * No full box 8 * No tick 9 * No clock A * No bell B * No musical note E * No LH Atari symbol F * No RH Atari symbol 10, 30 * LCD 0 11, 31 * LCD 1 12, 32 * LCD 2 13, 33 * LCD 3 14, 34 * LCD 4 15, 35 * LCD 5 16, 36 * LCD 6 17, 37 * LCD 7 18, 38 * LCD 8 19, 39 * LCD 9 23, 1B, 52, 0, 23 * # from USA fount 24, 1B, 52, 0, 24 * $ from USA fount 40, 1B, 52, 0, 40 * @ from USA fount 5B, 1B, 52, 0, 5B * [ from USA fount 5C, 1B, 52, 0, 5C * \ from USA fount 5D, 1B, 52, 0, 5D * ] from USA fount 5E, 1B, 52, 0, 5E * ^ from USA fount 60, 1B, 52, 0, 60 * ' from USA fount 7B, 1B, 52, 0, 7B * { from USA fount 7C, 1B, 52, 0, 7C * | from USA fount 7D, 1B, 52, 0, 7D * } from USA fount 7E, 1B, 52, 0, 7E * ~ from USA fount 7F * No triangle 80, 43, 8, 2C * Capital C cedilla: C backspace , 81, 1B, 52, 2, 7D * Lower case u umlaut from German fount 82, 1B, 52, 1, 7B * Lower case e acute from French fount 83, 61, 8, 1B, 52, 0, 5E * Lower case a circumflex: a backspace USA ^ 84, 1B, 52, 2, 7B * Lower case a umlaut from German fount 85, 1B, 52, 1, 40 * Lower case a grave from French fount 86, 1B, 52, 4, 7D * Lower case a boll from Danish 1 fount 87, 1B, 52, 1, 5C * Lower case c cedilla from French fount 88, 65, 8, 1B, 52, 0, 5E * Lower case e circumflex: e backspace USA ^ 89, 65, 8, 1B, 52, 1, 7E * Lower case e umlaut: e backspace French umlaut 8A, 1B, 52, 1, 7D * Lower case e grave from French fount 8B, 69, 8, 1B, 52, 1, 7E * Lower case i umlaut: i backspace French umlaut 8C, 69, 8, 1B, 52, 0, 5E * Lower case i circumflex: i backspace USA ^ 8D, 1B, 52, 6, 7E * Lower case i grave from Italian fount 8E, 1B, 52, 2, 5B * Capital A umlaut from German fount 8F, 1B, 52, 4, 5D * Capital A boll from Danish 1 fount 90, 1B, 52, 9, 40 * Capital E acute from Norwegian fount 91, 1B, 52, 4, 7B * Lower case ae dipthong from Danish 1 fount 92, 1B, 52, 4, 5B * Capital AE dipthong from Danish 1 fount 93, 6F, 8, 1B, 52, 0, 5E * Lower case o circumflex: o backspace USA ^ 94, 1B, 52, 2, 7C * Lower cSTAR LC-10 G6 WZG  EGFHxG H 4 5 x4 5xxSTGSHTSTGSHT---x- !@# %A&* (xWP )WPx *xWM ,xWP .xMW R}R R{Ra^ R{R R@R R}R R\Re^ eR~R R}R R~R R[R R]R R @R R{R R[Ro^ R|R R|Ru^ R|R yR~R R\R R]R R#R R\R R~Rf R|R R\Ra_o_ R]R R[Ra~o~ R\R R|R R~R yR~RY R@R R~R xWP WPx xWM WMx xWP WPx xMW MWx=_+_>_<_ R[Rhhhase o umlaut from German fount 95, 1B, 52, 6, 7C * Lower case o grave from Italian fount 96, 75, 8, 1B, 52, 0, 5E * Lower case u circumflex: u backspace USA ^ 97, 1B, 52, 1, 7C * Lower case u grave from French fount 98, 79, 8, 1B, 52, 1, 7E * Lower case y umlaut: y backspace French umlaut 99, 1B, 52, 2, 5C * Capital O umlaut from German fount 9A, 1B, 52, 2, 5D * Capital U umlaut from German fount 9B, 63, 8, 1B, 52, 0, 7C * c cent: c backspace USA | 9C, 1B, 52, 3, 23 * Pound sterling from UK fount 9D, 1B, 52, 8, 5C * Yen from Japanese fount 9E, 1B, 52, 2, 7E * Esszet from German fount 9F, 66 * Lower case swash f: print f A0, 61, 8, 27 * Lower case a acute: a backspace ' A1, 69, 8, 27 * Lower case i acute: i backspace ' A2, 6F, 8, 27 * Lower case o acute: o backspace ' A3, 75, 8, 27 * Lower case u acute: u backspace ' A4, 1B, 52, 7, 7C * Lower case n tilde from Spanish fount A5, 1B, 52, 7, 5C * Capital N tilde from Spanish fount A6, 61, 8, 5F * Lower case a underline: a backspace underline A7, 6F, 8, 5F * Lower case o underline: o backspace underline A8, 1B, 52, 7, 5D * Inverted ? from Spanish fount A9 * No top left corner AA * No top right corner AB * No 1/2 fraction AC * No 1/4 fraction AD, 1B, 52, 7, 5B * Inverted ! from Spanish fount AE * No << AF * No >> B0, 61, 8, 1B, 52, 0, 7E * Lower case a tilde: a backspace USA ~ B1, 6F, 8, 1B, 52, 0, 7E * Lower case o tilde: o backspace USA ~ B2, 1B, 52, 4, 5C * Capital crossed O from Danish 1 fount B3, 1B, 52, 4, 7C * Lower case crossed o from Danish 1 fount B4 * No lower case oe dipthong B5 * No capital OE dipthong B6, 41 * No capital A grave: print A B7, 41 * No capital A tilde: print A B8, 4F * No capital O tilde: print O B9, 1B, 52, 1, 7E * Umlaut from French fount BA, 27 * Acute: print ' BB * No dagger BC * No paragraph symbol BD * No copyright symbol BE * No Registered symbol BF * No Trademark symbol C0, 79, 8, 1B, 52, 1, 7E * ij ligature: y backspace French umlaut C1, 59 * Capital IJ ligature: print Y C2 * No Hebrew... C3 C4 C5 C6 C7 C8 C9 CA CB CC CD CE CF D0 D1 D2 D3 D4 D5 D6 D7 D8 D9 DA DB DC DD, 1B, 52, 2, 40 * Section mark from German fount DE * No dropped circumflex DF * No infinity E0 * No alpha E1, 1B, 52, 2, 7E * Esszet from German fount E2 * No Greek.... E3 E4 E5 E6 E7 E8 E9 EA EB EC ED EE EF F0, 3D, 8, 5F * Equivalence: = backspace _ F1, 2B, 8, 5F * +-: + backspace _ F2, 3E, 8, 5F * >=: > backspace _ F3, 3C, 8, 5F * <=: < backspace _ F4 * No integral top piece F5 * No integral bottom piece F6, 3A, 8, 2D * Division sign: : backspace - F7 * No twiddly = symbol F8, 1B, 52, 1, 5B * Degree symbol from French fount F9 * No superior bullet FA * No inferior bullet FB * No square root sign FC * No superior n FD * No superior 2 FE * No superior 3 FF * No macron 0 by 1st Word Plus to control its operation. * * An entry consists of: * * (1) Function number (these must be kept in order) * (2) Command bytes (hex commands and placeholders) * * A placeholder has the top bit set and is substituted * by an actual value by 1st Word Plus when printing. * * Lines preceded by an asterisk are commented out. * 0 * Character width 1, D, A * Carriage return and li***************************************************************** * * * * * * * STAR LC 10 PRINTER CONFIGURATION * * ==================================== * * Written for 1stWord.PLUS by F.A.SHELMERDINE G6.WZG * * * * Provides for :- * * * * (a) The printing of Double size and Quadruple size * * Characters, * * * * (b) The selection of Pica, Elite, Condensed and * * Expanded Type Styles in both Draft and NLQ. * * * * (c) The selection of Proportional or normal spacing. * * * * (d) The selection of Courier, Sanserif, Orator with * * small capitals or Orator with lower case Type * * Founts. * * * * (e) Paper Sensor Enable and Disable is provided at * * and . Disabling the paper sensor permits * * printing to the bottom of the sheet when using * * single sheets. * * * * (f) All foreign accented characters are now available * * * * G6 WZG 16th.June 1990 * ***************************************************************** * Printer name * ============ * * For display above the font table on the * 1st Word Plus desktop (max 32 characters) STAR LC-10 G6 WZG * Configuration variables * ======================= * * These six variables define certain printer * configuration details required by 1st Word Plus: * * (1) 1 for microspacing daisywheel, else 0 * (2) Character width in printer units (daisy) * (3) Linefeed height in printer units * (4) Mid-carriage (daisy) pixels/inch (matrix) * (5) Bold offset in printer units (daisy) * (6) 1 to pause printing between pages, else 0 0, 0, C, 0, 0, 1 * Printer characteristics * ======================= * * This table defines values to be sent to the * printer by 1st Word Plus to control its operation. * * An entry consists of: * * (1) Function number (these must be kept in order) * (2) Command bytes (hex commands and placeholders) * * A placeholder has the top bit set and is substituted * by an actual value by 1st Word Plus when printing. * * Lines preceded by an asterisk are commented out. * 0 * Character width 1, D, A * Carriage return and line feed * 2 * Forward print * 3 * Reverse print * 4, * Vertical tab to line * 5 * Absolute horizontal tab 6, 1B, 45, 1B, 47 * Draft bold on 7, 1B, 46, 1B, 48 * Draft bold off 8, 1B, 78, 1, 1B, 47 * NLQ bold on 9, 1B, 48 * NLQ bold off A, 1B, 34 * Draft italic on B, 1B, 35 * Draft italic off C, 1B, 78, 1, 1B, 34 * NLQ italic on D, 1B, 35 * NLQ italic off * E * Draft light on * F * Draft light off 10, 1B, 78, 0 * NLQ light on 11, 1B, 78, 1 * NLQ light off 12, 1B, 53, 0 * Draft superscript on 13, 1B, 54 * Draft superscript off 14, 1B, 47, 1B, 53, 0 * NLQ superscript on 15, 1B, 48, 1B, 54 * NLQ superscript off 16, 1B, 53, 1 * Draft subscript on 17, 1B, 54 * Draft subscript off 18, 1B, 47, 1B, 53, 1 * NLQ subscript on 19, 1B, 48, 1B, 54 * NLQ subscript off 1A, 1B, 2D, 1 * Draft underline on 1B, 1B, 2D, 0 * Draft underline off 1C, 1B, 2D, 1, 1B, 78, 1 * NLQ underline on 1D, 1B, 2D, 0 * NLQ underline off 1E, C * Formfeed *1F, 12 * Horizontal initialization *20, 1B, 42, 0, 0, B * Vertical initialization 21, 1B, 40 * Termination: printer reset *22, 8 * Backspace 23, D * Carriage return *24, 1B, 43, 71 * Form length in lines 25, 1B, 41, 80 * Set line feed to N units 26, 1B, 2A, 5 * Start graphics (mode 5) * 27 * Reserved 28, 1B,78,0,12,1B,57,0,1B,50 * Draft Pica (10 cpi) 29, 12,1B,57,0,1B,50,1B,78,1 * NLQ Pica (10 cpi) 2A, 1B,78,0,12,1B,57,0,1B,4D * Draft Elite (12 cpi) 2B, 12,1B,57,0,1B,4D,1B,78,1 * NLQ Elite (12 cpi) 2C, 1B,78,0,1B,57,0,1B,50,F * Draft Condensed (17.2 cpi) 2D, 1B,57,0,1B,50,F,1B,78,1 * NLQ Condensed (17.2 cpi) 2E, 1B,78,0,12,1B,4D,1B,57,1 * Draft Expanded ( 6 cpi) 2F, 12,1B,4D,1B,57,1,1B,78,1 * NLQ Expanded ( 6 cpi) * 30 * Black ink * 31 * Magenta ink * 32 * Cyan ink * 33 * Yellow ink 0 * NULL termination byte * Translation Table * ================= * * This table is used to translate the ST * character codes for output to the printer. * * Each entry consists of: * * (1) ST character code (these must be in order) * (2) The (possibly null) byte string to be output * * ST character codes with a NULL translation * string are printed as spaces. * * ST character codes NOT in the table are sent * directly to the printer without translation. 7F *  - N/A 80 * - N/A 81, 1B, 52, 2, 7D, 1B, 52, 0 * - German 82, 1B, 52, 1, 7B, 1B, 52, 0 * - French 83, 61, 8, 5E * - a BS ^ 84, 1B, 52, 2, 7B, 1B, 52, 0 * - German 85, 1B, 52, 1, 40, 1B, 52, 0 * - French 86, 1B, 52, 4, 7D, 1B, 52, 0 * - Danish 1 87, 1B, 52, 1, 5C, 1B, 52, 0 * - French 88, 65, 8, 5E * - e BS ^ 89, 65, 8,1B,52,1,7E,1B,52,0 * - e BS French 8A, 1B, 52, 1, 7D, 1B, 52, 0 * - French 8B * - N/A 8C * - N/A 8D, 1B, 52, 6, 7E, 1B, 52, 0 * - Italian 8E, 1B, 52, 2, 5B, 1B, 52, 0 * - German 8F, 1B, 52, 4, 5D, 1B, 52, 0 * - Danish 1 90, 1B, 52, 9, 40, 1B, 52, 0 * - Norwegian 91, 1B, 52, 4, 7B, 1B, 52, 0 * - Danish 1 92, 1B, 52, 4, 5B, 1B, 52, 0 * - Danish 1 93, 6F, 8, 5E * - o BS ^ 94, 1B, 52, 2, 7C, 1B, 52, 0 * - German 95, 1B, 52, 6, 7C, 1B, 52, 0 * - Italian 96, 75, 8, 5E * - u BS ^ 97, 1B, 52, 1, 7C, 1B, 52, 0 * - French 98, 79, 8,1B,52,1,7E,1B,52,0 * - y BS French 99, 1B, 52, 2, 5C, 1B, 52, 0 * - German 9A, 1B, 52, 2, 5D, 1B, 52, 0 * - German 9B, 63, 8, 1B, 52, 0, 7C * - USA Cent 9C, 1B, 52, 3, 23, 1B, 52, 0 * - UK 9D, 1B, 52, 8, 5C, 1B, 52, 0 * - Japanese 9E, 1B, 52, 2, 7E, 1B, 52, 0 * - German 9F, 66 * - f A0, 1B, 52, B, 40 * - a Acute A1, 1B, 52, B, 7B * - i Acute A2, 1B, 52, B, 7D * - o Acute A3, 1B, 52, B, 7E * - u Acute A4, 1B, 52, 7, 7C, 1B, 52, 0 * - Spanish A5, 1B, 52, 7, 5C, 1B, 52, 0 * - Spanish A6, 61, 8, 5F * - a BS _ A7, 6F, 8, 5F * - o BS _ A8, 1B, 52, 7, 5D, 1B, 52, 0 * - Spanish A9 * - N/A AA * - N/A AB * - N/A AC * - N/A AD, 1B, 52, 7, 5B, 1B, 52, 0 * - Spanish AE * - N/A AF * - N/A B0, 61, 8, 7E * - a BS ~ B1, 6F, 8, 7E * - o BS ~ B2, 1B, 52, 4, 5C, 1B, 52, 0 * - Danish 1 B3, 1B, 52, 4, 7C, 1B, 52, 0 * - Danish 1 B4 * - N/A B5 * - N/A B6 * - N/A B7 * - N/A B8 * - N/A B9, 1B, 52, 1, 7E, 1B, 52, 0 * - French BA * - N/A BB * - N/A BC * - N/A BD 0660103030566 9[...................................................] ******** 3-24-86 *********************************************** * * * STAR NL-10 Matrix Printer Driver Configuration Table * * ( converted from STAR SR-10 Table 3-21-86 ... ) * * ( changes: 1B,34 --> 1B,78,1 ; 1B,35 --> 1B,78,0 ) * * * * This file contains tables defining the code sequences * * to be sent to the printer to perform various functions * * and to access the characters from codes in the Atari * * character set. * * * **************************************************************** * * Name of printer * =============== * STAR NL-10 (S.T.D.COMMS 1.4) * * Miscellaneous configurable variables * ==================================== * * 1: printer type, 0=dot matrix, 1=daisy wheel * Note if printer type is 0 the following 4 variables are never used. * 2: unit width of one character * 3: unit height of one line * 4: Approximate middle of carriage after formfeed * 5: Carriage shift for bold overstrike * 6: 1 to pause between pages 0, 0, C, 0, 0, 0 * * Printer characteristics * ======================= * * This table specifies the printer command sequences. * If the top bit of a code is set, then this indicates the position * of a parameter passed to the printer. The code whose top bit is set * in this table is added to the parameter passed before being sent to the * printer. It is not used in all command sequences, only in those where * the printer requires a variable value such as the length of a vertical * tab. * * 0 * Character width 1, D, A * Linefeed WITH return * 2 * Forward print * 3 * Reverse print * 4, * Vertical tab to line * 5 * Absolute horizontal tab 6, 1B,45,1B,47 * Draft bold on 7, 1B,46,1B,48 * Draft bold off 8, 1B,78,1,1B,47 * NLQ bold on (NLQ off, Doppelanschlag & fett on) 9, 1B,48 * NLQ bold off A, 1B,34 * Draft italic on B, 1B,35 * Draft italic off C, 1B,78,1,1B,34 * NLQ italic on (NLQ off, Dopp.&italic on) D, 1B,35 * NLQ italic off E, 1B,45 * Draft light on F, 1B,46 * Draft light off 10, 1B,78,0 * NLQ light on (=normal print style) 11, 1B,78,1 * NLQ light off 12, 1B,53,0 * Draft superscript on 13, 1B,54 * Draft superscript off 14, 1B,47,1B,53,0 * NLQ superscript on (NLQ OFF, Dopp.&sup. on) 15, 1B,48,1B,54 * NLQ superscript off 16, 1B,53,1 * Draft subscript on 17, 1B,54 * Draft subscript off 18, 1B,47,1B,53,1 * NLQ subscript on (NLQ off, Dopp.&sub. on) 19, 1B,48,1B,54 * NLQ subscript off 1A, 1B,2D,1 * Draft underline on 1B, 1B,2D,0 * Draft underline off 1C, 1B,2D,1,1B,78,1 * NLQ underline on 1D, 1B,2D,0 * NLQ underline off 1E, C * Formfeed *1F, 12 * Horizontal initialisation *20, 1B, 42, 0, 0, B * Vertical initialisation: VT to line 0 21, 1B, 40 * Termination: printer reset *22, 8 * BACKSPACE 23, D * CARRIAGE RETURN *24, 1B, 43, 71 * form length in lines 25, 1B, 41, 80 * set line feed to N units 26, 1B, 2A, 5 * start graphics (mode 6) 0 * NULL termination byte * * Translation Table * ================= * * This table provides translation from single Atari input bytes into * multiple Epson printer codes, and is useful for printing extraneous * characters such as accented characters etc. All characters are * subjected to translation, but if there is no entry in the table for * a particular code, then the original code is sent to the printer. * * The entries must be arranged in ascending order of Atari input * code. The table is NULL terminated. * 0 * NULL: print a space 1, 1B,52,0, 7C, 8, 5E * Up arrow: USA | backspace USA ^ 2, 1B,52,0, 7C, 8, 76 * Down arrow: USA | backspace USA v 3, 2D, 8, 3E * Right arrow: - backspace > 4, 3C, 8, 2D * Left arrow: - backspace < 5 * No close box 6 * No size box 7 * No full box 8 * No tick 9 * No clock A * No bell B * No musical note E * No LH Atari symbol F * No RH Atari symbol 10, 30 * LCD 0 11, 31 * LCD 1 12, 32 * LCD 2 13, 33 * LCD 3 14, 34 * LCD 4 15, 35 * LCD 5 16, 36 * LCD 6 17, 37 * LCD 7 18, 38 * LCD 8 19, 39 * LCD 9 23, 1B, 52, 0, 23 * # from USA fount 24, 1B, 52, 0, 24 * $ from USA fount 40, 1B, 52, 0, 40 * @ from USA fount 5B, 1B, 52, 0, 5B * [ from USA fount 5C, 1B, 52, 0, 5C * \ from USA fount 5D, 1B, 52, 0, 5D * ] from USA fount 5E, 1B, 52, 0, 5E * ^ from USA fount 60, 1B, 52, 0, 60 * ' from USA fount 7B, 1B, 52, 0, 7B * { from USA fount 7C, 1B, 52, 0, 7C * | from USA fount 7D, 1B, 52, 0, 7D * } from USA fount 7E, 1B, 52, 0, 7E * ~ from USA fount 7F * No triangle 80, 43, 8, 2C * Capital C cedilla: C backspace , 81, 1B, 52, 2, 7D * Lower case u umlaut from German fount 82, 1B, 52, 1, 7B * Lower case e acute from French fount 83, 61, 8, 1B, 52, 0, 5E * Lower case a circumflex: a backspace USA ^ 84, 1B, 52, 2, 7B * Lower case a umlaut from German fount 85, 1B, 52, 1, 40 * Lower case a grave from French fount 86, 1B, 52, 4, 7D * Lower case a boll from Danish 1 fount 87, 1B, 52, 1, 5C * Lower case c cedilla from French fount 88, 65, 8, 1B, 52, 0, 5E * Lower case e circumflex: e backspace USA ^ 89, 65, 8, 1B, 52, 1, 7E * Lower case e umlaut: e backspace French umlaut 8A, 1B, 52, 1, 7D * Lower case e grave from French fount 8B, 69, 8, 1B, 52, 1, 7E * Lower case i umlaut: i backspace French umlaut 8C, 69, 8, 1B, 52, 0, 5E * Lower case i circumflex: i backspace USA ^ 8D, 1B, 52, 6, 7E * Lower case i grave from Italian fount 8E, 1B, 52, 2, 5B * Capital A umlaut from German fount 8F, 1B, 52, 4, 5D * Capital A boll from Danish 1 fount 90, 1B, 52, 9, 40 * Capital E acute from Norwegian fount 91, 1B, 52, 4, 7B * Lower case ae dipthong from Danish 1 fount 92, 1B, 52, 4, 5B * Capital AE dipthong from Danish 1 fount 93, 6F, 8, 1B, 52, 0, 5E * Lower case o circumflex: o backspace USA ^ 94, 1B, 52, 2, 7C * Lower case o umlaut from German fount 95, 1B, 52, 6, 7C * Lower case o grave from Italian fount 96, 75, 8, 1B, 52, 0, 5E * Lower case u circumflex: u backspace USA ^ 97, 1B, 52, 1, 7C * Lower case u grave from French fount 98, 79, 8, 1B, 52, 1, 7E * Lower case y umlaut: y backspace French umlaut 99, 1B, 52, 2, 5C * Capital O umlaut from German fount 9A, 1B, 52, 2, 5D * Capital U umlaut from German fount 9B, 63, 8, 1B, 52, 0, 7C * c cent: c backspace USA | 9C, 1B, 52, 3, 23 * Pound sterling from UK fount 9D, 1B, 52, 8, 5C * Yen from Japanese fount 9E, 1B, 52, 2, 7E * Esszet from German fount 9F, 66 * Lower case swash f: print f A0, 61, 8, 27 * Lower case a acute: a backspace ' A1, 69, 8, 27 * Lower case i acute: i backspace ' A2, 6F, 8, 27 * Lower case o acute: o backspace ' A3, 75, 8, 27 * Lower case u acute: u backspace ' A4, 1B, 52, 7, 7C * Lower case n tilde from Spanish fount A5, 1B, 52, 7, 5C * Capital N tilde from Spanish fount A6, 61, 8, 5F * Lower case a underline: a backspace underline A7, 6F, 8, 5F * Lower case o underline: o backspace underline A8, 1B, 52, 7, 5D * Inverted ? from Spanish fount A9 * No top left corner AA * No top right corner AB * No 1/2 fraction AC * No 1/4 fraction AD, 1B, 52, 7, 5B * Inverted ! from Spanish fount AE * No << AF * No >> B0, 61, 8, 1B, 52, 0, 7E * Lower case a tilde: a backspace USA ~ B1, 6F, 8, 1B, 52, 0, 7E * Lower case o tilde: o backspace USA ~ B2, 1B, 52, 4, 5C * Capital crossed O from Danish 1 fount B3, 1B, 52, 4, 7C * Lower case crossed o from Danish 1 fount B4 * No lower case oe dipthong B5 * No capital OE dipthong B6, 41 * No capital A grave: print A B7, 41 * No capital A tilde: print A B8, 4F * No capital O tilde: print O B9, 1B, 52, 1, 7E * Umlaut from French fount BA, 27 * Acute: print ' BB * No dagger BC * No paragraph symbol BD * No copyright symbol BE * No Registered symbol BF * No Trademark symbol C0, 79, 8, 1B, 52, 1, 7E * ij ligature: y backspace French umlaut C1, 59 * Capital IJ ligature: print Y C2 * No Hebrew... C3 C4 C5 C6 C7 C8 C9 CA CB CC CD CE CF D0 D1 D2 D3 D4 D5 D6 D7 D8 D9 DA DB DC DD, 1B, 52, 2, 40 * Section mark from German fount DE * No dropped circumflex DF * No infinity E0 * No alpha E1, 1B, 52, 2, 7E * Esszet from German fount E2 * No Greek.... E3 E4 E5 E6 E7 E8 E9 EA EB EC ED EE EF F0, 3D, 8, 5F * Equivalence: = backspace _ F1, 2B, 8, 5F * +-: + backspace _ F2, 3E, 8, 5F * >=: > backspace _ F3, 3C, 8, 5F * <=: < backspace _ F4 * No integral top piece F5 * No integral bottom piece F6, 3A, 8, 2D * Division sign: : backspace - F7 * No twiddly = symbol F8, 1B, 52, 1, 5B * Degree symbol from French fount F9 * No superior bullet FA * No inferior bullet FB * No square root sign FC * No superior n FD * No superior 2 FE * No superior 3 FF * No macron 0 * - N/A BE * - N/A BF * - N/A C0, 79, 8,1B,52,1,7E,1B,52,0 * - y BS French C1, 59 * - Y C2 * - N/A C3 * - N/A C4 * - N/A C5 * - N/A C6 * - N/A C7 * - N/A C8 * - N/A C9 * - N/A CA * - N/A CB * - N/A CC * - N/A CD * - N/A CE * - N/A CF * - N/A D0 * - N/A D1 * - N/A D2 * - N/A D3 * - N/A D4 * - N/A D5 * - N/A D6 `&o + ЫЫO// Bg?<JNA IK~|NHkN~.HmN`BN9NV/HxHnHnHnHntNu m P-H/.0nC/0nC/HxHxdtNM/.Hz@tN?P/.tNNX n C g/tN9XA-HSJm8C n//. nC"_/tNyX"_2` n h /tNBX g/tN9X/./-tN?PHz/-tN3P nX//-tN3P0n gHzh/-tN3P`Hzk/-tN3P nX/ nP/HntNp /tN9XN^NuPRINTERPrinting in Letter Quality mode in Draft mode NV G=HHnHztNzPHn/.tNzDPHnHztN/.P-H g`/./HxtN| N g/.tN|PX"F-H/.tN:PX+H g\/.tN|8XN g /-//./.tNz`"/.tN5X/tNrX F=H`/HztNrP F=H`"/.tN5X/tNrX F=H/.tN2X/-/-tNAN^NutN N^NuHmtN XN^NuHmtN XN^Nu`,Nh012`tN N^NuNV G-H"nAlj` R n`HnC n P"F//-tN5 f FN^NuCf n/HntNyX"_"`tN N^NuNV n/tN "X-HCfH nX/tN "X-HCf( nP/tN "X-HC f F` G g GN^Nu nCf AN^Nu FN^NuN^NuNV/-tN4X-H`*"n G  nN^Nu nR"H n `$Nh ``N^NuNV/-tN4X-HC g nCf AN^Nu` GN^NuNVC0mB @Cf tNCB0- @Rm"H n C0m"HA  GN^NuNVAfX P-HJg` S n`tN`AfP P-H g$HmtN@XSJg tN`N^NuNVAf h g<0m/ mf"HAf h F I"_l tN`HmtN@XC0mB @CgtN^2m m~T0PmC0mRB @C0m"H G  G;HRm0mN^NuNVB- @ @B-/tNX m~\2P0m-H m~PJPg n"FN@N g F` G g nP P-H n P-H` n P-H nP P-HHn/./.tN -HHnJ nX//.tN -HHn/./.tN -H"nAf hoAf h-H/.Af h"H nʓ FNJ"_oAf h"H nʓ FNJ-HAf h"H nʓ FNJ"H nғ I-H/.Af h"H nғ nΓ nʓ I"_o$Af h"H nғ nΓ nʓ I-HAf h"H nғ nΓ nʓ n“ I-HA-HJg$ nRH0@/tNXS n`SJm tN`AJ-HJg$ nRH0@/tNBXS n`SJm tNV`A-HJg$ nRH0@/tNXS n`tNtB./tNXN^NuNV G-H n R H0@ @ gh` R n`.H0@C#f0/./.tNxPR nJg R n`` nR"H.H0@ `"n G  nN^NuNVB. @C?N@ @C0mBJfjC:0mB/C0mB @"_/C0mB @"_ g*B."@B- @N6CN@ g F` G gC0m"H F C0mBJf,B. @ @C0m"HB- @ `B. @ @tNN^NuNV nJg n R "H nRH0@ ` n N^NuNVC0mB @Cf62m m~T0Pm tNr G;HA;HtNB`C0mBJg tNBN^NuNVRm2mAdm G;HtNJmf m~0h g F` G gZC: m~0h B- @CN@ g4A/B @CN@"_ C F  F;HtN2m m~T0Pl G;HtNN^NuNVC0m"H G C0m"HB- @ Cr0m"HB0- @2C:0m/C0m/C0m"H G "_ "_ N^NuNV/-HztN;P f F;H ` /-HztN;P f F;H mRH0@ @ @ mTH0@ @ mXH0@ @Hx-H0@/tN,xPHx -H0@/tN,xPA @/tN%XN^NuLST:AUX:NVHx!/tN,xPN^NuNV m/tNNX mJftN` tN8C0mB/C0mB/tN*dPN^NuNV G=H2n0mlC0nB/tN%XC:0nB/C0nB @"_/C0nB @"_=H0nSn gHx tN)X`Hmr0n"F"_B0/Cr0nB0 @"_ I=HHmCr0nB0 @"_-H0nSn g nRH0@/tN)X`Rn0n`C0nB/tN%XC:0nB @=H0nSn gHx tN)X`N^NuNVtNLB-/tN#,X @CB. @BJg,B.//tNPCB. @"H G A @CB. @BJgH m~JPgB./tN#XB.//tNPCB. @"H G B. @S. g`Jmg(B-/tN#,X//tNP G;HN^NuNV G=H=H G=H2n0mn` Rn0n`HmC0nB/tN#,X"_"H F C0nB @CN@ g F;HC0nB @Cg>0n/C0nB @"_=H0n/C0nB @"_=H`P2n0n"H-H0@N~=HJng22n0nN=H0n/2n0nN~"_ I=H` G=H G=H-H2@AN=H G=H2n0mn` Rn0n`C0n/2n0n"_2C0n/C:0nB"@-H0@N~"_2C0nB @Cf G=H`C0n/0P/C0nB"@0nN~"_"_2JngC0nBJg F` G gC0nRP0PSn0nHmr0n"F"_B0/Cr0nB0 @"_ I=H0n/C0n0P"_=HCx0n/2n0n"_20n/2n-H0@N~"_=HC@0n/2n0n I"_2Jng$C0nB @"FN@ g F` G g C@0n/2P-H0@"_2`N^NuNV G=H=HJn g0n/tN)zXHx tN)X0m/-H2@0nN~"_;HN^NuNV2n -H0@g/0n /tN,xP0n @N^NuNV/-. H0@/tN-FP-H gx n"GB"@A I @B.Jg> nC-H nRB/tN-XS.B.Jg``Hx tN-X`. H0@/tN-XN^NuNVB.Jg mJg F` G g2 mVH2@-H0@N~=H0n/0n/tNPB. @S. g/-HxtN-FP g0B- @CN@/tNXHx/tN,xP` mf"HB- @ I/tN+X mZJg/Hz6tNrP G @ G @`\B. /tN+XN^Nu[1][When the printer stops,|change the paper then|click on CONTINUE][CONTINUE]NVB. Jg/-HxtN-FP gZB- @CN@/tNXHxB-"@B. @/tN,xPB-"@B. @ @`.//tN,xPR-B- @S. B. Jg`N^NuNV/-B./tN-FP-H g n"GB"@A I @ nC-HB. @S. gl nRB @ @B. @CN@ g.B. @CN@"HB. @/tN-X`B./tN-X`N^NuNV n "FB"@B. @d2/. n "GB @"_-H n BJf GN^Nu` n "FB"@B. @f n N^Nu GN^NuNVtN.Jm gB. /tN.^X`B. //-tN7PN^NuNVJm g"tN. g/tN=xX``,Jm g$HxtN~@X f/tN=xX`N^NuNV n;H tN g`CVNN^NuNVCN 0m N^Nu/ ?<&NN\Nu"|)f)-gByNu3Nu"|09@/NuNV/-NXN^NuNV/./-NlPN^NuNV/./-NPHx /-NlPN^NuNVHx$/NdP-H fA+H GN^Nu/. /./.N~ o nN^Nu GN^NuNV n H0@/NX-H n`H G-H F-H`Z F-HA-H`HA-HA-H`4A+H N^Nu`$NhRWA`/.Hz@NP gB nCN,-HJg/HxPHxHz/NȢ+H m -H`/.HzNP g$ nCN,-H nC-H`/.HzNP f/.HzNP f G` F g2JfA-H` A-H nCN,-H`N n"Ff*HxA/.NZPHx n/NNP"_" g AN^Nu nX/N X nHh nHh nX"H G""_""_" GN^NuNV n C fHx /.NP/. /.NP n C f/.NX g F` G g /.NX n h g AN^Nu n N^NuNV n Jg n R H0@//.NlP`N^NuNV/.NX-H nC f8/.NX-H nC f n-H`/./.NP nCf8/.NX-H nCf n-H`/./.NP nN^NuNV n hCf n Cg G` F g AN^Nu nC n "N^NuNV n-HS J o@/.NX-HCf`$ nR"H n C f``"n G "n nf GN^Nu nN^NuNVJf m N^Nu n hN^NuNV nC G"N^NuNV n h g/.NX g AN^Nu GN^NuNV n h"FN@ f nCA"AN^Nu n h-HCg nCA" nN^Nu/.NX gX nP"P n hm>/-NX nHh n/ nX/HxN* "_" nP"H G"`^/.NhX g n/N@XN^Nu nP"P n hm/.N6X g F` G g AN^Nu nX"P nP$H PR-H nH0@CN@N^NuNVHx? n/Hx nX/Nv-HJo nC n" nC G"`6 nC G"Jf nCA"` nC n" nP"H G" n hN^NuNV n hCN@ f nCA"AN^Nu/.NXN g/.NhX g F` G g n//. NNP n N^Nu nX"P nP$H PR-H"n n  nC F" nP"PAm/.NX g F` G g AN^Nu n N^NuNV/.NX g8 nX P-H"n nP P"H G  n//.NP`rHx@ n/ nP/ nX/Nv-HJl nC n"`2"n nP Pl nCA"` nC G" nP/ nC G""_" n hN^NuNVHzN X. H0@/NXN^NuabortedNVNHxL. H0@/NNPN^NuNV m -HJg/.NX n h -H`NBN^NuNV/.N X/. NXN^NuNV"n nN~//NdPN^NuNV/./NdPN^NuNV n CCN@-HHxH/.NZP-HJf GN^Nu nR"HA  n"FN@ g nR"HA  n-HJg" n S o nR"H G ` nN^NuNVS nH0@-H nCfS nH0@-H nCfHxI/.NZP GN^NuNVHxHHxNZPN^NuNV"nA _ @N^NuNV n Jg, n H2@. H0@f n N^NuR n ` GN^NuNV n H2@ nH0@f$ n Jf GN^NuR n R n` n H2@ nH0@ IN^NuNV n-H nS oH nR"H n R H0@  g` nS o nR"H G ``"n G  nN^NuNV"nAzn"nAam F` G g"nA IN^Nu nN^NuNV"n F I-HR nJg`"n n IN^NuNV n Jg@ n R H0@/NX/ nRH0@/NX"_g GN^Nu` nH0@"GW @N^NuNV G-HJgtHnHnHnHnNJngT/NX///HnHnHnHnN`//N4P-H nCf /NX nN^NuHx N@X glHxN@XCN@-H nC f A -HJg8 nCfNƄCN@-H` nCf /NX nN^NuNV n P-H nA P-HJgZ nHh nC n""_" nHh( nHh, nC. G2"_2"_2 nC6 F2"n G `> nA P-H nA40P-H nS g nR"H G `/.tN΄X/.tNXN^NuNV n P-H n PJg, n P"H n" nT0P/Hx/.tN N^NuNV n P-H n X"H n" nT0P/Hx/.tN N^NuNV n P-H nA JfN^Nu/.N΄X/.NXN^NuNV n P-H nA JfN^Nu/.N΄X/.N.XN^NuNV n P-H n A JfN^Nu. H0@C fN^Nu/. NX. H0@C g& nA(0P/ nA00P"_l G` F g/. /.NnP. H0@C gt/.HnHnN0 n A/ nA($H0PRR"_-H"n. H0@  nR"H G  n0P/0n/0n//.Nb/. NX/. NXN^NuNV n A/ nA(0P"_-H nR"H G  nC( G2 nA6RP0P/. n A P"_e n A P-H n C n" n A/ n A P"_ I=HJnm$0n/ nA00P"F"_n G` F g` n A P-H nRJg`/. n A P"_e n A P-H n C n" nA./0P/ nA"0P"_ I"_2 nA6SP0P`,"n G /. NXN^NuNV n P-H n A JfN^Nu/. NX n A P-H nA(0P=H0n/ nA00P"_l0 nH0@ @ g.H0@C g F` G g<.H0@C g"n0nRn"H.H0@ R n`z"n0n"H G  nC(0n2/. nA60P//.NԲ nJf`0 nH0@C f R n/. /.NnP`/. NXN^NuNV G=H n P-H nA P-H nA(0P=H nA JfN^Nu2n A I=H nA00P/ nA(0P"_ I=H2n0n l 0n=H Jn n"n G  GN^Nu/.N΄XNƄ=HB0. @`/.A =H/NFP`"Jngx/.NXSn0n/. nA(SP0P"_"H G /.HnHnN0 n0P/0n/0n/Hz"Nb/.NX/.NX`B0. @CN@=HB0."@A e(B0."@Ab2n0n l F` G gRn0n/.B0./NFP`.Nh `dB0. @C f``/. "n0n/NP"n 0nRn"HA "n 0n"H G 0nN^Nu NV//N4P=HB0. @C f A =HB0. @Cf A'=HB0. @N^NuNV n P-H G=H/.HnHnN0 0n/ nA0P"_m 0n/ nA0P"_l G` F gf F=H nHh,/ nA 0P/ nA(0P/ nA0P/ nA 0PCN~"_N"_ I"_N~/NP"_20n/ nA0P/ nA"0P"_"_o\ F=H0n/ nA0P"_o>0n/ nA"0P"_ I=H nA./0P/ nA"0P"_"_2`Jng/.NX`00n/ nA0P"_o/. nA"0P/NlP/.NXN^NuNVNCf HxNX/NX F;H N^NuNVJm fNtHnAT/AX/A\/N=HHm HnHm N8 Jnf HxNXC 0nJg/HzFNPNC 0n"H F HxxNlX-H nA(-H"n n" nX"H n " nP"H n""n0n20n//HxHnHnN G=H2nAl:` 0nRn`/.0nC"_/C0n0P"_2`Jnf0n/HxNP=H0n/HxNP=H nC00n2 nC20n20n/HxNP=H nHh40n"F/0nC"_N~"_2 nHh nHh nHh nA40P/NlX"_""_""_" nHh nA/0n"F/0n"F"_N~"_"_" nC6 F2`/./.N P nPJg nX"HA2` nX"HA2/HxHm N /Hx nP/N /./.NˀP nN^Nu[3][please re-boot and try again][ok]NV nX0P/ nP0P/ nA 0P/ nA 0P/ nA0P/N=HJnl HxNX n\"H F2C 0n"H n " nT"H0n2 nA00P/ nA 0P"_N~/A X0P/NP=H nA20P/ nA"0P"_N~/A \0P/NP=H/ nX0P/Hx Hx0n/0n/HnHnHnHnN,(/. nP0P/0nCN~"_/ nA 0P/0nCN~"_/0n/A X0P/0nCN~"_ I/NP/0n/A \0P/0nCN~"_ I/NP/N͈0n/Hx n X/N n PJg0n/Hx n P/N N^NuNV n P-H nT0P=H nP"H0n2 nC 0n2 nC 0n2 nC0n 2Hm nP/N

@2A CB0.: @2A CB0.6 @2A CB0.2 @2A CB0.. @2C n("A CB0.& @2A CB0." @2HxNX/.ATB0 @"_2/.AXB0 @"_2/.A\B0 @"_2/.APB0 @"_2/. AA B0 @"_2/.AA B0 @"_2AB0 @N^NuNVC 0n 2Hx5NXN^NuNVC 0n2C n"Hx4NXN^NuNVC 0n&2A T"H0n"2A X"H0n2A \"H0n2A P"H0n2A C 0n2A C 0n2A C0n 2HxINXN^NuNVC 0n&2A T"H0n"2A X"H0n2A \"H0n2A P"H0n2A C 0n2A C 0n2A C0n 2HxJNXN^NuNVHxMNX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2AB0 @N^NuNVC 0n2C n"HxNNXN^NuNVHxONX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2N^NuNVC B0. @2A T"H0n2A X"H0n2A \"H0n2A P"H0n 2HxdNXN^NuNVC 0n2A T"H0n2A X"H0n2A \"H0n2A P"H0n 2HxeNXN^NuNVC 0n 2HxfNXN^NuNVC 0n 2HxgNXN^NuNVC 0n2A T"H0n2HxhNX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2AB0 @N^NuNVC 0n2A T"H0n2A X"H0n2A \"H0n2A P"H0n2A C 0n 2HxiNXN^NuNV0n/0n/"nANJ//.//NRN^NuNVC 0n2A T"H0n 2HxjNXN^NuNVC 0n 2HxkNXN^NuNVC 0n.2A T"HB0.* @2A X"H0n&2A \"H0n"2A P"H0n2A C 0n2HxlNX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2AB0 @N^NuNVC 0n 2Hm*2n A ICN~"_-H F=H2nAl0` 0nRn`C 0n"H nRH0@2`NnAB0 @N^NuNV"- 0<NBN^NuNV n-H n -H l n N-H nR/"n A N IC0"_ "n A N-H o`Jl nR"HA- "n G /.NXN^NuNV nH0@/NxX g R n` F-H nH0@`A-HR n`Nh-+ G-H nH0@/NX g0 nC N~"H nRH0@"HA0 I-H`"n nN~N^NuNV/./.NX"_"H F I-H"n nd< nH0@-H nR"H nH0@  nS"H n `N^NuNV"n F I-HR nJg` nR"H nRH0@  g` n N^NuNV n -H nR"H nRH0@  g` n N^NuNV"nA9n"nA0m F` GN^NuNV/./."n nN~/NZ N^NuNV/./."n nN~/N -HCf GN^Nu nN^NuNVHx? n//./. Nv-HJf nCA"`Jl nC n" G-H nN^NuNVHx@ n//./. Nv-HJf nCA"`Jl nC n" G-H nN^NuNV nA PCW @N^NuNV/.//N N^NuNV/.NhX g GN^NuHxB/ n//NN^NuNV/.NhX g AN^Nu/.NXHxB/. n//.N-H nC G" nCA"Jl nC n"AN^Nu nC G" GN^Nu D @Nu W @Nu F @Nu " @Nu " @Nu " @Nu " ANu " ANu " ANu"_ g "fNN BNu"$ 68HAHBBHABA҃ ANu$ma`DaD A"BNu$" a A"BNu" j DaDDNu cPgc $BNurBNu&BCHCR(*$a.$Â$&HCHCԃb DbR`S`NuHPBAHA62HAB42HA6Nu$O?*NA @.JNu$O?*?* `$O/*?* `$O?*/*?*`$O/*/*?*?*`$O?*?* /* ?*`$O/*/*/* ?*?*`NV G+H+HHzzHz{N.P+H nRH0@-H nC//NdP-H/././.N* CA" nJg nH0@`R n`R/.HzHmN -H`R nH0@C>f"R/.HzHmN -H`/.HzHmN -H`n"mAlC mR"H n"/.NTX-H`$NhF H<^>``JfHz1Hz2N.P+HJf m+HN^NuCON:WrawCON:RNV nJg< nH0@/NxX g nR"H G  nN^NuR n` nN^NuNV n-H/.NTX-H/././. N.P"_" nN^NuA 0g C" ӑ`Nu<P    *, ":D\"  l f8tZb6*(2PN^NuNV nJPg,"n n0P"H G  n h //. NpP"n G2N^NuNV n h,-H n hT-H G-H n h$-H n h(-H nJg0`R nR n`"n nH0@Nb-H`/. n hT/N jP-HJg nN^Nu n hT"H nf2 n h(-H n/H0@/ n"GNb"_Nb"_ JgP n"P n hTo nS P`" n"P n hTf nX"H G" nP P-H` GN^NuNV n h,-H n hT"H n hDf n h< n F` G g"/.N3@X-HJg nN^Nu n hT"F-H n h(-H n h$-H-H/./.N0P-H/.N`X-H/.N`X-H"n n"HAo AN^Nu/."n F I"_H0@-H/."n F I"_-H/./. n"F/N/ nC/ nC//.N/ /."n F I/ n hT/N "n n hX/H0@/ n"GNb"_Nb"_ /. n hT/N)P/.N)X/. n hT"F/N jP-HJg nN^NuJgP n"P nܳm2 n"P nܳf nX/"P n hX"_" nS P nP P-H` GN^NuNVV n h(-H nH0@=H0nCNb/HnVHxN/ /. /.HnVN < N^NuNV n h,-H n hT-H/. N`X-H/. n hT/NP-HJg nN^Nu n h$-H n h(-H/. /. n"F/N/ /././.N/ /. n hT"F/N0DP-H/./ n hT/N /. n hT/N)P/.N)XJg( n"P nm nR P nP P-H` GN^NuNV G-H n h< n/. N3@X-H n-H"n n hDlV` R n`/. /.N0P-H/. n"F/N0P-H/./.HxHN/ `"n n hDf( n h< n"n n hTf F` G g\ n h$-H"nA  nR"H G /. n hT/N)rP n CX G"/. N)X GN^Nu n A4R P n A/. n"F"_o*/."n F I/N'P/./.N'P/.N)XJgD n"P n hTf" nX"P n hXo nXS P nP P-H` GN^NuNV n h$N^NuNV n C\0n "Jn g$/. n hX/ n hT/N /. 0n /N(

PN^NuNV/. HxN+P g n h //.N0PN^NuNV/. n hT/N+P g n h //. /.N^ N^NuNV"nA l"nAo F` G g A -H/. n hT/N+P g n h //.NPN^NuNV"n n hPm(/. n hP"H n h"_l F` G g/. /.N۠PN^NuNV/. n hL//./N) n h /HxN>PN^NuNV/. n hX/ n hT/ n h\/N)N^NuNV/.HxN+PNbx gN^NuJn f n h //N0P n h /"n n hP I/"n n hL I/NZ Jn g n h //N0PN^NuNV nA-H/.HxN+PNbx g GN^Nu nC\ G"/./NP G-H"n n hlj` R n` n hd f"n nJf G` F g/."n n hP/NP"n n"H G `/.NtX/.NX nC\ F"/.NFX/. n hd/NP/.NNX/.N.X/.N.,X nCd G" GN^NuNV n A-H n h` gV nCf n Cd F"`4"n n hPm"/."n n hP I"_"H F ` n h /N"X n h`"GW @N^NuNV G-H/.NX-HJg /. HxN:PNbx f G` F gN^NuJl"n n hl F` G g n h"H n I-H"n n hl0 n h / n h"H nNb//N ` n h-H/. n hL/ n hP"H n//N n h /NX g/. N(X`"/. /./.N- /. N&X/. /NP/. N.XN^NuNV n hP"H n -H/. n hP"H n "H n"_l ` R n`/./.NP`/.NX/.NX GN^NuNV n hL"H n hg8 n h / nC n hL"/ n h/HxNN^NuNV n hP"H n h"H n hH-H n h< o"n n h<-H n h / n hP/ n h//.NnN^NuNV/.HxNPNbx gN^Nu n h //N0P"n n hPf n h //./N `B/. n hL/"n F I//Nf n h //.HxN /.N X/./NP/.NXN^NuNV . n ".`QN^NuNV . n "n`QN^NuNV .". n`SQN^NuNV n /"nANb ICHNb"_N^NuNV n PC/"nANb ICHNb"_N^NuNVJg(/./. HmHx/0n /$oNN^NuN^NuNVJg2/././. /. N`X//0n /$oNN^NuN^NuNV/./NDP/.N!X-HJg`` nCg nN^Nu n h4"HAl$/.N4X-HJg nN^Nu` GN^NuNV nX"H n" nP"H n " nCH n" GN^NuNV n h< l"/.N3@X-H g nN^Nu` GN^NuNV nX P-HJf AN^Nu n h4 f/.N4X-H g F` G g nN^Nu/. nP//N2 -H g nN^Nu/. nA@S/N0P-H-HA-H nRB @=H gh0nCf nRB @CNb-H`:"n0n  nC"H n  nCNb-HR n`"n G  nC, nAB @" nA8R P nA4S P GN^NuNV nX P-HJf AN^Nu n h4 f/.N5X-H g F` G g nN^Nu/. nP//N -H g nN^Nu n h0-H/. nADR/N0P-HA-H nRB @=H gh0nCf nRB @CNb-H`:"n0n  nC"H n  nCNb-HR n`"n G  nHh0 nCNb"_" nA/-lHxN"|PN/.N?X gN^/.N*XN&N^NuwNV/-l/HnHnN"/-lHxHnHnN"/-l/./.N n-H/-lNHX-H n-H"n nf "n n-H"n n I-H"n nf2 nS g nRH0@//.NP``././.NlP/-l/R/.N `T/.N8X/.NXN^NuNV/NCX gNE g F` G g| ml hP-H/-lHnHnN N|/-l/N#:PNF g/-l/./.N NH6/-l/././.NNZN^NuNV/NCX gNE g F` G g ml hP-H/-lHnHnN /-lHxN"|PN/-l/N#:PNF gXNDR/-lHxN#:P/-l/N"|PNH6/-lHxN"|PNZ mlCx F" mlC| F"/-l/././.NNdN^NuNV ml hP-H/NCX f GN^NuNE f GN^Nu/-lHnHnN N/-l/N#:P/-lHxN"|PNF f/-NX G+H /-l/././.NN m N^NuNVNrNH6NN^NuNV/NCX g&/-lHxN"|PNJ|g nS`*NT g mNbx+H GN^NuNS-H G+H|/.NT.X gJ"n mx I+H|/-l/-|/-N mCNb"F I/N:X FN^NuJg nS"H mxf` `R nBJf``jNT g mNbx+H GN^Nu mx-HJg NS-H`.N^NuNV/-xN`X"H F I-H"n mo"n m I-H"mx nN^NuNV nB @Cf GN^NuA-H nBJgr nRB @-H nCf`Jg/.NU(X-H nCf A -H"n nRB @g GN^Nu` FN^NuNV/-l//- mCNb"F I"_+H/N -H/-lNHX+Hx nN^NuNV"nAam"nAzn nC-H nN^NuNVtNU=H/. 0nCA"_  n R"HA: 0n"F/ n T/tNUP/. Hz"tN!&P/. /.tN!&PN^Nu\NVHxtN#XN^NuNVHxG/./. tN# N^NuNV/. tN`X-HJgP/. "n F I"_H0@ @C\g.H0@C:g F` G g F` G g nS`"n n"H G /. /.tN!&PN^NuNVJg/.0n//tNV `/.0n//tNW^ N^NuNV/.0nCNb"_C /tN[|X-H/.0nCNb"_C /"n0n Nb/tN[PN^NuNV/.0nCNb"_C /tN[|X-H/.0nCNb"_C /"n0n NbNb/tN[PN^NuNV/.0n//. nT/tN nX//.0nCNb"_C/tN[|X"_2 n\//.0nCNb"_C/tN[|X"_2N^NuNV/.0nCNb"_C /tN[nX-H/./. tN[PJn g nC/0n /tN[PN^NuNVC0n2AT"H0n2AX"H0n2A\"H0n 2/.HnHn/tNY^/.0n/tNP=H/.HnHntNZ /.0n//tNd 0nN^NuNVJn g././. n T/ n X/ n \/tNT///// n 0P/ n T0P/ n X0P/ n \0P/t N$/ n0P/ nT0P/ nX0P/ n\0P/ n 0P/ n T0P/ n X0P/ n \0P/t N$/.//. tNZV Hx/tN PN^NuNV/.0n/Hx n0P/ nT0P/ nX0P/ n\0P/tNN^NuNVHx/tN PHx n 0P/ n T0P/ n X0P/ n \0P/ n0P/ nT0P/ nX0P/ n\0P/t N$Hx n 0P/ n T0P/ n X0P/ n \0P/ n0P/ nT0P/ nX0P/ n\0P/t N$N^NuNV n PN^NuNV n0PN^NuNV"n 0n 2N^NuNV"n n"N^NuNVN"HA.lHxNX FN^NuJgHn/.N!tP`"HnN]X-HJg nN^NuHnHznNb$P-HN+Hl ml h -H n0P;Hp0mp/HxHnN 6 Jf,Hx NX-H nCfN`b FN^NuA;H/-l/.HnNb g,N`bJg/.N*XA;HAN^NuHnHx.NP-HJg/.HzNLP f F` G g mlCA" mlC F" mlP P-H0mp/Hx n h /N 6 Jg/.N*XA;H GN^Nur.DOCNVHx/N PHmHmHnN $ Hx/N PJnf FN^NuAJg(/.HmN!tP/.HmNVP GN^Nu`N^NuNV0m/NXN^NuNVHxNXN^NuNVNbHnNLX fHnN"X`NbjN^NuNV/./. N!tP/.Hx.NP-HJg/./.N!tP`/./.N!&P nN^NuNV mlP P-H/-zHxHnNW /HxHnN /.HxHnHx%NXVHn n h /N!tP/./0n/AT0P/AX0P/A\0P/NX-H nCf(/HnN`P g FN^NuN`b GN^Nu FN^NuNV mlP P-H/ n h /N`P g FN^NuN`b GN^NuNV/-zHx!HnNW //HnN /./0n/AT0P/AX0P/A\0P/NX-H nCfNhN`b GN^Nu FN^NuNV/-lN,X/Hx HnHnHnHnN P0n;HpC0n P+HlN^NuNV ml h g ml h f F` G gHxNXCf FN^Nu/.HzNb$P-HJgb/.N*XJ gHx NXCf FN^NuHn/.HzN HnN"X/.HnNbP/-l/NDPN;/.HzoNb$P-HJfHxNXA-H`/.NeX-H/.N*XJg/-l/NDP nN^Nur.bakwNVHxV//. /.N#N^NuNV m!XJg/-!N*X/. /./-!N n GN^Nu m!N^NuNVJfHxHxNP+HN^NuNVJg/-NX G+HN^NuNV G-H G=HHxHxNP-HJf AN^Nu nP"H n" nC nA$" n h //.N!tP nX/"n n""_" nHh nP"H nP""_"/.NX nCAB" nC F" nHh nCA""_" nC A" nCA6"J gОHnHx/. N gJo2/-l/"n F I/tN /-ltN X-H`Hx(tNtrX nN^NuNV/tNtrXN^NuNVHxtNtrXN^NuNV/-l/tNXP G-H n`>/-l/tNDP`/-ltNX`/-l/tNDP/-l/tNXP/-ltN X-H nN^Nu`/-l/tNP`n/-lHnHntN G-H nR/-l/./.tN -H nCf tN^/-l/tNDPtNwd-H`tNw-H`/-l/tNP`tNwd-H`/-l/tNP``Nb  $@(X,P0H4P8\.H2@ nfHm n"F"_H0@N^Nu nC-H`AN^NuNV/-lHnHntN Jf FN^Nu nS/-l/./.tN GN^NuNV/-ltNXtNN^NuNV"m mBfNw g AN^Nu` GN^NuNV G=H mB-H G=H F=H/-lNHX-H nC-H G=H"n0nB @=H"n0nB @=H2n0m.f mB+H60nRn0nC f`0nCfJmZg F=H```:0nCf&JngA=H`A=H`V` G=H0n=H G=H0n/0n/NyP`&JmTg@Jng0nCf F` G g/-lNTX F;HVAN^Nu0nCg0nC-g F` G g F;HT"mB nf F;HV/-lNTX G;HZ0mVN^NuNV2n ANb"H0n=HJmTf0"mB0n2/-BNzX+HB"mB mFf F;HTN^NuNVT"n m>e m:-H nN^NuNV/-lNHX-H nH0@C f/-lN$vXN^NuN7N;NzN{8JmVf`N7N^NuNVJ:fHxHxNP+H: m:+HB+HA;H. G+H6 m:A+H> F;HZ G;HT;HV/NX;HN G;HL/-lHnHnN /-l//.N N^NuNVN{N{JmVg F;HX`2JmRg2m 0m o F` G g N}``N~N^NuNV G;H,;H`;HR;HP;H;H;H ;H 0mNbx;HX0mN;H 0mL;H" m+HFN^NuNVN ft m0PCNb=H0nCf N|f`(0nCf N|`0n/N}X0nC-W @;H,/-NX+HN^NuNVRm0mN||N^NuNVJmPo A;HPN^NuNV0m Rm Jm"f 0m /2m F I"_l F` G g60m ;HL/NX"H0m I;HN0m`Rm` G;H G;HN^NuNVJmg2N}2m 0m;H 0m Rm JmPl 0mRm`Jm,gN} G;H0m Rm 0n /N}pXN^NuNV G;HP2n AAl Hz 0n /NP g F;HPN^Nu.,!?:;NV0m ;H0m ;H0m;H m+H F;HRN^NuNVJmRg"0m;H 0m;H 0m;H m+HN^NuNV G;H\;H^;H*;H(;H&;H$A;H00m ;HJ2m 0m I=HJm gJmXf F` G gv2n0m Nb;H$2n0m Nb I=H2m 0m I;HJ2n0mn0n;H&`*0m;H&2n0m I;H*2m*ANb;H( G;HPA+HdA+Hh0m"/N,X G;H"mF mg mF0P/NX`NHx NX/NX/-lHnHnN /-lHnHnN < /-l/ n"F/N Jm0m0m0;H2 n;H4Jmg~A+HdA+Hh2m"Al A;H"0m"/N,XHx NX/NX/-lHnHnN < /-l/ nC/N N^NuNVJn gJ mF2PANbCwNb @bHxNX2n Fo2n F I/NXN^NuNVB0. @CNb=HN0nCf^B0. "@ANb @b-bH0@CwNb @bJm\g A=H0n/NX0m`Sm` F;H\`h G;H\0nCf"B0. "@ANb @bN`4JmgNB0. "@ANb @b0n/NX/-FNX+HFN^NuNV"mF m6f0m^;H0 G+H6N^NuNVNHxNX0mRmN^NuNV0n /NX0n /NXN^NuNVJm gJm`f F` G g0m$/NXJmPl&Jm&g/NXSm&0m& G;HP`LJm(g/NXSm(0m(Sm*0m*2mJ0m*n/NXSm*0m*SmJ0mJSm 0m G;HN^NuNV0n Sn gHxNX`N^NuNV mdRd"H0n  mhRh/-bH0@CNb"_ 0m^Rm^N^NuNV/NX=HJmg/-lHnHnN /-lNHX-H/.HxNP-HJfN^Nu nRH0@Cf` nJfN^Nu"n0no(N7/.NX//.NrPN7N^NuNV/-l/HnHnN"/-lHxHnHnN""n ng"n ng G` F gN;N^NuNV/-lHnHnN N7/.NpX//NrPN7N^NuNVN(NJng G;HZ` 0n ;H.Nd F;HT F;HXN8JmVg`` 0nRn`C0n0P/C0n0P"_g G=H`Jng0n /HxHntN 0n /HntN8PN^NuNVC0n P-H n h -H/. n0PCCNb"_20n/Hx/.tN 0n/Hx nP/tN nP/ nHhtN^P nT0P// nHhtNT /.tN2X/. n0h "H n0h$ nX0PNb/ n0h"H0m n\0PNb/tN N^NuNVA\0P=HAP0P-H ml hP"H ml hH-H2n0mpgN^Nu ml h< o"n ml h<-HJnN^Nu"n nNb"HANb-H/-l//./.tNN^NuNVA\0P=HAP0P-H ml hC I-H2n0mpgN^Nu"n nNb"HANb-H mlCL n"/-ltNXN^NuNV ml h -HHnHnHnHntN 2n n0h 0ml0n/0n/tNҞPN^Nu2n nP0P0ml$0n/0n/0n/tN\ N^NuJnfT/.HnHntN g2/-l0n/0n/tN /tN:XtN~`Hx/tN PHx/tN P0n/0n/HxHxHnHntN Hx/tN P//tN P0nCf0nCf F` G gL/.HnHntN g*/-l0n/0n/tN /tN:XN^Nu0n/2nA I"_=H0n/0nC"_=H/.HnHntN g&/.HnHntN g F` G gT2n0ng G=H G=H0nRn0n/0n/0n/0n/tN:R/tNXN^NuNV n /2P nP0P I"_2 n/2P n0h I"_2 n JPl GN^Nu n /2P n0h$ I"_2 n JPl "n G2 n2P0mm0 n 2P n0h l n2P n0hl F` G g^/. ml hL/ n 2P ml hNb"_"_2/. ml hP/ n2P0m ml hNb"_"_2 FN^Nu GN^NuNV2nA" I=H m~-H///HnHn HnHntNt/-~0n/HnHntN2n0n0mfNb=H/.0nCNb"_C /tN[nX-H n P-H"n0nH0@C fN^Nu0nCNb/2nANb"_/tNXN^NuNV0mNbx g F;H/tN XN^NuNVJmg G;H/tN XN^NuNVC0n P-H n h -HA =H nT0P=H0n/0n/HntN A =HAXJPfA\JPf F` G g`b/.HntNP gFHnHntN^P0n//HntNT G;H/.tNX F;H`T0n// nHhtNT N^NuNVA =H G=HJmg0n/0n/HntN A =HAXJPfA\JPf F` G g`D/-~0n /Hx0n/AT0P/AX0P/A\0P/tN`rN^NuNV ml h=H0n "FNb=H2n0nNb"GW @=H ml h fHxtNXN^Nu0n /0n/tNPJng.CR0n 0P=H Jn m0n //tNP ml h;HxN^NuNVCr0n0P=HCb0n0P=H0n"FNb=HJn g mlA/"P0nNb"_"` mlA/"P0nNbNb"_"/-z0n/0n /tN Jng0n/0n /tNzPN^NuNV F=HJmvfN^Nu/-ltN%X=H2n0mxNb=HJng G=H2nAl`0nRn2n FNb=H`2n0nNb gb2n0nNb"GV @=H/-zCr0n0P/0n/tN Cb0n0P/0n/tNzP`t mlC0n;Hx"N^NuNVJngn/-~0n/0n /tNV /-~0n"F/0n /tNV /-~0nC/0n /tNV 0n/tN|XN^NuNVHx0n /HntN //.tNPN^NuNVHx@NX-HJg nC n" nC-H nC n" nC-H nC n" nC-H nC n" nC-H nC n"/.NX nN^NuNV n h-H nT"HA2 nT"H G2 nT"H G2 nT"H G2 nC G" nCAB" nCA6" nC G" nCA" nCA" nC A" n h-H"n G  n h-H"n G  n h/HmN!tPN^NuNV/. Hn N4P-HJg nTRP0P/. /.N4PN^NuNV0n =H G=H/. HnN4P-HJgZ nT0P"Ff0Jn f A=H/. "n0n/NP-H nTSP0P/. /.N4PN^NuNV/.HnN4P-H n h-H n h"HAmHxNXN^Nu/. n h"F"_-HJnf"n0n 2`2n nT0Po`j"n ne nX"H n P" nY` nX"H0n 2 nT"H0n2 n\/2P0n I"_2 nA$H PR/./.N4PN^NuNV n-H"n n hgd"nA I-H nT/2P n\0P"_2"n nX P" g nX` n AS P/. /.N4P nN^NuNV n h-H n h=H F=H"n n"T n0P=HJnf GN^NuT nJPo2nT n0P=H` n 2P0nl`@0n/2n0n"H F0nNb"_=H n /2P0n I"_2`f0n/ n 2P0nNb"_=H0nN^NuNV n h-HJg/./.N4P-H`N^NuNV n h=H nJPo"nA I-H` G=H2nT n0P=H2n0no2n0n I=H`T n0P=HJno02n0n"H0no"n0nNbp2 G=H`LJnl:0nNbp=H2n0n"H0nn"n0n2``` G-H``< nN^NuNV n h-H n2P nT0Pm6 nXJPf`& nT n/2P nT0P I"_2` nN^NuNV n h-H/. n hCNb"_-H nT$H0PRRN^NuNV n h-H/. n hCNb"_-H nTJPgX nC-H nT"H0n 2 nT"H G2 nT"H G2 nT"H G2 n A$H PRN^NuNVA\0P;HrAP0P;HtJmg40mt/N@XCf/-z0mr//NZ N^Nu0mt`TN`2/N[X fRmv0mvN`Nɺ`N_ fSmv0mvN`N^ fSmv0mvN`N¾`N^2`N;`N>`Jmvg N_ fSmv0mvN`NB/N@X`h mlHhHx#NP ml h g mlC F"N/-l/NP/-lNNX`HmHx$NPHx0m/NzP`NHr/-zHx(/N& `NJ/-zHx(/N& `NQ`/Hx/NNP`HxHx0NNP`HxHx1NNP`pHxHx2NNP`\/NE*X`NHxNE*X`>HxNE*X`.HxNE*X`N8 f./-zHx?/N& ml h| g /NX`N90 f./-zHx@/N& ml h| g /NX`JmgHx NXCf`NB g:0mNbx gHx NX F;H;H/-zHx8/N& `< G;HNC4`,N@`"NA`NCJ/NX`NE`NE`N;/NX`/NX`HxNX`HxNX`/NX`HxNX`HxNX`N/NX`lHmHxMNP`XHmHxNNP`DHmHxONP`0N2`&/NX`Nz<`JmfHxNXCf`HmHxUNP`/HmNP`/HmQNP`/HmNP`/Hm7NP`/HmNP`~/Hm3NP`l/HmNP`Z/Hm;NP`H/HmNP`6/Hm;NP`$/HmNP`/Hm7NP`/HmNP``Nb !.#x$&'(*+,-/0124D5x78:;=?@BDEFGH&I.K:MFNRO^Q`RfShUWXYZ[\]^_`bca/-z0mr//NZ N^NuNVHxN,XN^NuNV/-z0mt/HnNW /0n /HnN /./0n/AT0P/AX0P/A\0P/NXN^NuNV/NCX gN7 ml hC?Nb=H ml hP=H/-lHnHnN /-l/N#:P/-l0n/HxHxN%/-l/./.0n/NN7 mlCx G" mlC| G"N^NuNV/-l/. N"|P mlA// n "FNb"_Nb"_"/-z/./N& N^NuNV"n n 0PNbx2/-z0n / n 0P/N N^NuNV0mv"GV @=H G=H G=H G=HJngl ml hx g ml h| g F` G=H ml h=H ml h"GV @=H ml h / ml h/N@P`/-zHx(/N& /-zHx2mvA_/N& /-zHx0mv"GW/N& /-zHx/0nCNb"GV/N& /-zHx00nCNb"GV/N& /-zHx10nCNb"GV/N& /-zHx20nCNb"GV/N& 0n/NXHm0n/NP/-zHx8JngJmg F` G/N& /-zHx#0n/N Hm0n/NPHx0m/NzPJmvgN~N^NuNVHm/.NP/-zHx@Jg ml h| g F` G/N& /-zHx?Jg ml hx g F` G/N& /-zHxKJg ml h g F` G/N& N^NuNV n JPg$/-z n T 0P/0n /N& `N^NuNV G;H0n CNb g0n CNb=H 0n C f A =H 0n Cf A'=H 2n A o2n Al F` G g0n /NX`0n /NzX0n /NX0m=H g`D``?&@&A\TBtlCD9`/N:XN~N^Nu NVN^NuNV G=H/-l/NPCfC0n/0PC"_2Hm0n/ n0P//N\`C0n/2PRn0n"_2 G=H n0PCgBC0n/0PC@"_2Hm0n/ n0PNbp//N\`C0n/0PCP"_2`B2n n hNb I f*C0n/0P/Rn0nC0"_"_2` nP0P=H n0h "H0m"H F I=H0n/0n/HnHnHnHnNp0n//N|P G=H2n n hl` 0nRn`C0n0P/"n0n0P"_g,/.0n/0n/C0n0P/N"n0n/C0n0P"_22n n h=H`r0n/0n/HnHnHnHnNp0n/ n0hCNb/N|PN^NuNV nT0P=HC0n2AT"H0n2AX/2n0m"H F I"_2A\/2n n\0P"H F I=H"_20n//NP0n/HnN(P0n/HxNP2n A Nb=HJngJ0n/C0n0P/NPA\"HAT0P20n/HxHnN 0n CNb gA\"H0n2HnAX/2PA I"_2"_2 F=H0n CNb g A=H0n/C0n0P/NP0n/HxHnN 0nC=H0n CNb=H g2mAmD0n /HnHxND 0n/0nC/0n/HnN`22n Fo&0n/0n"F/0n/HzNN^NupNVA=HJn g A =H0nSn g2nAl F` G g$"n0nRn/2P0nNb"_2`N^NuNV nT0P=HC nP0P2AT"H n0h 2A\"H n0h2AX"H0m2HnHnN^P0n//NP0n/HnN(PA/2P0m"_2AX"H0n20n//NP0n/HnN(PA/0P/0m"F"_"_2AX/ n0h$"H0m F I"_2AXJPg4HnHnN^P0n//NP0n/HnN(P G=H2nAl$` 0nRn`"n 0n"H G2`N^NuNVN²-H G=HC0nJPgH` 0nRn`C0n2P0n f /"n0n/NPN^Nu` GN^NuNVAhN^NuNVT G=H/-zHxHnNW /Hx HmN /-HxHnHxNXV/-Hx!HnHxNXV/-Hx"HnHxNXV/-Hx'HnHxNXV/-Hx(HnnHxNXV/-Hx)HnTHxNXVC G C G C G C G CT G HnnHzN!tP G=H2nAlP` 0nRn`C~0n//-lC0n0P"_ P"_20n//NP` ml h/HnHnHnN ml h/HnHnnHnTN/-HnHm/NY^JnfB/-/NP=H0n`//NP`//NP`//NP`//NP`Hx/NP`Hx/NP`Hx/NP`Hx/NP`Hx/NP`Hx/NP`x F=H`n`jNbBJRZb l v`/-HnHmNZ /-0n//NV 0nCf G=H2nAl@` 0nRn`/-lC0n0P"_/C~0n0P"_"` ml h/Hx1HnHnHnNLj ml h/Hx2HnHnnHnTNLj/-lNX/-l/NPN^Nupage #NV nJgL nC-H/./.N(P-H/./. N(P-H/./.N(P-HN^NuNV n R H0@=H0nCf`(0nC f` nR"H0n `"n G  n N^NuNV nR"HA  nR"H.H0@ /./.N!tP/.HmN!&P/./. N!&P/.HmN!&P/./.N!&P/.HzN!&PN^Nu NV0n =HJnf0n Nbx=HJngA~0h "Ff F` G gN^NuJn g@C~0n0P/C0n0P"_fN^NuC~0nRP0P`(C~0nJPfN^NuC~0nSP0PJngA~A SP0P`A~A RP0P0n//NPHx/NPN^NuNVC0n0P=H/-0nCNb"_C /N[nX-H/.N[nX-HC~0n0P//.C0n0P"F/ND Jn g/-0n/HmNZV N^NuNVJmvgHxNXN^NuN"HAPlHxNXN^NuHmN]X fN" fNN^NuNV/-zHxHnNW /Hx HnN F;HvA;Hx/.Hx 0m~Nbx/NV /.Hx 0m~/NV /.Hx0m/NV /.Hx0mNbx/NV /.Hx0mv/HxN6/.Hx0mx/HxN6/.Hx0mz/HxN6/.Hx 0m|/HxN6/./0n/AT0P/AX0P/A\0P/NX=H0nCf nC8C /N[|X"FNb"GV @;H~ nCC /N[|X"FNb"GV @;H/.HxN̨P;Hv/.HxN̨P;Hx/.HxN̨P;Hz/.Hx N̨P;H| GN^NuAN^NuNV/.0nCNb"_C /N[nX-H/.N[nX-H/.Hz,N!tP0n//.0n "F/ND N^Nu00NV/. 0n CNb"_C /N[nX-H/.N[nX-H/.N dXN^NuNVN=H0n"FNb gAn-H` Ar-H0nCNb gAV-H` AQ-HHnHmN!tPHn/.N!&PHn/.N!&PHnHzN!&PHnHx:N!P-H0m/ nC-H/HxND 0mv/ nC-H/HxND 0mx/ nC-H/HxND 0mz/ nC-H/HxND 0m~/ nC-H/HxND 0m|/ nC-H/HxND Hm`Hn/N N^Nu AUX: LST: NV?/.0n/N2P=H0n//NX"_nN^Nu2nAm A=H"n0n"HA] 2n0noX0n=H2n0nl&` 0nRn`"n0n"HA. `/.0n"F"_"H G `H2n0nl:0n=H2n0no$` 0nSn`"n0n"H G ``4N^Nu`,Nb.][`/-lNX///HnHnHnHnNtN^NuNV ml h-H/.Hx]NP-H"n n0n N^NuNV ml h-H/.Hx[NP-H"n n0n N^NuNV0mf=H0m=H n P2P n 0h$=H n 0h =H n 0h "H n 0h$ I=H0m=H0n/2n ml hL0mfNb"_=HHx/N PHx/N P0n/0n/0n/0n/0n/0n/0n/0n/HnHnN (Hx/N P//N P0n/2mfANb"_"H0n0mfNb"H ml hLN^NuNV ml h -H ml h -H0n=H0n=H/.HnHnN 0n=H2n ml hP I=H"n0n2PA Nb=HJn f0n`/-l0n/HxN `Jngx/-lHnHnN nXJPo2n nT0Pm F` G g&2n nT0P I=H nC-H`/-l/.NP`>N`4NbTL`XP``&0nCf Jng/.0n/NP`0n=H/-lHnHnN nXJPo2n nT0Pm F` G g&2n nT0P I=H nC-H` n0P/NX=H0nCg2n0nl F` G g2n0n I=H` G-H2n ml hP I=H/.0n/0n//.Nj/-l/NPN^NuNV n P0P=H0n=H n 0h "H0m=H0m=H n 0h"H0m I=H n \0P=H0n/2n ml hP0nNb"_=HHx/N PHx/N P0m/0n/0n/0n/0n/0n/0n/0n/HnHnN (Hx/N P//N P0n/2nANb"_=H/. HnHnN 2n0n g@/-lHn HnN /-l/.NP/-l0n/HxN N^NuNV2m n0h =H0n=H G=H n\0P=H2n0nNb"H0n=H2n0nNb"H0n=H0n=H2n0nn2`2n0n=H`/.0n/N"P0nRn`Hx/N PHx/N PHx/////0n/Hx0n/////////HnHnHnHnHnHnN\=HHx/N P0nCNb g`0nCNb g2n0nl40nSn o/.0n/N"P2n0n I=H`0n/2n0n"_mL2n0n=H2nAclRnJno F` G g/.0n/N"P``//N PJno0n=H0n=HJno2`2n0n=H0nSn`/.0n/N"P`Jg "n0n2/-l/.N4P`&/-l2n ml hP/0n/N `Jg/-l/.NPN^NuNV n T0P=HC n P0P2AT"H0n 2AX/0n"H0m"H F I"_2A\/2n n \0P"H F I"_20n/HxN@P0n//NP0n/HnN(P0n//N@PN^NuNVNHx/N PHmfHmhHmHmN 0;Hd0mhC;H0md/Hx/HmN>0md/Hx/HmN>0md/HxHmN 0md/HxHmN /HxHmjN Aj\2PA,l F;HA;HA;HA;H G=H2nAl`0nC=H`Hm0n"F"_/Hm0n"F"_2PANbC"_2Hm0nC"_/Hm0nC"_2PANb"HA I"_2`rAjX2PAlzA ;H G=H2nAl^`0nC=H`Hm0n"G"_/2PANb"_2Hm0nC"_/2PANb"_2`N^NuNVvHxHxNP-HJf GN^Nu0md=HHmrHnHnzNh nT"H0n20n//NP0n/HxN|P0n/HmHm nHh(Hm nHh2N G=H2nAlD` 0nRn`C0n/Hm0mCNb"H0n"_0P"_2` nX"H0mf2 n\"H0mh2/.Hx0mj/AjT0P/AjX0P/Aj\0P/N l"_2/Hx0n/AT0P/AX0P/A\0P/ nP/ nHh nHh nHhN (/.N2X n0h"H0m0mhNb=H n0h "H n0h$0mfNb=H n0P/HxHz@N 6 AjX2PANb/Aj\2PANb/HxHx0n/AT0P/AX0P/A\0P/N Rm0m n0P/0n/AT0P/AX0P/A\0P/N  n0P/Hx nP/N nP/ nHhN^P0n// nHhNT /./N>P/.0n/0n/N` -HvC n0P"H nv" nvN^NuNV nP2P0m"FCNb=H0nC ICNb=H nHh$0m"F"H0n"_2N^NuNV G-H"nAl:` nR`C n P-HJg/.N,X`0md/HxAT/N 0md/HxAT/N Hx/N PN`N^NuNV n h -H n0P/N XAjX2PANb/Aj\2PANb/HxHx0mj/AjT0P/AjX0P/Aj\0P/N n0P/N 4X nT0P/NXC n0P"H G"Sm0m/.NX/.NFXN^NuNV n C. H0@2 n T0P/. H0@CNb/N|PN^NuNVA=H n T0P=H n \"H0n 20n Cf A =H n C&0n20n/0n/HnHnHnHnNp0n/HxN|P0n/HnHn n Hh(Hn n Hh2NN^NuNV n 0h=H/. N~X. H0@C f A @ C. H0@ AR"H G /. HnNpPJng/. N\XN^NuNV G=H G=H/.N`X=H n 0h=H n T0P=H/. HnHnN 2n n 0h0=H0nCtNb f n \2P0mhf G` F g0nC@Nb g0m=HA=HHnAX"H0n2"_2AP/AHh 0n/2mf0nNb"_"_2"_20nCNb gfAX/2P n 0h2 I"_2AP/2P n 0h2 I"_2A/2P n 0h6"_2AA /2P n 0h6"_2AT/AHh2n F I"_2"_2A\/AHh 2n n \0P"_2"_20n/HxNP0n/0n/NP0n/0n/NP0n/HxHnN\ 0n//NP0n//NP0n/HxN@P0nC0Nb g^0n/HxHnHnHnHnNpJmf0nCNb g F` G g2nA I=H0n/0n/0n//.N n \0PCf&0n/Hx HnHnHnHnNp0n/ n 0h /N@P n A/2P0n"_2N^NuNV nT0P=H/.0n /HnN fN^NuHmjHnNP fN^NuHnHnN^P G=H2nAl^` 0nRn`Hn0nC"_/C0n/C0n/C0n0P"_2"_2"_2`JnlPAT/2P0n I"_2AA/2P0n"_2AT/A\2P0n"F"_2`PA\/2P0n I"_2AA /2P0n"_2A\/AT2P0n"H F I"_2C G"0n/HxHnHnHnN0n//NP0n/HnN(PN^NuNV nT0P=H n0h=H/.0n /HnN fN^NuHmjHnNP fN^NuHnHnN^P/.N~X G=H2nAl^` 0nRn`Hn0nC"_/C0n/C0n/C0n0P"_2"_2"_2`JnoPAP/2P0n"_2AX/2P0n I"_2AX/0n"H0n"H F I"_2`FA/2P0n I"_2AA /2P0n"_2HnAX2P0n"F"_2C G"0n/HxHnHnHnN0n//NP0n/HnN(PJng/.N\XN^NuNV n 0h=H/. 0n /HnN fN^NuHnHnN^P/. N~X n T0P//NP n T0P/HnN(PJng/. N\XN^NuNV0n/0n/ n"G/ nC/ nC/ nC/N PN^NuNV0n/0n/ n0P/ nT0P/ nX0P/ n\0P/N N^NuNV nT"H n 0P2 nT"H n T0P2 nT/ n 2P n X0P"H F I"_2 nT/ n T2P n \0P"H F I"_2N^NuNV"n nl n N^Nu nN^NuNV"n no n N^Nu nN^NuNV n2P nX0P/ n 2P n X0P/NP=H nT2P n\0P/ n T2P n \0P/N`P=H n0P/ n 0P/NhP=H nT0P/ n T0P/NJP=H nT"H0n2 nT"H0n2 nT/2n0n I"_2/.2n0n I"_22n0no2n0no F` GN^NuNVJn g/. N\X`/. N~XN^NuNV n0h f/.NXN^NuNV n0h g/.NXN^NuNV nT0P=H/.HnHnN C0n2AT"H0n2AX/2n0mf"H F I"_2A\/2n n\0P"H F I"_20n/HxN@P0n//NP0n/HnN(P0n/ n0h /N@P nC n0hNbx2N^NuNV/. n0h"H0mfNb"H nP0P"H n0h$"_2/. n0h"H n\0PNb"H n0h "H0m"_2N^NuNV/.HnHnN HmjHnNLP2n0mf"HAX0Pn&2n n\0P"HA\0Pn G` FN^NuNV n0h=H/.NX nC0n 2 nC0n2Jng /.NXN^NuNV/.HnHnN /. nP2P n0h$"_2 nT/ n0h "H0m"_2 nX/ n0h "H n0h$ I"_2 n\/ n0h"H0m I"_20n`r n\/2n nT0P I"_2` nT/2n n\0P"_2`f"n0n2 nT"H0n2 n\"H n\0P2`8`4Nb` nP//.N2PN^NuNV n0P/Hx nCNb/"n n I"_Nb////N  n0P/Hx n CNb"H nNb////N N^NuNV"n n o& nCNb/"n n I"_Nb-H n0P/Hx /.///N  n CNb"H nNb-H "n n0h"g0 nC" n 2 n0P/Hx/. ///N N^NuNVJmfN^Nu n0P/Hx HnHnHnHnN P2n n0Pg@ n0P/Hx n0P////N C n0P/NXN^NuNVN^NuNV/HztNGPN^Nu[3][This facility is not|implemented yet][CANCEL]NVC0n2 F=H2nAl,` 0nRn`C0n"H nT0P2`Hx/Hx0n/N@N^NuNVC0n2AT"H0n2Hxi//0n/N@/. A0P"_2/.AT0P"_2N^NuNV/. NAlX/.NAXHxn//0n/N@N^NuNV/.NAXHxo/Hx%0n/N@HmNAXN^NuNVC0n2AT"H nT0P2AX"H n0P2/.NAlX/. NAX/.NA*XHxy//0n/N@HmNA*XN^NuNVC0n 2Hxz//0n/N@N^NuNVHx{//0n /N@N^NuNV/.Hx|//0n/N@"_2/. AL0P"_2/.ALT0P"_2N^NuNV/.Hx//0n/N@"_2N^NuNVC0n 2Hx //0n/N@N^NuNVN@r/.NAX/.NA@X nCZ/NAVXHxd/Hx n 0P/N@/. AA 0P"_2HmNAXHmNA@XHmLNAVXN^NuNVHxe//0n /N@N^NuNVC0n2/. NAlX/.NAX/.NA*XHxmHx/0n/N@HmNA*XN^NuNV/.NA*XC0n2HxHx/0n/N@HmNA*XN^NuNV/.NA*XHx0n//0n/N@HmNA*XN^NuNVC0n 2Hx//0n/N@A0PN^NuNVC0n 2AT"H G2Hx//0n/N@AL0PN^NuNVC0n 2Hx//0n/N@A0PN^NuNVC0n2AT"H0n 2Hxl/Hx0n/N@N^NuNVC0n 2Hxq//0n/N@N^NuNVC0n2AT"H0n2 G=HC0nRn"H nRB @2 g`Hx/Sn0n/0n/N@N^NuNVC0n2AT"H0n2/. Hx'/Hx0n/N@"_2/.AT0P"_2N^NuNVC0n 2Hxj//0n/N@N^NuNVA-HA-H nT"H0n2 nT"H0n2 nT"H0n2"n G2 nT"H0n2 nT"H0n 2 nT"H nRB @2 g`AC A 2Hx HxU"nAʓ FNb/0n"/N@N^NuNVC G2AT"H0n2Hx //0n/N@/.AL0P"_2/.ALT0P"_2/. ALX0P"_2/.AL\0P"_2N^NuNVC0n 2Hx //0n/N@N^NuNVC0n 2Hx//0n/N@N^NuNVC0n2Hxk//0n/N@/.AL0P"_2/.ALT0P"_2/. ALX0P"_2/.AL\0P"_2A0PN^NuNVC0n 2Hx//0n/N@A0PN^NuNVC0n 2Hx//0n/N@A0PN^NuNVC0n 2Hx//0n/N@A0PN^NuNV/.NA*XHxrHx/0n/N@HmNA*XN^NuNV/.NA*XHx 0n//0n/N@HmNA*XN^NuNVC0n 2C0n2AT"H0n2Hxg//0n/N@N^NuNVC0n 2Hxh//0n/N@A0PN^NuNV/. NAXHxp/0n CNb/0n/N@HmNAXN^NuNVC0n2AT"H0n2/.NA@XHx/Hx0n/N@HmNA@XN^NuNVHx//0n/N@/.A0P"_2/.A0P"_2/. AL0P"_2/.ALT0P"_2 nT/AL\0P"_2 nX/ALA 0P"_2 n\/ALA0P"_2 nP/ALA0P"_2/.ALX0P"_2 nT/ALP0P"_2 nX/ALA 0P"_2N^NuNVCA"AX"HA"AP"HA"AC A"ACAL"N^NuNVC0n2AT"H0n2A\"H0n2AC 0n 2NAA0PN^NuNVA"psNBN^NuNVAX"H n"N^NuNVAP"H n"N^NuNVAC n"N^NuNVAC n"N^NuNVAA-H"n n"N^NuNVAA-H"n n"N^NuNV/.NAlXN^NuNVAA-H"n n P"N^NuNVHm.AF"_"A.X/AN"_"A.P/Al"_"A.Hh A"_"A.HhA"_"A.HhA"_"A.+H*Hx NNXAB0 @;H( FN^NuNVHxNNX FN^NuNVCl0n"2AlT"HB0. @2AlX"HB0. @2HxNNX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2AB0 @N^NuNVClB0.b @2AlT"HB0.^ @2AlX"HB0.Z @2Al\"HB0.V @2AlP"HB0.R @2AlC B0.N @2AlC B0.J @2AlCB0.F @2AlCB0.B @2AlCB0.> @2AlCB0.: @2AlCB0.6 @2AlCB0.2 @2AlCB0.. @2C n("AlCB0.& @2AlCB0." @2HxNNX/.ATB0 @"_2/.AXB0 @"_2/.A\B0 @"_2/.APB0 @"_2/. AA B0 @"_2/.AA B0 @"_2AB0 @N^NuNVC n "Cl0n 2HxNNXN^NuNVC n"Cl0n2AlT"H0n 2HxNNXN^NuNVC n"Cl0n2AlT"H0n 2Hx NNXN^NuNVC n"Cl0n2AlT"H0n 2Hx!NNXN^NuNVC n "Cl0n2AlT"H0n2AlX"H0n2Al\"H0n2AlP"H0n2AlC 0n 2Hx*NNXN^NuNVC n"Cl0n2Hx,NNX/. ATB0 @"_2/.AXB0 @"_2AB0 @N^NuNVC n"Cl0n2AlT"H0n2AlX"H0n2Al\"H0n 2Hx+NNXN^NuNVC n "Cl0n 2Hx2NNXN^NuNVCl0n*2AlT"H0n&2AlX"H0n"2Al\"H0n2AlP"H0n2AlC 0n2AlC 0n2AlC0n2AlC0n 2Hx3NNXN^NuNVC n"Hx6NNX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2AB0 @N^NuNVCl0n 2Hx5NNXN^NuNVCl0n2C n"Hx4NNXN^NuNVCl0n&2AlT"H0n"2AlX"H0n2Al\"H0n2AlP"H0n2AlC 0n2AlC 0n2AlC0n 2HxINNXN^NuNVCl0n&2AlT"H0n"2AlX"H0n2Al\"H0n2AlP"H0n2AlC 0n2AlC 0n2AlC0n 2HxJNNXN^NuNVCl0n2AlT"H0n2AlX"H0n2Al\"H0n2HxFNNX/. ATB0 @"_2/.AXB0 @"_2AB0 @N^NuNVCl0n.2AlT"H0n*2AlX"H0n&2Al\"H0n"2AlP"H0n2AlC 0n2AlC 0n2AlC0n2HxGNNX/. ATB0 @"_2/.AXB0 @"_2AB0 @N^NuNVHxMNNX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2AB0 @N^NuNVCl0n2C n"HxNNNXN^NuNVHxONNX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2N^NuNVC n"AX"H n "HxZNNX/.ATB0 @"_2AB0 @N^NuNVClB0. @2AlT"H0n2AlX"H0n2Al\"H0n2AlP"H0n 2HxdNNXN^NuNVCl0n2AlT"H0n2AlX"H0n2Al\"H0n2AlP"H0n 2HxeNNXN^NuNVCl0n 2HxfNNXN^NuNVCl0n 2HxgNNXN^NuNVCl0n2AlT"H0n2HxhNNX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2AB0 @N^NuNVCl0n2AlT"H0n2AlX"H0n2Al\"H0n2AlP"H0n2AlC 0n 2HxiNNXN^NuNV0n/0n/"nANb//.//NLN^NuNVCl0n2AlT"H0n 2HxjNNXN^NuNVCl0n 2HxkNNXN^NuNVCl0n.2AlT"HB0.* @2AlX"H0n&2Al\"H0n"2AlP"H0n2AlC 0n2HxlNNX/.ATB0 @"_2/.AXB0 @"_2/. A\B0 @"_2/.APB0 @"_2AB0 @N^NuNVC n"HxnNNXN^NuNVCl0n2AlT"H0n2HxpNNX/.A P"_"AB0 @N^NuNVCF0n 2Hm2n A ICNb"_-H F=H2nAl0` 0nRn`CF0n"H nRH0@2`NONAB0 @N^NuNV"-*0<NBN^NuNV/-!NTXN^NuNV/./-!NSPN^NuNV/./-!NTlPHx /-!NSPN^NuNVHx$/NZP-H fA+H! GN^Nu/. /./.NO o nN^Nu GN^NuNV n H0@/N]X-H n`H G-H F-H`Z F-HA-H`HA-HA-H`4A+H!N^Nu`$NbRWA`/.Hz@N]P gB nCNb-HJg/HxPHxHz/N5+H! m! -H`/.HzN]P g$ nCNb-H nC-H`/.HzN]P f/.HzN]P f G` F g2JfA-H` A-H nCNb-H`N n"Ff*HxA/.NcPHx n/NcP"_" g AN^Nu nX/N[X nHh nHh nX"H G""_""_" GN^NuNV n C fHx /.NXLP/. /.NXLP n C f/.NSX g F` G g /.NV8X n h g AN^Nu n N^NuNV n Jg n R H0@//.NSP`N^NuNV/.NVhX-H nC f8/.NVhX-H nC f n-H`/./.NU

/-!NV8X nHh n/ nX/HxN5 "_" nP"H G"`^/.NRX g n/NcXN^Nu nP"P n hm/.NWX g F` G g AN^Nu nX"P nP$H PR-H nH0@CNbN^NuNVHx? n/Hx nX/Nc-HJo nC n" nC G"`6 nC G"Jf nCA"` nC n" nP"H G" n hN^NuNV n hCNb f nCA"AN^Nu/.NSXNbx g/.NRX g F` G g n//. NcP n N^Nu nX"P nP$H PR-H"n n  nC F" nP"PAm/.NY8X g F` G g AN^Nu n N^NuNV/.NSX g8 nX P-H"n nP P"H G  n//.N5P`rHx@ n/ nP/ nX/Nc-HJl nC n"`2"n nP Pl nCA"` nC G" nP/ nC G""_" n hN^NuNVHzNOX. H0@/NZ@XN^NuabortedNVNZ`HxL. H0@/NcPN^NuNV m!-HJg/.NV8X n h -H`N#N^NuNV/.NOX/. NZ@XN^NuNV"n nNb//NZPN^NuNV/./NZPN^NuNV n CCNb-HHxH/.NcP-HJf GN^Nu nR"HA  n"FNb g nR"HA  n-HJg" n S o nR"H G ` nN^NuNVS nH0@-H nCfS nH0@-H nCfHxI/.NcP GN^NuNVHxHHxNcPN^NuNV"nA _ @N^NuNV n Jg, n H2@. H0@f n N^NuR n ` GN^NuNV n H2@ nH0@f$ n Jf GN^NuR n R n` n H2@ nH0@ IN^NuNV n-H nS oH nR"H n R H0@  g` nS o nR"H G ``"n G  nN^NuNV"nAzn"nAam F` G g"nA IN^Nu nN^NuNV"n F I-HR nJg`"n n IN^NuNV n Jg@ n R H0@/N]X/ nRH0@/N]X"_g GN^Nu` nH0@"GW @N^NuNV G-HJgtHnHnHnHnNJJngT/N5X///HnHnHnHnNBt//N5P-H nCf /NZ@X nN^NuHx NcX glHxNcXCNb-H nC f A -HJg8 nCfN5CNb-H` nCf /NZ@X nN^NuNVJl nNbpN^Nu nN^NuNVJo FN^NuJf GN^NuAN^NuNVJl nNbp-HA- @` A @Jo"n S n"H G `4Jl nNbp-H`"n nJg R n`JgH"n S n/"nA Nb IC0"_ "nA Nb-H f``Jg"n S n"H.H0@ Jo"n S n"HA ` n N^NuNV nH0@/N[X g R n` F-H nH0@`A-HR n`Nb-+ G-H nH0@/NaX g0 nC Nb"H nRH0@"HA0 I-H`"n nNbN^NuNV"n F I-HR nJg` nR"H nRH0@  g` n N^NuNV n -H nR"H nRH0@  g` n N^NuNV G-H n Jg, n H2@. H0@f n -HR n ` nN^NuNV"nA9n"nA0m F` GN^NuNVHxA/.NcP-H nC߳f GN^NuJg AN^Nu GN^NuNV/.NbXN^Nu D @Nu W @Nu F @Nu " @Nu " @Nu " @Nu " ANu " ANu " ANu"_ g "fNN BNu"$ 68HAHBBHABA҃ ANu$ma`DaD A"BNu$" a A"BNu" j DaDDNu cPgc $BNurBNu&BCHCR(*$a.$Â$&HCHCԃb DbR`S`NuHPBAHA62HAB42HA6Nu$O?*NA @.JNu$O?*?* `$O/*?* `$O?*/*?*`$O/*/*?*?*`$O?*?* /* ?*`$O/*/*/* ?*?*`NV G+H!+H!HzzHz{NOP+H! nRH0@-H nC//NZP-H/././.N\ C!"A!r" nJg nH0@`R n`R/.HzHm!Nf -H`R nH0@C>f"R/.HzHm!Nf -H`/.HzHm!Nf -H`n"m!AlC!" m!R!"H n"/.NeX-H`$NbF H<^>``J!fHz1Hz2NOP+H!J!f m!+H!N^NuCON:WrawCON:RNV nJg< nH0@/N[X g nR"H G  nN^NuR n` nN^NuNV n-H/.NeX-H/././. NOP"_" nN^NuA 0g C" ӑ`Nu   $  ,04,044884@DH@DHLLHLLH .,!?:;_GST word processor[....................................................] DGFEHI#$&'*+,-45DEFGHIMNOQRS7:;=B""33ww!#$&'(*+,-/0124578:;=?@BDEFGHIKMNOQRS+z+,=,- -q-.?./ /x/0I01 1 1 1 1p1p1p1p12@233w34;445W56667S78889O9::w[1][Use OPEN FILE to create or|edit a file in a window - up|to four can be open at once][OK|CANCEL][1][Use PRINT FILE to select a|file for printing - remember|to use SAVE FILE first][OK|CANCEL][1][Use SAVE FILE to save the file|in the current window to disk|and to close the window][OK|CANCEL][1][Use SAVE AS to save the file|in the current window to disk|but give it a new file name][OK|CANCEL][1][Use PAGE LAYOUT to define the|page layout and the head and|foot lines for your document][OK|CANCEL][1][Use DELETE FILE to delete a|file from the disk permanently|to make room for SAVE FILE][OK|CANCEL][1][Use READ FILE to insert a|complete file from disk at the|current window cursor position][OK|CANCEL][1][Use WRITE FILE to save the|contents of the marked block|in the window to a disk file][OK|CANCEL][1][Use QUIT EDIT to close the|window without saving the text|and to exit to the GEM Desktop][OK|CANCEL][1][Use WP MODE for document text|only - turn it off for editing|program sources or data files][OK|CANCEL][1][Use INSERT MODE to show if the|text you type must be inserted|or must overwrite the old text][OK|CANCEL][1][Use FIND to search for a text|string within the window and|to move the cursor there][OK|CANCEL][1][Use REPLACE to search for a|text string and replace it|with a second text string][OK|CANCEL][1][Use REPEAT FIND to repeat the|previous FIND or REPLACE|from the cursor position][OK]|CANCEL][1][Use SET MARK to remember a|position in the current window|so you can GOTO MARK later][OK|CANCEL][1][Use GOTO MARK to return to a|position in the text that you|have remembered with SET MARK][OK|CANCEL][1][Use START BLOCK to define or|modify the start position of a|block - then use END BLOCK][OK|CANCEL][1][Use END BLOCK to define or|modify the end position of a|block - use after START BLOCK][OK|CANCEL][1][Use CUT BLOCK to copy the text|in the block to the clipboard|so you can PASTE BLOCK later][OK|CANCEL][1][Use PASTE BLOCK to copy the|text on the clipboard to the|window at the cursor position][OK|CANCEL][1][Use COPY BLOCK to copy the|text in the block to the|window at the cursor position][OK|CANCEL][1][Use MOVE BLOCK to move the|text in the block to the|window at the cursor position][OK|CANCEL][1][Use DELETE BLOCK to delete the|text in the current marked|block - permanently][OK|CANCEL][1][Use FIND START to move the|cursor in the window to the|start of the marked block][OK|CANCEL][1][Use FIND END to move the|cursor in the window to the|end of the marked block][OK|CANCEL][1][Use HIDE BLOCK to remove the|start and end block markers|and undefine the block][OK|CANCEL][1][Use BOLD before typing text|that you want to see in bold|and before a RESTYLE command][OK|CANCEL][1][Use UNDERLINE before typing|text that you want to see|underlined and before RESTYLE][OK|CANCEL][1][Use ITALIC before typing text|that you want to see in italic|and before a RESTYLE command][OK|CANCEL][1][Use LIGHT before typing text|that you want to see in light|and before a RESTYLE command][OK|CANCEL][1][Use SUPER before typing text|that you want to see in|superscript and before RESTYLE][OK|CANCEL][1][Use SUBSCRIPT before typing|text that you want to see in|subscript and before RESTYLE][OK|CANCEL][1][Use RESTYLE to changed the|text style of a marked block|to the style options selected][OK|CANCEL][1][Use JUSTIFY to show if you|want 1st Word to justify your|text on the right margin][OK|CANCEL][1][Use WORD WRAP to show if you|want 1st Word to wrap onto the|next line at the right margin][OK|CANCEL][1][Use SPACING to show if you|want 1st Word to use double|line spacing in REFORMAT][OK|CANCEL][1][Use CENTRE to position an|existing line half way between|the left and right margins][OK|CANCEL][1][Use INDENT to define your|paragraph indent size before|typing or a REFORMAT command][OK|CANCEL][1][Use REFORMAT to rejustify a|paragraph after you have|changed the text or style][OK|CANCEL]c <@ABC=[1][To create or amend a document|use OPEN to open a text window|(up to 4 can be open at once)|then SAVE when you've finished][ OK ][1][Use LAYOUT in the File Menu|to specify page shape and size|and head and footline text][ OK ][1][To set the text margins move|the pointer to the ruler line|and drag the margin indicator|to the required position][ OK ][1][To set or clear tab points|move the pointer to the ruler|line and click the mouse at|the required position][ OK ][1][WORD WRAP handles line ends|for you automatically at the|right margin. JUSTIFY aligns|the text on the right margin][ OK ][1][To correct your document use|EDIT to open the file then|scroll through the file and|delete or add text as required][ OK ][1][The cursor shows where editing|or typing will happen. Move it|with the keys marked    |or move the mouse and click][ OK ][1][Click in the GEM scroll bars:|    for single line/column|shaded area for window scroll|or drag the white slider bar][ OK ][1][Use BACKSPACE for characters|to the left of the cursor.|Use DELETE for characters at|the cursor position][ OK ][1][INSERT = insert line|CONTROL+SPACE = fixed space|CONTROL+ or  = move word|CONTROL+DELETE = delete word][ OK ][1][Define a block with START and|END BLOCK or by dragging the|mouse in the window. Then use|the BLOCK menu to move text][ OK ][1][Use INSTALL PRINTER to|select type (DOT or DAISY) and|the port (PRINTER or MODEM).|Use PRINT to specify output|mode and print a document][ OK ][1][Click in the left border to|insert or delete page breaks.|F7 also inserts a new page.|Drag the mouse for a|conditional page break][ OK ]1ST_PRNT.PRGDSYDOT, X(KZ |FP *, R >  ~v0@< @8,NNL84l@X,* lH .fB>nj"(T >:@0 `6,L|&2Z\fx& Rz2*6$, ,N( tVx:*D. HnT` l 4 T ($t0"t* &&$&   @P| b>.$ $p 2 2 4$ Zv   4 &,&(*,^4..   "B0..08   * *\\$ $6 T4*L.rPB&08.<(022$TVp,<~ f̈(   <2 *$"d ("2"p4Z>n0L^6&. & 2.$><^HR$ D< :f:8.l$ V : $VD"J@$(@V N 4 4 DP$"$>*L$ ".t.$(  n`6<r^N~.08$" &@"LZX>V("VF$:p^4 ("@ "0&&F0Ąr     "        42 .24" ((((*0222B2 H"B ($4  &H0$L0P6N22N>tt\"6(~J&40XFZ6D` $8>4   *4..$:2\&$$$$$n$,LBX$(*\N((Vj@&8@ v^"b ` bx@ .$NVrN$& ,~. *XTZ>"X* >r*"J 0~4X6@<6 2* JD""(l4ZZ:4`$`:D J:pQUITAbandon the current edit andleave original file unchangedCANCELOKWRITE FILEWrite marked block to filec:\abcdefgh\abcdefgh.ext Filename: _________________________XXXXXXXXXXXXXXXXXXXXXXXXXCANCELOKReplace?YESNOCANCEL FIND STRING Find the specified text stringxxxxxxxxxxxxxxxxxxxxxxxx FIND: ________________________XXXXXXXXXXXXXXXXXXXXXXXXDir.CaseMATCHIGNORECANCELOK FIND AND REPLACE Find the first text string andreplace it with the second onexxxxxxxxxxxxxxxxxxxxx REPLACE: _____________________XXXXXXXXXXXXXXXXXXXXXxxxxxxxxxxxxxxxxxxxxx WITH: _____________________XXXXXXXXXXXXXXXXXXXXXDir.CaseMATCHIGNOREScopeSOMEALLONECANCELOK SAVE AS Save text in the specified filec:\abcdefgh\abcdefgh\abcdefgh.ext ____________________________________XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCANCELOK 1st Word ProcessorSoftware by GST, Cambridge, EnglandAuthors:Howard ChalkleyWill FookesPenny HallChris ScheybelerOKCopyright GST Holdings Limited, 1985Version 1.06 (USA)F4F1 BOLDF2 UNDLINEF3 ITALICF4 LIGHTF5 INS MODEF6 DEL LINEF7 NEW PAGEF8 CENTERF9 INDENTF10 REFORMAT                     ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~   File Edit Block Style Help 1st Word... -------------------- Desk Accessory 1 Desk Accessory 2 Desk Accessory 3 Desk Accessory 4 Desk Accessory 5 Desk Accessory 6 Open... Print... ------------- Save Save as... ------------- Layout... ------------- Read... Write... ------------- Delete... ------------- Quit WP mode Insert mode --------------- Find... Replace... Repeat find --------------- Set mark #1 Set mark #2 Set mark #3 Set mark #4 --------------- Goto mark #1 Goto mark #2 Goto mark #3 Goto mark #4 Start block End block --------------- Cut block Paste block --------------- Copy block Move block --------------- Delete block --------------- Find start Find end --------------- Hide block Bold Underline Italic Light Super Subscript ------------ Restyle ------------ Justify Word wrap Spacing ------------ Center Indent Reformat Extra help -------------- Editing Layout Margins Tab points Typing Correcting Cursor Scrolling Deletion Keyboard Page breaks Cut & paste Printing PAGE LAYOUT FORM66__9901__9903__99Paper lengthTOF marginHead marginCANCEL03__9954__9905__99Foot marginBOF marginLines/pageOK_________________________XXXXXXXXXXXXXXXXXXXXXXXXXHead LHead CHead R_________________________XXXXXXXXXXXXXXXXXXXXXXXXX_________________________XXXXXXXXXXXXXXXXXXXXXXXXXFoot LFoot CFoot R_________________________XXXXXXXXXXXXXXXXXXXXXXXXX#_________________________XXXXXXXXXXXXXXXXXXXXXXXXX_________________________XXXXXXXXXXXXXXXXXXXXXXXXX PRINT FILE Print pages from001___999to999___999Page number offset000___999Left margin offset05__99Swap left & right headings onNOYESPrint qualityDRAFTNLQOKCANCELalternate pages?[3][The marked block is too big|for CUT and PASTE operations][ CANCEL ][3][Not enough memory available|for CUT and PASTE operations][ CANCEL ][3][Not enough memory available|to OPEN another document][ CANCEL ][3][Completely out of memory!|SAVE your file(s) NOW!][ CANCEL ][3][The disk is full! To SAVE you|must DELETE some files or use|another disk with enough room][ CANCEL ][3][Unable to read or write file.|See if the file or directory|exists, or see if the disk|is protected or missing][ CANCEL ][3][Block start or end not marked.|Use START BLOCK and END BLOCK|to define block position][ CANCEL ][3][Unable to REPLACE text string|because this would exceed the|maximum line length (160)][ CANCEL ][3][Unable to perform REPEAT FIND|because you have not used a|FIND or REPLACE command yet][ CANCEL ][3][Line too long.|You cannot create a line that|is longer than 160 characters][ CANCEL ][2][This file does not exist. Do|you want to create a new file?][OK| CANCEL ][2][A document already exists|with that name. It will be|renamed to "filename.BAK"][OK| CANCEL ][2][If you use CUT now you will|overwrite the buffer without|having PASTEd its contents][OK| CANCEL ][1][The block has been saved in|the buffer ready for PASTE][ OK ][3][This function is only valid|when in Word Processor mode][ CANCEL ][2][QUIT abandons the current edit|and leaves the file unchanged.|Use SAVE to save your work][OK| CANCEL ][1][Use EXTRA HELP to display an|alert like this for each menu|command before executing it][OK| CANCEL ][3][You can only PRINT a file|if there are no windows open.][ CANCEL ][3][There is not enough RAM|to run the printer driver][ CANCEL ][3][The file will be saved without|any style or layout data.|If you want to save the style|first select WP MODE from the|EDIT menu then SAVE the file.][OK|CANCEL][3][There are too many page|breaks in the file: the limit|is 256 hard or conditional|page breaks.][ OK ][1][Nearly out of memory:|save your file soon][ OK ][1][Nearly out of memory:|close one of the other windows][ OK ]\0pV -:U $)*+HIJhit $ %&'FGHa ,L bx   9^%%p 23'GJKLUV W\]^gh iqrs|} ~        1    <=">`a"b"""""89":\]"^"""""45"6XY"        % & @ o p    #%?YZt "j%q'  ,# '%H  % $ d              ' $   (                 '( D `|$ ' ' #       4 !CM!C E    $@   \ x    #  * <X1 t8  >  "1, !#!$8!%T!&p!'!(!)!*!+!, !-4 !.P !/l !0 !1!! ! P P$ Z _ f  m u } TP    "! & 4 B P ^ l z       !  3#2 $ % & ' ( *) :* J+ Z, j- z . / 0 1 2 " C4B5 6 7 8 9 *: :; J< Z= j> z ? @ A B 3 TDS E F  G  H  I  J  K ( L 5 M B N O O \ P i Q v R S  C   UcV W X Y Z [ \ ] ^ "_ 1 ` @ a O b ^ c m T |#&   @@@@  @ @ 0          @@L@@h          "#" " Z  a! h"$)"% & ' ()#(,'H d       " % )  7= AD K  d !l"$%D&L*4\8L`(^ .|CT?9C?9C?9C?< N%P3C|BWBg/<8C~?9??9??9??9C|N%P>C~?9??9??9??<$?<$09C~H?09?W09?H?09?WN# N^NuNV.Q/]/Y/U?< ?9C|N&@=n =n =n=n`=n=n=n=n./N'`XJ@g*>?.?.?.?<?./<-N$v.Q/]/Y/U?< ?9C|N&@JngJnfp3B~C:3BC<09B~yAS@3C>09By?S@3C@.C:?<?9?NXN^NuNVN .>n/<A/<B/<CzN$ 3?3pA yBoB=|`,0.м3 @0.м3 @Rn nmA3A3.8L?9CVN$TT3<.8\?9CVN$TT3A.CT/<C/<C/<C?<BgN&@3C|#.VA#.?#.?3BByCaJy?faaaa aaD>?NaaN^NuNV`\.CR/<?p/<CR/<CR/<?/<?Bg?N&.CR/<CR/<CR/<B?< ?9C|N&@.gaa409C|yBff>??9A?9B?9B~?<?</<-N$v>??9A?9B?9B~?<?</<-N$v`n yC|gd>0?90?9009BW?9009B~W?<aP>0?90?9009BW?9009B~W?<aP.gn09?`L09?yC|f >??9??9??9?BgaP`209?yC|fBWBgBgBg?< ?9C|N& `09?y?N3C|`09?yC|fa>C|N& >??9A?9B?9B~?9>n?9A09?H?09BW09AH?09B~WN#\>C|N&&>?N3C|`.09?yC|fp>??9??9??9??<?9C|N& .?/<A/<B/<B~?<?9C|N&@3B~-3B-`09?y?.?.?.?<$?<$BgBgBgN"f>?.?.?.?<$?<$BgBg?<N"f>?.?.?.?<Bg/<3N$vBW/<3N"DX|fLBn`60.P@м3 @( gB@`p"|A4nRn nmaa >?.?.?.?<$?<$BgBg?<N"f>?.?.?.?<$?<$BgBg?<N"f``||b@0@6* PN.g09C|yBfJyBg>??9??<Bg/<-N$ =@`..\/9A?<?<aPa *`../9??<?<aPa `r../9??< ?<aPa`P>b/<.\/9A?<Bg yAH?WN'X?a aByB`>b/<.\/9A?<?< yAH?WN(X?a| aZByB`>b/<./9??<Bg y?H?WN'X?a4 aByB`v>b/<./9??<?< y?H?WN(X?a aByB`,>b/<./9??<Bg y?H?WN'X?a aByB`>b/<./9??<?< y?H?WN(X?aX a6ByB`>>j/<1/<1?<+?<*?<(aH?RWaT`^.2/<2J?</?<.?<,aX H2>RW?9>hajT`"=|6`R0.м- @( g6>Bg?9??9A?9B?9B~Bg?./<-N$Rn n:o>?<?9??9A?9B?9B~Bg?./<-N$0.|3>b>?.WN""TByB`\BW?<?./<-N#PJ@g>/<-N"DX>Bg?9??9A?9B?9B~Bg?</<-N$>Bg?9??9A?9B?9B~Bg?</<-N$a*a a>??9A?9B?9B~?<?</<-N$v>??9A?9B?9B~?<?</<-N$v`L y>fa~>??9A?9B?9B~?<?<1/<-N$vByB` y>da6>??9A?9B?9B~?<?<3/<-N$vByB`BW?<?./<-N#PJ@g*a By2>??9A?9B?9B~BgaP`r0.|3C.B?<?9C?9?N2\>b/<.\/9A?<09BH?a >b/<./9??<09BH?a >b/<./9??<09BH?ar =|`h0.м- @( fL <2.Ҽ-"A >??9A?9B?9B~?<?./<-N$vRn no09/y/2f </>??9A?9B?9B~?<?< /<-N$vVy/Vy/]y/]y/ />??9A?9B?9B~?<?< /<-N$vJyCg <2.Ҽ-"A `(3/2/3/L/3/6/3/8/ >??9A?9B?9B~?<?./<-N$vByB` ByB``S@|9b@0@6 PN`3B.g409?p|| f$a>??9A?9B?9B~BgaPBWN&`N^NuNV./. ?.?<?<?. ?./<-N# ?0<_H}?N(X?aPN^NuNV0.|0"n >?<Vpn?N 6X? n0>??9A?9B?9B~?<?. /<-N$vN^NuNVBW?. ?. /<-N#P=@/.?<?<m?.N 6\ _0"n2>??9A?9B?9B~?<?./<-N$v0.N^NuNV yAH|}|>3B y?H|}|>3B y?H|}|>3B.B?9C?9?NXBn`,09Cn0@=2nB1QjRn nmN^NuNV> ?.?<#N(.X3>h3 >jN^NuNV.)a=@ nPl 0.|`0.|=@0.Hr-@.)a=@ 9P)f n ln 9A)f n fBn.)aHr㠁.)aHr㠁0.Hr 㠁.)alH뀁.?<N(.T.)aL@>/<)a@XW0.r `W?<+N(NT.)a@>0.r `W?<-N(NTN^NuNV n  fB@` nH| =@R nHn|N^NuNV>N(.-@ .?3Cp .r 3B .r3B .r3? .r|PHdH@3AN^NuNV>,N(N=@0.@|?3Cp0.r `|3B>*N(N=@0.|3B0.@|3?0.r `||PHdH@3AN^NuNVBW?9A/<)a\>?9?/<)a\>?9B/<)av\BW?9Cp/<)ab\JyBg,> y Bo ?9BW`?9B/<)a0\`>?< /<)a\ y BlpA`pP)N^NuNVJng0. H fp `0. H |0"nR0. H H@|0"nN^NuNV>/<AN%TX-|A n #@RDf n b@RDfBn` nH|2nARRn nm n #@RDf n c@RDfBn`* nH|}|>2n=2RRn n0m=|0`" nH|2n=2RRn n3m.a3=T.a3>N^NuNV>/<AN%TX-|ABn`j.B?<?.?9?N2\Bn`<0n"|B00H}|>2.n2A=3@jRn nmRn0.y?mBn` 0n=2n=0jRn n5m n #@RDf n c@RDfBn`,0n"|=00j|H}|0"nRnR n0m=|0`"0n"|=00j|0"nRnR n3mBW?9>h/.a,\TBW?9>j/.a\>/<AN%vXN^NuNV>/<AN%TX-|A n #@RDf n b@RDfBn`"0n"|A0H|0"nRnR nm>/<AN%vXN^NuNVBn` 0n=2n=1QjRn n5mBn`*0.@Hм=.?.?9?NXRn nm09C0@"|=00|H}=@0.|0"yA>?<Vpn?N 6X3.\09CR@0@"|=00|H}=@0.|0"y?>?<Vpn?N 6X3.09CT@0@"|=00|H}=@0.|0"y?>?<Vpn?N 6X3.a=|6`0.м- @Bh Rn n:o09=|6м- @1| >?<m09=S@?N 6X3131>?<m09>S@2?N 6X3232J>>?9=a TN^NuNV>>d?9>fNPTJy>fg <-` <-#2Jy>dg <-` <-#2N^NuNV9AH@>9AH@W9AH@W9AH@W9AH@W9AHW?<!N(.TN^NuB?< NA\#p<#@<#?r n1y>t n1y>vN^NuNV# <3 <3CZ3C\3C`3CfN P#? aF3BCVpN^NuNV>a*pN^NuNV3B3 B3 B3B3B3B3B3B3B3B3B3B3 B3"B#$Cr3(B3*B>N f n,0B n00B n40B n80B n<0B n@0BB@09BN^NuNV3B3 B>N fN^NuNV#Cr3 B>2N fN^NuNV3B3 B3 B3B3B3B3B3B3B>3N fN^NuNV#Cr>6N f n 0B n0B n0B n0BB@09BN^NuNV3B3 B3 B3B3B3B3B3B>IN fN^NuNV3B3 B3 B3B3B3B3B3B>JN fN^NuNV#Cr3 B3B3B>KN fN^NuNV#Cr3 B3B3B>LN fN^NuNV>MN f n0B n 0B n0B n0BB@09BN^NuNV3B# Cr>#N fN^NuNV#Cr3 B3B3B3B3B3B>*N fN^NuNV#Cr3 B3B3B3B>+N fN^NuNV#Cr3 B3B3B3B3B3B3B3B>/N fN^NuNV#Cr3 B>zN fN^NuNV#Cr3 B>{N fN^NuNV3B3 B3 B3B3B>dN fN^NuNV3B3 B3 B3B3B>eN fN^NuNV3B>fN fN^NuNV3B>gN fN^NuNV3B3 B>hN f n 0B n0B n0B n0BB@09BN^NuNV3B3 B3 B3B3B3B>iN fN^NuNV3B>kN fN^NuNV3B3 B3 B3B3B3B>lN f n0B n0B n0B n 0BB@09BN^NuNVH *n(n >0-W?0,WN(T:>0-W?,0,WN(T8>?N'T>>?,N'T<89F0G9@0F9@GoFnB@`pJL0N^NuNV0.n o0.`0. N^NuNV0.n l0.`0. N^Nu#87>97>:7>;7><-pL> -~>(p7h7 ,`7Dh7PX7< 07,8@  p 7@7h@ p  7@ 7h@p,7@ 7h@p87@8h@pD8@8h@pP8@8h@8"Xx82P`8'85`80 ` ` ` ` `40 ` ` ` ` ` ` ` ` ` `` ^ D D D  :  DDDDDDDDDD D D D DDDb D D D D D__:__ _M9999F__/__/__999999Cancel01234Printer Type:Pixels/Line:Printer Port:Paper Type:Color:Quality:DotDaisyB/WColor1280960DraftFinalPrinterModemFeedSingleINSTALL PRINTEROKCancel CONTROL PANEL Control Panel Install Printer*     (P$                      ": $,""B,       0&               (     .8 * :" R     ^B\2 ( F<&6* (        $ $                        *prRH0000`x00000000 #a000000 #b000000 #c77700070000606Np>N=n=n =n =n.U/Y/]/Q?< ?9<(N0`\.Q/NXJ@g>SW?.SW?.?.a6\a.U/Y/]/Q?< ?9<(N0JngJnfBWN>6NN^NuNV=|d=|=| y6f096 Z@=@ y6f096 =@>?.?.?.?< NP3<(BWBg/<-?<?9<(N >?.?.?.096??<0.H?0.W0.H?0.WN>?.?.?.?9<(NP.:/<:/<;/<;?<?9<(N0N^NuNVN .;/<;/<6/<;N$ 36.-?9;NfT34h3<(,04jB94k04tB94uBy*3;By6By6aN^NuNV`r.;/<6/<;/<;/<;/<;Bg?<2/<;"BgBgBgBgBgBgBgBgBgBgBgBgBg?<1N8=@>N.g09;"`09;(y<(f`>;0?9;.?9;,?9;*?<?9<(N .:/<:/<;/<;?<?9<(N0a`09;(y<(f>;0?9;.?9;,?9;*aD\`\09;(y<(fBWBgBgBg?< ?9<(N `,09;(y4hf y<(g>6N3<(`09;(y<(f><(N>:?9:?9;?9;096??<09:H?09;W09:H?09;WN><(N>6N3<(`\09;*y4hf2 y<(f aa`BWBgBgBg?< ?9<(N ``||b@0@, PN.g.;/<;/<;/<6?< ?9<(N03;.4f/<4d/<:?96N 09<(y6fJ y:f>094dy;o.09;y:y4do094fy;o09;y:y4fo36>6/<<*/<,?96?9:?9:?9;?9;?96NZ3<& y<&g.6/<6/<6/<6?<BgN036;36;096y63;096y63;.;?<?96NbXa.;Bg?96NbX.g..;/<;/<;/<6?< ?9<(N03;09<(y6f>6/<<*/<,?96?9:?9:?9;?9;?96NZ3<& y<&g.6/<6/<6/<6?<BgN036;36;096y63;096y63;.;?<?96NbXaJ.;Bg?96NbXBWN`N^NuNVBy6`By6`x096%y;| 296A496BB2A<*2096| 6y6y;|296A496BBRA2A<*2Ry6 y6m~Ry6 y6md09;|T36Np3;;3;;09;y:3;09;y:3;>?96NRTBW?96NT.;?96NTBW?96NT09;P@3;09;P@3;09;|D3;09;y6Z@3;.;?96NTJy6f&.4j?96?9;?9;?96NP y6f&.-,?96?9;?9;?96NPBy6`>?96NT>?96NT0y6"|<*00T@3;0y6RH"|<*00T@3;09;|3;09;y6T@3;.;?96NTBW?96NT0y6<*3;0y6RH<*3;09;|3;09;y6T@3;.;?96NT09;T@36By; y6f3;09;y6y;36096Hм, @:096Hм, @:096Hм, @:B9:.:?96?96?96N\Ry6 y6m.>6NN^NuNV.;/<;/<:?96N y6f y<&fN@ y6f y<&g`By6 y;g y<&f3<& y<&ffBy*By63;By:By:04jB94k04tB94u.4j?96?9;?9;?96NP`j y <&o y<&m y <&f`F y*f`8 y<&f y6f` y<&f36Jy<&m y <&m` |4j2y*29<&HҼ,"A |4j2y*B(.4j?96?9;?9;?96NP09*R@3*`By*By63<&:3;`f y<&fDBy*By604tB94u.4t?96?9;?9;?96NP` y<&ffBy*By6By:By:3;04jB94k04tB94u.4j?96?9;?9;?96NP` y <&l( y :f3;By:By*By6` y <&m y<&m y*f`R y<&f y6f`: y<&f36Jy<&m y <&m` |4t2y*29<&HҼ,"A |4t2y*B(.4t?96?9;?9;?96NP09*R@3*`3<&:By*By63;>:/<4t/<4jNP363:: y6f(.-2?96?9;?9;?96NP`&.4j?96?9;?9;?96NPN^NuNV=| ngBBn` 0n"|-800nf=nRn nm nf0.`N`.]/Y/U?.N ng0.`Bn`p n2n00nlV n2n00|no< n2nRI00nl$ n2nRI00nT@no=nRn nm nf0.`.///?<BgN0=n=n0.n=@0.n=@.?<?.NbX>Np0n=P0nRH=P0.|=@0.nT@=@>?.NZT>?.NT.?.NT>?.NZT>?.NRT0.T@=@Bn nf=|0.nn=@0.HЮ @P0.HЮ @h0.HЮ @hB..?.?.?.N\>N.]/Y/U?.N Jng20.n m(0. nnm0.n m0. nnm`>Np>?.NZTBW?.NT.?.NT>?.NZT>?.NRT.?.?.?.N\>N.Bg?.NbX0.N^NuNVBn.N"-@. N"-@BnBn.ah=@Bn` n2n .gRn0.nm n2n .f0.S@n=@. a=@Bn` n 2n .gRn0.nm n 2n .f0.S@n=@0.`/.B@H/N&ZX/N&Pg/./.N&:P-@=|`=|`/./.N'rP-@0.n=@`h/./.N'P-@0.no=n`B/./.N%P-@0.no=n``| gF| g|g|g/./<N&ZX/N&Pl=|Jnf>/./.N P nB(.a=@Bn` n2n .gRn0.nm n2n .f60.S@=@` n2n 0f n2nBSn0.nn.a8=@0n (.f 0nB( n 0 n B(0.N^NuNVBn`Rn n2nJf0.N^NuNV>Np.-?. 0.WW ?. W ?.N\.a=@p82.SAAAn | =@.?. 0.WW ?.?.N\>NN^NuNV.-\?<N^TN^NuNV3 2d3 ;By;3;3;N094~N^NuNV# 2T3 ;3;By;3;3;N#62TN^NuNV3e;By;By;3;NN^NuNV3 63 6Bn nH|2n2d2RRnJ@f3;3;Sn3;3;NN^NuNV3{;By;By;3;NN^NuNV#2P#2X .мZ#2\3d;By;3 ; n 3;N n 0;#2d2P#4~2X#82\#62TN^NuNV3|;By;By;3;N n 04~ n08 n08N^NuNV# 2T3 2d3;3;3;3;N#62TN^NuNV3 2d3;By;3;3;N094~N^NuNV3 2d3;By;3;3;N094~N^NuNV3 2d3z;By;3;3;NN^NuNV3 2d3;By;3;3;N094~N^Nu#;2L"<2LpsNBNuNV3:0.|Hм+&-@=|` nH2n:2RRn nm.;NB@09;N^NuNV#:6~#:6#:6#;6#<6# aF3;;pN^NuNV>a*pN^NuNV3:3 :3 :3:3:3:3;3;3;3;3;3; 3 ; 3";#$<3(;3*;>N n,0; n00; n40; n80; n<0; n@0; B@09;N^NuNV3:# <>4NN^NuNV3:3 :3 :3:3:3:3;3;>INN^NuNV3:3 :3 :3:3:3:3;3;>JNN^NuNV>MN n0; n 0; n0; n0;B@09;N^NuNV3:# <>#NN^NuNV3:3 :3 :3:3:>dNN^NuNV3:3 :3 :3:3:>eNN^NuNV3:>fNN^NuNV3:>gNN^NuNV3:3 :>hN n 0; n0; n0; n0;B@09;N^NuNV3:3 :3 :3:3:3:>iNN^NuNV3:>kNN^NuNVH *n(n >0-W?0,WN T:>0-W?,0,WN T8>?N tT>>?,N tT<89F0G9@0F9@GoFnB@`pJL0N^NuNV0.n o0.`0. N^NuNV0.n l0.`0. N^NuNVH-n Jnnp` nop`0.R@8BGB/.N&Pl n -R /.N'X-@B/.N&Po.`/<D/.N'rP-@SG/<A/.N&Pm`/<D/.N&:P-@RG/<D/.N&PlG|0H/N&ZX-@`/<D/.N&:P-@RFDm/<B/.N&:P//.N%P-@/<D/.N&Pm -|ARGJGl4 n 0R n .R JDlD|` n 0R SFGnBF`j/.N&X:0|0"n R Gf n .R 0H/N&ZX-@//.N'P-@/<D/.N'rP-@RFDm n BR .JLN^NuNVH KIBnBn`R n  g n  g n -gB@`p=@ n -g n +fR`$ n .fRn` nJngRnR nJg n eg n EfB n eg n EfDR n -gB@`p=@ n -g n +fR` nR nJfB.a-@.N*.=@Jng 0.D@n`0.ܐn=@/.?.a:T/N'rP-@.N%-@Jng .JL0N^NuNVJnl,-|A`/<D/.N&:P-@RnJnm`*-|A`/<D/.N'rP-@SnJnn .N^NuNV-|`D/<D/.N'rP-@/. nH|H/N&ZX/N%P-@R n 0m n 9o .N^NuNVHB/.N&PfB`B/.N&Pl/.N'X-@z`BEBG`RG/<B/.N&:P-@/<A/.N&Pl`SG/<B/.N'rP-@/<@/.N&Pm/<Y/.N'rP-@/.N&X-@ .-@|@0|HJEg .JLN^NuNVH..,. N' LN^NuNVH..,. N(LN^NuNVH..,. N( LN^NuNVHJl| .D-@`BFJfB`^~` .-@R .f` .-@S. g .-@޼@ JFg .JLN^NuNVH .м<JgJFlB`V .:|oJEg <` <`0..μ|`RFJFm`SFJFnJEg D. JLN^NuNVH..,. N)d LN^NuNVH..N' LN^NuNVH..,. N' LN^Nu<NuJg NugR kjklf`>k^g>k^g2k8<d,&B<ރeNuRid~S<Nu.NuJNu:ڼ.gNugRghEDvi^E]HE:BB8HD&HC؃HF&؃BDHDHGHFHEބj ޼gNuSiex@ބއdRgNu~NujJ<Numc68343 floating point firmware (c) copyright 1981 by motorola inc.NVH*nBGBF`RHHм- @f +fR` -fRRF` H@| 0m 9oJFg0D@>0JL N^Nu#2`NN/92`Nu#2`NM/92`Nu#2`NA/92`NuNVH*n. ` JfB`Rf JL N^NuNVH*n. H>/ aXJL N^NuNVN^Nu  7 4 1 0 8 5 2 . 9 6 3 = ? X - + CE CLRT Calculator CalculatorErrorErrorg7j4m1p0h8k5n2q.i9l6o3r e/f*J-N+c(d)[1][ Calculator accessory | ( Version 2.0 )| Written by| Robert M. Birmingham ][ Exit ] !!!!"  < 2>"" 4   $                                                                              *F@ J H  &"&D $ D        $             *T0@6D,6 :"P : Tthe bottom of the screen and indicate the WP functions assigned to each of the ST function keys. Keys F1 through F5 are toggles which indicate the current settings of the following: F1 bold text on/off F2 underlined text on/off F3 italic text on/off F4 light text on/off F5 insert mode/overwrite mode Keys F6 through F10 are actions performed when editing: F6 delete line F7 new page F8 center line F9 indent paragraph ` .|N>.NA"/0<NBNuNVJy!fB?<N2T3!N^NuNVJy!gB?<N2TBy!N^NuNVBn`0n#(0Rn n m3#<3 !.#/<!/<#(NlP y#f y#fp`p3#D y#fp`p3$jN^NuNV=n=n 0.n S@=@0. nS@=@.Q?<?9!NhXN^NuNV.!/<#&/<#@/<#>?<BgN>!?9#&?9#@?9#>?</NvP3$hBWBg/<?<?9$hNp 09$jK>09#D$jK??<209#Dd??9?9#?9#@?9#>NL09$jK>09#D$jK??<209#Dd??9$hNP.!/<#&/<#@/<#>?<?9$hNN^NuNVa>N=n =n =n=n.U/Y/]/Q?< ?9$hN`\.Q/NXJ@g>?.?.?.a\>a L.U/Y/]/Q?< ?9$hNJngJnfBWNaN^NuNVN./<#/<#/<$fN 3 .?9$DNTT33$hBy!3#BaN^NuNV`bBn.$B/</<$B/<$B/< /< Bg?</< BgBgBgBgBgBgBgBgBgBgBg?<?<?<1Nn8=@>N.$B/<$B/<$B/<#J?< ?9$hN.gd09 `.09 y$hf(Jnf"> ?9 ?9 ?9 ?<aP` 09 y$hfBWBgBgBg?< ?9$hNp `09 yf y$hg>!N3$h`09 y$hfj>$hN>!?9#&?9#@?9#>09?09#@?BgBgN>$hN>!N3$h`009 y$hf09#@y o09#@3 09y o093 > ?9 ?9 ?9 ?<?9$hNp .!/<#&/<#@/<#>?<?9$hNa>!?9#&?9#@?9#>?<a.PBy#B`T09 y$hf09#@y o09#@3 09y o093 > ?9 ?9 ?9 ?<?9$hNp .!/<#&/<#@/<#>?<?9$hNa6By#B`09 yf6 y$hfaBaa`BWBgBgBg?< ?9$hNp =|`LJy#Bg.!/<#&/<#@/<#>?<?9$hN>!?9#&?9#@?9#>?<?9$hNp .!/<#&/<#@/<#>?<?9$hN`.!/<#&/<#@/<#>?<?9$hN>!?9#&?9#@?9#>?<?9$hNp .!/<#&/<#@/<#>?<?9$hN y#Ba``||b@0@@ PN y gB@`p=@>Nx|yf.g0 y$hg&Jnf >!?9#&?9#@?9#>BgapPBWN`N^NuNV`nhJnm0.HhH@=@0.H=@ nn0n"| 00H`Z nn0|"| 00H`: n-n0n"| 00D@H`0|<"| 00D@HN^NuNV>WZaHN^NuNV>Nx=@0.r `|H H@=@0.@|?=@>?9!NT>?9!NNT.#?< ?9!N*X>?9!NT>?9!N$T>?9!NT>?<?9!N^X=y$l=y$n/</9#F0.?0.HWaHT/NP/NP29$lHЁ-@ .=@/</9#L0.?0.HWaTH/NP/NP/09$nH-@ .=@.?<?9!NX/</</9#F0.?aT/NP/NP/NP/09$lHП-@ .=@/</</9#L0.?aTH/NP/NP/NP/09$nH-@ .=@.?<?9!NX3N^NuNVJngh>?9!NTBW?9!NT=y#>=y#@09#>y#&S@=@09#@y!S@=@.Q?9!NTBW?9!NT>?9!NT09!H>09#&H?09!H?09#@W09#&H?09#>W?9!NPaN^NuNV09#&Hy#>3$l09!Hy#@3$n09#&HS@H##F09!HS@H##L-|#Bn`0.=@/</</9#F?.aLT/NP/NP/NP/09$lHП-@ ."n2T/</</9#L?.aTH/NP/NP/NP/09$nH-@ ."n2TRn n m6N^Nu#NN/9Nu#NM/9Nu#NA/9NuNV# 3 $F3$HBy$L3$P3$RN#!N^NuNV3e$FBy$HBy$L3$RNN^NuNV3 !3 !3! 3! 3 $F3$HBy$L3$P3$RNN^NuNV## .мZ#3d$FBy$H3 $L n 3$RN n 0$R###"#!N^NuNV# 3$F3 $HBy$L3$RN#!N^NuNV# 3$F3 $HBy$L3$RN#!N^NuNV# 3 3$F3$H3$L3$RN#!N^NuNV3 3$FBy$H3$L3$RN09N^NuNV3 3$FBy$H3$L3$RN09N^NuNV3 3$FBy$H3$L3$RN09N^NuNV3 3 3l$FBy$H3$L3$RNN^NuNV3 3$FBy$H3$L3$RN09N^NuNV3 !By!3$F3$HBy$L3$RN09"N^NuNV3 3$FBy$H3$L3$RN09N^NuNV3 3$FBy$H3$L3$RN09N^Nu#$F"<psNBNuNVBBJlDRBJ lD RB0. -@0.2. An=@ .gDN^NuNVH?BCB..,. f# <`hlDRCJlDRCn8fzB`0l :HGH`xe`Jge`|fD# D`# JLN^NuNV3#P0.|Hм-@=|` nH2n#P2RRn nm.$>NB@09#xN^NuNV##P ## ##X ##x #$^ #$p # $>> aF3#x$DpN^NuNV>a*pN^NuNV3#X3 #Z3 #\3#^3#`3#b3#d3#f3#h3#j3#l3#n3 #p3"#r#$$^3(#t3*#v>N n,0#z n00#| n40#~ n80# n<0# n@0#B@09#xN^NuNV3#X3 #Z3 #\3#^3#`3#b3#d3#f>INN^NuNV3#X3 #Z3 #\3#^3#`3#b3#d3#f>JNN^NuNV>MN n0#z n 0#| n0#~ n0#B@09#xN^NuNV3#X# $^>NNN^NuNV3#X# $^>#NN^NuNV3#X3 #Z3 #\3#^3#`>dNN^NuNV3#X3 #Z3 #\3#^3#`>eNN^NuNV3#X>fNN^NuNV3#X>gNN^NuNV3#X3 #Z>hN n 0#z n0#| n0#~ n0#B@09#xN^NuNV3#X3 #Z3 #\3#^3#`3#b>iNN^NuNV3#X>kNN^NuNVH *n(n >0-W?0,WN~T:>0-W?,0,WN~T8>?NbT>>?,NbT<89F0G9@0F9@GoFnB@`pJL0N^NuNV0.n o0.`0. N^NuNV0.n l0.`0. N^Nu @(#)CLOCK.ACC V0.03 Atari Corp. /jwt N %*/37m:x<>?@b\xT CLOCK Clock  >        2>  (                      "             L .:     $ & " " "       ( ( .   zf  $             *n the window area so you will need to scroll to view it all. This is achieved using the GEM scroll bars at the right and the bottom of the text area. The white sliders in the scroll bars represent the visible portion of the document as follows: * the vertical slider shows the size and vertical position of the text area relative to the size of the whole document, * the horizontal slider shows the horizontal position of 127.73134.45+0.0322,278.33148.33     0       observing the effects on the text window, sliders and cursor position: * clicking the arrow boxes scrolls vertically by one line at a time and horizontally by five characters at a time, * clicking the shaded areas scrolls both vertically and horizontally one 'screenful' at a time, * dragging the sliders moves the window text area through the document to the position indicated. Note that it takes a little while to drag the vertical slider from one end of the document to the other - this delay will increase with the size of your document. 2.11 Page Break Display Examine the page break display to the left of the window while you scroll the text. You will notice three types of page break indicated by horizont. G.. 07201030305800 1 2# F0110030 9[........................................................]001 `Bo"h###,Oؽc.N//Bg?NAN^_ONNV/./.?.?Nupress...SCRUB_IT ?Hz~2/,HNVNA>-HPBn~3.=@~4~40.nl~5~60.R@=@~7~80.2|CrA!0p@V0.2|CrA!0p@VC0.2|CrA!0p@]C~9~:0.2|CrA!0p`@W~;C~<0.2|CrA!0p{@W~=C~>0.2|CrA!0p|@^~@CBd0.2|CrCA!~A`~BN^,_X>_XNCOPY_FILE?Hz~K/,HNVNA-HP~L~L?.NR~MHy1&?_XNerrorwritingoutputfileoninputfileerrorA0B1|A01|~`A#p31f~a~a091f@d~b~cpy?N>X~dHy?X~eHyN\XHyN\XHyN\X~fHyHz?~n~n091$2|C?291$CPtA0A1%Ry1$`~op9R@2|C?rA1%~pHy1&BgN31"~q091"J@k&~rHyHz?~{~{091$2|C?291$CPtA0A1%Ry1$`~|p9R@2|C?rA1%~}Hy1&BgN|31~~091J@k(~HyHzv?<`P><><><>N\X><`r>X>X>missionofOSS.OSSandCCD.Usebyper-arecopyright(c)1986,Portionsofthisproduct(c)1987G.HungerfordCleananotherfile?CleancopysuccessfulopeningoutputopenedoutputfileDestination(ajax'ed)file: openinginputerroropenedinputfileFiletoClean: andbleaches'emtospacesnon-printablecharactersCleansandshinesallButch'sFileCleanser~,GxvGRI1j/?3|NAXNu_4`_t6BoraSB`2aNH?V_rara/L?VNu_raN_4`_t"x0HgJJjDxvCzpcRЀ`|e W0R"f`6_4`_t2xJAjDAxvCp02H@0RJAfJg<-RBlCSBraQSCaQN_4v`_46"_JBjtClBSCraQSBkaQN_v`_60@dCt`CtClBSCraQSBavQNFALSETRUE_6kfv2_tCc"4YBv`_6kfv"_tCc4QBvSBkra(QSCC" A09c^aJgYC`NHF"oA/ NLFNuBy(__/C(g f,t4(H/ /?(?<@NALJkffNu4(SBraQNu(gNfH??p2JXD (0"L2vcribes how it was formatted. This section describes the general rules for formatting paragraphs within 1st Word: (a) Justification A paragraph can either be right justified (text is aligned on the right margin by inserting stretch spaces) or left justified (text is flushed left with no stretch spaces). In either case no line is allowed to exceed the right margin. To switch right justification on and off, select the Justify option from the Style menu. Note that the entry is checked (ticked) when right justification is on. When you are typing a new paragraph, justification is automatic and no special action is required (other than setting the required justification style). However, if you change either the justification style or contents of a paragraph you will need to reformat it by using the F10 key or icon when the cursor is in the first line. (b) Indenting the Whole Paragraph To indent the whole paragraph by the same amount use the F9 key or icon to specify the indent size before typing the paragraph. Indents are remembered by 1st Word so you do not need to respecify them when you reformat a paragraph unless you want to change the indent size. To change the size of an indent use the deletion and/or indent functions as required on the first line of the paragraph and then reformat it. (c) Indenting the First Line of a Paragraph To indent the first line of a paragraph by a larger value than the remaining lines use fixed spaces (generated by the TAB key or CONTROL key plus space bar) after any indent and before the first text character. (d) Hanging Indents (Outdents) This style has the first line at standard length with subsequent lines further indented. Justify the text with the initial indent (if any), then on the second line insert an extra indent and reformat. This style is not preserved by a reformat from the first line. (e) Numbered Paragraphs This style is obtained by typing the paragraph number or letter followed by one or more indents before the first text character. Subsequent lines will be left aligned on the indent. Experiment with these basic styles and invent some of your own. Although 1st Word is very good at remembering the style when you reformat a paragraph, hanging indents and centered paragraphs will require manual intervention from you. You should also confirm whether any special formatting styles that you have invented require manual intervention when reformatting. 2.17 Saving the Document File with a New Name You have now learned how to use most of the basic features of 1st Word, so TUTORIAL.DOC is now ready to be saved on disk. Even in the unlikely event that you have made a complete mess of the editing, your original version of TUTORIAL.DOC will not be destroyed because 1st Word will rename this to TUTORIAL.BAK for security. Alternatively, you can save the edited version in a new file in which case the original version retains its original name. Select the Save as entry in the File menu which will display a form containing the current name (TUTORIAL.DOC). You can edit this field to give the document a new name (say NEW.DOC) and then click on OK. 1st Word will save the document with the new file name and close the window, returning to the startup screen. 2.18 How to Exit From 1st Word To exit from 1st Word you must first select Save or Save as from the File menu to close your document and return to the startup screen. Then select Quit from the File menu to return to the GEM Desktop. This ends the tutorial section of the manual. 3 1ST WORD USER INTERFACE This chapter describes the major components of the 1st Word user interface in general terms. 3.1 Typing and Editing 1st Word has been designed for two modes of operation: (a) Typing When you are creating a document for the first time or adding new text to an existing document, it is usual to operate 1st Word in typing mode, using only the main QWERTY keyboard and the 10 function keys whose actions are displayed permanently at the bottom of the screen. The function key commands have been chosen to maximize efficiency by ensuring that your fingers rarely need to leave the keyboard when operating in typing mode. (b) Editing When you have created a document, you will usually need to change it at least once to correct style, spelling or grammar or to rearrange the document contents. In editing mode it is unusual to change more than a small portion of the text, the bulk of the editing process being scrolling, searching, style changes and block movement operations, where continuous use of the keyboard is not necessary. Therefore 1st Word has been designed to enable editing to be achieved almost entirely by use of the mouse. Note that there is no formal distinction between the two modes (nor are there any commands provided to switch between them). The distinction is purely one of operation. If you have never used a mouse-driven computer before, we suggest that you try the suggested method first before selecting your own operational style. 3.2 WP Mode Text can be entered or edited with WP Mode on or off. This tells 1st Word whether to store special style codes in your text or to produce pure ASCII files. Switch WP Mode on for word processed documents and off for program source or data files. 1st Word will usually default to the correct mode for the file you edit (see 5.1 for details). 3.3 Keyboard The ST keyboard is a very good example of a modern computer keyboard. Its light action and audio feedback option enable very fast typing speeds to be attained, comparable with the best electronic typewriters. The keyboard is divided into four areas: * the QWERTY bank is used for typing in the usual way, * the function keys are used to action a subset of the WP style commands, * the cursor keys are used to move the text cursor around the document window, * the numeric keypad is not particularly useful for WP, but can be used to enter long strings of numbers. With the exception of ALTERNATE, CAPS LOCK, CONTROL and SHIFT, all keys on the keyboard will auto-repeat if held down for a short while. This is not always synchronized with the screen update and you may find that the keyboard will occasionally race ahead of the screen, especially when you are forcing the screen to scroll. 1st Word allocates special functions to certain keys and key combinations: * INSERT insert line * CONTROL + SPACE fixed space * CONTROL +  or  move left or right one word * CONTROL + DELETE delete from cursor to end of word No action is performed by the HELP, UNDO or CLR/HOME keys. 3.4 Font Table Not all of the ST's 256 character set is available from the keyboard, and the particular characters available will differ from country to country. To remedy this, 1st Word provides a font table on the desktop. (High and medium resolution only.) To select a character from the desktop, drag the GEM size box at the bottom right of your document window to reveal the font table. Then select the character you want by clicking the mouse at the appropriate position and 1st Word will copy the character to your window at the current cursor position. 3.5 Function Key Icons 1st Word provides 10 function key icons at the bottom of the screen. (Only in high and medium resolution.) These are provided for three purposes: * as a visual reminder of the actions of function keys, * as a visual reminder of the status of some of the style functions, * as an alternative to the function keys during editing by clicking the required icon with the mouse. Note that the F1-F5 icons are toggles which are shown in reverse video (white on black) if the effect is in force. 3.6 Drop-down Menus Six menu headings are shown at the top of the screen: (a) Atari  1st Word program information screen and your ST desk utilities. (b) File File open and close functions and document layout commands that have scope across an entire file. (c) Edit Text editing mode selection and search, replace and position marker functions. (d) Block Text block manipulation functions for cut and paste operations. (e) Style Commands that affect local text style and formatting. (f) Help Brief help screens, displayed either on demand or automatically when a drop-down menu item is selected. At certain stages during an edit some of the menu functions will be invalid (shown in light face). If a menu entry is a toggle function it will be checked (ticked) when in force. 3.7 Edit Windows Typing and editing is performed in edit windows. You can open up to four windows, enabling cut and paste operations between documents. To switch windows, click the mouse at any point in the target window to make it the current window. Window scrolling and size and position manipulation can be performed by using the mouse in the edit window border: (a) Vertical Scrolling Text in the window can be scrolled vertically with the vertical scroll bar to the right of the window: * click the arrows to scroll a line at a time, * click the shaded areas to scroll a page at a time, * drag the white slider bar to the required position. (b) Horizontal Scrolling Text in the window can be scrolled horizontally with the horizontal scroll bar at the bottom of the window: * click the arrows to scroll 5 character positions, * click the shaded areas to scroll a page at a time, * drag the white slider bar to the required position. (c) Sizing the Window The edit window can have its size changed as follows: * click the GEM full box in the top right corner to expand to full size or shrink to original size, * drag the GEM size box in the bottom right corner to change the horizontal and vertical dimensions. (d) Moving the Window Drag the window to a new position using the title line. (e) Closing the Window The edit window can be closed (and the edit abandoned) by clicking the GEM close box at the top left corner. In addition to window manipulation functions, pagination and ruler functions are also carried out in the window borders. 3.8 Pagination 1st Word displays page breaks and actions pagination commands in the left margin of the edit window. Three types of page breaks are recognized by 1st Word: (a) Hard Page Break A hard page break is always inserted by the user and is indicated by a solid horizontal line with the new page number directly beneath it. You can set or clear these by clicking the mouse in the left margin at the desired position. A hard page break can also be inserted above the line containing the text cursor with the F7 key or icon. (b) Conditional Page Break A conditional page break with a defined number of lines of scope is also inserted by the user. It is used to protect a group of lines that you do not wish to be split across a page boundary. If the scope of the conditional break spans a potential page boundary then a new page is inserted at the start position of the scope. A conditional page break is created by dragging the mouse down in the left margin to indicate the scope. This can subsequently be increased or decreased in scope by dragging the end position in the desired direction, or deleted by clicking the mouse at the start position. If 1st Word inserts a page break at the start position, the conditional break is displayed as a 75% dashed horizontal line with the new page number displayed directly beneath it. Otherwise the conditional page break is displayed as a 25% dashed line with no page number. In either case the scope is displayed as a vertical line in a matching line style. (c) Soft Page Break A soft page break is inserted by the 1st Word program if you have exceeded the total number of lines permitted on a page and is indicated by a 50% dashed horizontal line with the new page number directly beneath it. You can convert these to hard page breaks by clicking at the appropriate position in the margin. Note that the total number of text lines on a page is defined globally for a document by using the Layout command in the File menu. 3.9 Ruler Line The ruler line is displayed immediately beneath the document title and is used to indicate and change the margin and tab positions for formatting the document. If you change the ruler line, only those paragraphs you type or reformat after the change will be affected. The default ruler line is set up for Pica pitch (10 cpi) on 8 1/2 by 11 inch paper and allows 66 character positions per line with tab points every 5 characters. The ruler line is modified by use of the mouse as follows: (a) Tab Points Tab points are used to determine how many fixed or indent spaces to insert when using the TAB and F9 keys. Tab points can be set and cleared by clicking the mouse in the ruler line at the desired position. (b) Left Margin It is neither possible nor necessary to change the left margin in a document. The effective left margin position can be changed either by using indents in the document or by specifying a page offset at print time. (c) Right Margin The right margin is used to indicate where word wrap and right justification occur. You may change the right margin by dragging it with the mouse to the desired position. To set a right margin outside the current window area, you must first horizontally scroll the window. The ruler line in effect when you Save the document will be stored together with the text (WP mode only). The stored ruler will be redisplayed when you next Open the document. 3.10 Document Size Restrictions On a 520ST with the operating system in ROM, there is enough space to edit a document of around 80 pages. This reduces to around 40 pages on early systems with a RAM based operating system. 1st Word will warn you when you are running short of space in RAM or on disk. 4 ATARI MENU  Menu entries ending with "..." invoke a dialogue, others are actioned immediately. 4.1 1st Word... This function displays 1st Word program information including the authors' names and program revision number. Click the OK button to continue. 4.2 Desk Utilities The remaining items in the Atari menu are the desk utilities that were loaded with your version of the ST operating system when you bootstrapped the system. Any number of desk utilities may be started or quit during 1st Word operation without affecting your text (provided that your desk utilities are well behaved)! This is because they are allocated memory when you bootstrap the system and do not grab any more when invoked from the drop-down menu. 5 FILE MENU Menu entries ending with "..." require a dialogue, others are actioned immediately. 5.1 Open... This command invokes the GEM Item Selector to select a file for editing (up to four documents can be edited at once). The Item Selector has three fields which you can modify (use the cursor keys or the mouse to select the fields): (a) Directory Line This field holds a mask to determine which files are displayed in the directory window. By default this will be set to display all the .DOC files on the disk from which you loaded 1st Word, for example B:\*.DOC. If you edit this mask to change the files displayed in the directory window you must also click the mouse in the directory window to display the new list. (b) Directory Window This displays all the files matching the directory line mask and can be scrolled just like a GEM Desktop window. Click on an entry in this window to copy it to the selection line or double-click an entry to open it for editing. Note that if a folder is displayed in this window its contents can be displayed by clicking it. This has the side effect of updating the directory line mask. (c) Selection Line This displays either the last file you opened or the file you have just selected from the directory window, and you can edit this line if you wish to change the name. When the selection line contains the filename you want, click the OK button or press the RETURN key. If you have selected a filename that does not exist, 1st Word will confirm that you wish to open a new file. After you have selected the file to open, 1st Word will create an edit window, read the text from disk into memory and display the start of the document in the edit window. If the file has a .DOC extension or if ruler and pagination data are held in the text, the file is opened in WP mode. Otherwise it is opened in non-WP mode. 5.2 Print... Use this command to print a document file after you have saved it to disk. You can only print a file if there are no edit windows open, otherwise 1st Word will issue an error prompt. The Print command will use either the installed dot matrix printer driver or the installed daisywheel printer driver, depending on the status of the Install Printer menu. (See Appendix A for details of printer driver installation.) When you print a document the PRINT FILE form is displayed. This asks a number of questions: * start and end page numbers, * page number offset to be added to the page numbers generated in the document, * left margin offset to further indent the document at print time (to cope with sheet and tractor paper feeds), * swap left & right headings on alternate pages. If this option is selected, even numbered pages will have the left and right hand components of the head and foot lines interchanged, * print quality. If you have installed and selected a near-letter quality dot matrix printer then draft or NLQ printing is selected by this option. If you have installed and selected a daisywheel printer then selecting NLQ mode will make the printer pause whenever it is asked to print italic or light text. The printer driver will prompt you to change daisywheels at each style change. When printing, 1st Word displays a small window whose title line shows the printer type. This window displays the name of the file being printed and the print quality. To pause printing, hold the mouse button down until the pointer appears. To restart printing click in the window. To abandon printing click in the close box. 5.3 Save This command will write the contents of the current edit window to disk with the same filename as the original file, after first renaming the original with a .BAK extension. The edit window is then closed. If there is not enough space on the disk when you save the file, an alert will be displayed saying that the disk is full. The file is not saved, and you have an opportunity to delete files to make space, or you can change disks if you wish and then save onto another disk. 5.4 Save as... This command prompts for a new filename and then writes the contents of the current edit window to disk with the filename specified. If a file already exists with the same name it will be renamed with a .BAK extension. The edit window is then closed. 5.5 Layout... This command displays a form that allows you to specify the running head and foot lines and page layout for a document: (a) Head L C and R These fields specify the left aligned, centered and right aligned components of the running headline that is output at the start of each page. (b) Foot L C and R These fields specify the left aligned, centered and right aligned components of the running footline that is output at the end of each page. Note that a hash character (# - ASCII hexadecimal 23) placed in any of the six head or footline fields will be replaced at print time by the page number. (c) Paper length Total length of the paper in lines (default value 66). (d) TOF margin Number of lines between top of form and the headline excluding the headline (default value 1). (e) Head margin Number of lines between the headline and first text line including the headline (default value 3). (f) Foot margin Number of lines between the last text line and the footline including the footline (default value 3). (g) BOF margin Number of lines from the footline to the bottom of form, excluding the footline (default value 5). Values (c) through (g) can be modified by clicking the arrows as required. The values are used to calculate: (h) Lines/page This value is given by the formula: h = c-(d+e)-(f+g) A little experimentation will be necessary for your printer. 5.6 Read... This command requests the name of a file to be read into the current document. The text is inserted at the current cursor position. 5.7 Write... This command writes the contents of the current marked block (see chapter 7) to the specified file. All style commands are stripped out of the text. 5.8 Delete... Use this command to delete a file from your disk if there is insufficient room to store your document. Delete invokes the GEM Item Selector (see 5.1) to specify the file to delete. Delete repeats displaying a file selector until you select CANCEL, to allow several files to be deleted at once. Note that it is safe to delete the original version of the document and/or the .BAK version provided you are certain that you have not lost any text during the current edit and you Save the document immediately afterwards. Alternatively, you can always Save your file to another disk. 5.9 Quit This command has two functions: (a) Abandon Edit If Quit is used when you are editing a document, the current edit is abandoned (retaining the original version of the document) and the edit window is closed. (b) Quit from 1st Word If Quit is used when no documents are being edited or printed, 1st Word will terminate and return control to the GEM Desktop. Note that you can also quit a document edit by clicking the window close box. 6 EDIT MENU Menu entries ending with "..." require a dialogue, others are actioned immediately. The WP mode and Insert mode entries will be checked (ticked) when enabled. 6.1 WP Mode This command switches WP mode on and off. WP mode is designed for word processed documents such as letters or reports. Switch WP mode on to tell 1st Word to store the ruler line, pagination data and style changes in your document. Non-WP mode is designed for program sources and data files. Switch WP mode off for program source or data files, only ASCII data is stored in the file. 6.2 Insert Mode This command switches insert mode on and off. Insert mode determines whether new text being entered at the cursor position is inserted or overwrites any existing text. Note that at the end of a line or document, overwrite mode does allow text to be 'inserted'. Note also that the action of the TAB and RETURN keys in overwrite mode is one of cursor movement only. 6.3 Find... This command is used to search for a specified text string in your document. A form is displayed asking you to specify: * String text, * Direction of search (forward or backward), * Case matching during string comparison. Find will search for the first occurrance of the specified string. If the string is found, the cursor will be placed either on the first character of the string (backward search) or on the character immediately after the string (forward search). If the string is not found, the cursor will be placed at the start or end of document depending on the search direction. 6.4 Replace... This command is used to search for a specified text string in your document and replace it with a second string. A form is displayed asking you to specify: * Search string text, * Replacement string text, * Direction of search (forward or backward), * Case matching during string comparison. * Scope of search (replace one, some or all matches) If you have specified replacement of one or all matches, Replace will search and replace automatically, without user intervention. If you have specified replacement of some matches, Replace will find and display each match and ask you whether or not to replace the string or cancel the search. If the search string is not found, the cursor will be placed at the start or end of document depending on the search direction. 6.5 Repeat find This command will repeat the last performed Find or Replace operation, using the same parameters as defined in the original command. If the Find or Replace command terminated at the start or end of the document then the search direction is automatically reversed for the Repeat operation. 6.6 Set mark Use this command to set or redefine one of the four position markers anywhere in your document. The marker position is defined by the current cursor position. 6.7 Goto mark Use this command to move the cursor to one of the previously defined position markers. 7 BLOCK MENU These commands create and manipulate text blocks used in cut and paste operations. These are variable length text strings, highlighted by a stippled background (monochrome monitor) or fluorescent yellow background (color monitor). Each document open in a window may have one and only one block defined at any time and defining a second block will cause the first to be hidden. Although block start and end positions must be within the window when they are defined, 1st Word will remember the block position when it is scrolled off the screen. The Block menu commands give you the flexibility to create irregular shaped blocks by defining the start and end positions in separate operations. A more convenient method for defining regular shaped blocks is to use a rubber band as follows: * To mark a section of a single line as a block, point the mouse at the first character and drag it horizontally to the final character, then release the button. * To mark two or more complete lines as a block, point the mouse at any position in the first line and drag it to any position in the final line, then release the button. (It is not necessary to enclose the lines in the rubber band.) Blocks defined in this way can have their start and end positions modified by the Block start and Block end commands. 7.1 Start block Use this command to define or redefine the block start position at the current cursor position. 7.2 End block Use this command to define or redefine the block end at a position immediately preceding the current cursor position. Block start and end positions can be defined in any order, but the start position must placed before the end position in the document, or the command is ignored. When a valid block is defined, the block background is drawn in and will remain until the block is hidden or deleted or a Reformat command is actioned. 7.3 Cut block Use this command to copy the contents of the marked block in the current window excluding style commands to the cut and paste buffer. The block in the window remains marked. The text in the buffer can later be pasted to any position in one of the open document windows. 1st Word maintains a single cut and paste buffer. You will be warned when you attempt to cut a block into the buffer if the current buffer contents have not been pasted to a window. Note that Copy block and Move block also use the cut and paste buffer and will change its contents. 7.4 Paste block Use this command to insert a copy of the cut and paste buffer to the cursor position in the current window. The text in the buffer remains intact, so you can paste it to more than one position or document. 7.5 Copy block Use this command to insert copies of the marked block to the current cursor position within the same window and the cut and paste buffer. The marked block remains unaffected, but the copied text has all style changes removed. 7.6 Move block Use this command to insert copies of the marked block to the current cursor position within the same window and the cut and paste buffer. The marked block is deleted and the copied text has all style changes removed. 7.7 Delete block Use this command to delete the contents of the marked block. The contents of the cut and paste buffer are unaffected. 7.8 Find start This command moves the cursor to the start of the marked block. The contents of the cut and paste buffer are unaffected. 7.9 Find end This command moves the cursor to the end of the marked block. The contents of the cut and paste buffer are unaffected. 7.10 Hide block This command removes the block markers and the stippled or colored background from the marked block. The contents of the cut and paste buffer are unaffected. 8 STYLE MENU The Style menu is used to determine the character style and text formatting parameters. All style commands are actioned immediately. 8.1 Bold Use this command to select or turn off boldface characters before you type and before a Restyle command. The F1 icon display is inverted. This command has an identical effect to the use of the F1 key or icon. 8.2 Underline Use this command to select or turn off underlined text before you type and before a Restyle command. The F2 icon display is inverted. This command has an identical effect to the use of the F2 key or icon. Note that unlike most word processors, 1st Word correctly underlines whole paragraphs, both on screen and in the printed output, including stretched spaces but excluding the paragraph indent! 8.3 Italic Use this command to select or turn off italic characters before you type and before a Restyle command. The F3 icon display is inverted. This command has the same effect as using the F3 key or icon. Because the final italic character in a string overlaps the next character position it is a good idea to finish an italic string with an italic space. This italic trailing space ensures correct screen display of italic text. 8.4 Light Use this command to select or turn off light characters before you type and before a Restyle command. The F4 icon display is inverted. This command has the same effect as using the F4 key or icon. 8.5 Super Use this command to select or turn off superscript characters before you type and before a Restyle command. 8.6 Subscript Use this command to select or turn off subscript characters before you type and before a Restyle command. 8.7 Restyle Other than deletion and retyping, this command is the only method provided by 1st Word to change text style. Convert the string you wish to restyle into a marked block using a rubber band or the Start block and End block commands described in Chapter 7. Next select the style combination you want using the function keys, function key icons or the Style menu. Finally click the Restyle menu entry to complete the operation. 8.8 Justify Use this command to tell 1st Word whether to left justify or right justify your paragraphs. If Justify is switched on, the menu entry is checked (ticked) and paragraphs will be right justified. 8.9 Word wrap Use this command to tell 1st Word whether to wrap words onto the next line when you exceed the right margin. If Word wrap is switched on, the menu entry is checked (ticked) and words are wrapped at the end of line, otherwise the right margin is released and you can continue typing on the same line until you press RETURN or reach the 160 character limit. 8.10 Spacing Use this command to tell 1st Word whether to use single or double line spacing. If Spacing is switched on, the menu entry is checked (ticked) and lines are double-spaced when you type or reformat paragraphs. The default condition has Spacing switched off and single line spacing. 8.11 Center Use this command (or the F8 key or icon) to center the line containing the cursor between the margins with equal spacing on the left and right. 8.12 Indent Use this command (or the F9 key or icon) to indent your text by one or more tab stops for the duration of a paragraph. The tab positions are taken from the ruler line. At the start of each paragraph, Indent to the required position then simply type the text. When word wrap takes place 1st Word will automatically indent the next line. When you press RETURN at the end of the paragraph, the indent is cancelled. 1st Word remembers indent values, so you will not need to respecify them when reformatting after a text change. If you want to change the indent value, move the cursor to the start of paragraph, then either delete the indent (be careful, only one keystroke is required) or add to the indent value and Reformat the paragraph. The indent need not be placed at the start of a line and you can even have more than one indent in the same line. 1st Word will always align subsequent lines on the final indent detected. (Section 2.16 contains details of using indents to create the most commonly used paragraph styles.) 8.13 Reformat Always use this command (or the F10 key or icon) to reformat a paragraph if you: * change the text by deletion or insertion, * change the indent value or style, * change the justification mode, * change the right margin. You will not need to reformat if you have only changed the text style. 9 HELP MENU The help menu is provided to give you brief notes on program operation while you are still learning 1st Word. All Help functions generate a help window and you must click OK to remove them. 9.1 Extra help If you select this option, 1st Word will generate a help window whenever you use a menu function. The help window informs you what the command will do and gives you the option of proceeding (click OK) or cancelling (click CANCEL). This feature is recommended for your initial sessions with 1st Word. 9.2 Other Help Screens The remaining help screens provide general information about those aspects of 1st Word operation not fully covered by the Extra help menus. A PRINTER DRIVERS This chapter tells you how to create and install printer drivers for 1st Word. Installing a printer driver is a complex operation requiring great attention to detail and a degree of trial and error. However, this method provides the greatest possible flexibility, and you can be sure that the driver you produce will match your printer exactly. The template patch files supplied for dot and daisywheel printers have their codes defined in hexadecimal. You should ensure that a list of your printer's control code functions in hexadecimal is available, before attempting to install a special printer. A.1 Standard Printer Drivers 1st Word is supplied with patch templates for these standard printer drivers: * ASCII only driver to drive any printer, * Epson LX-80, Epson RX-80 and Atari SMM804 dot matrix printer drivers, * Qume Sprint series and Brother HR-15/25 series daisywheel printer drivers. On the 1st Word disk supplied, th 1ST WORD (tm) RELEASE NOTE VERSION 1.04 This disk contains 1st Word, the GEM word processor written by GST of Cambridge, England and supplied with your Atari ST computer. In order to provide you with a fully working word processor as soon as possible, the 1st Word User Guide has been supplied on the microfloppy disk together with the 1st Word software. Backing up Before you do anything else, backup the 1st Word disk. Viewing the User Guide To view the User Guide on screen, do the following: * Obtain a directory window of the 1st Word disk * Double-click the item 1ST_WORD.PRG to load the program * Double-click the item GUIDE.DOC to open the manual * Scroll through the text using the vertical scroll bar * Click the window close box when finished * Click Quit in the File menu to exit 1st Word Printing the User Guide To print the User Guide, do the following: * Use Install Printer in the Desk menu to select Dot * Obtain a directory window of the 1st Word disk * Double-click the item 1ST_WORD.PRG to load the program * When the Item Selector is displayed click CANCEL * Click Print in the File menu * Select GUIDE.DOC from the directory listing * Answer the questions on the PRINT MENU then click OK * To pause printing, hold the mouse button until the pointer appears then click when you are ready to continue. Click in the close box to cancel the print. * Click Quit in the File menu to exit 1st Word You may need to experiment with the page offset value. 1st Word is initially configured with an ASCII-only print driver which should be capable of driving all printers, but will not print special styles such as bold or underlined. You should print a good copy of your manual (which may require editing for page layout changes) when you have configured 1st Word to drive your printer intelligently. If you have been using version 1.00 or 1.01 of 1st Word, please make sure you use all of the new files on this disk, including printer configuration files. To convert an old configuration file, you must add a sixth number to the "Miscellaneous Configurable Variables" which should normally be zero. A non-zero value causes the print program to pause between pages. 5306 -19372 0660103030566 1 2Page # of 5 9[....................................................]  1STWORDTUTORIAL  ThisdocumentisprovidedforusewithChapter2ofthe1st WordUserGuide,GettingStarted. Usethisfiletogetusedtoeditingadocumentwith1stWord withoutworryingtoomuchabouttheresults. VerticalScrolling Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyousc roll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith 0theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll.  Aprogramgeneratedpagebreakinthenextparagraph... Thisdocumentcontainsseveralscreensoftextand THELASTTIMEISAWPARISMYHEARTWASYOUNGAND GAY .............. BUTILOSTMYHEART INSAN IDONOTUNDERSTANDTHISVERYWELL,BUTIAMDOINGMY BEST.ITHINKINOWSEEHOWTOMAKEABASICMARGIN ADJUSTMENT. THELEITHPOLICEDISMISSETHISSHESELLSSEASHELLSBY THESEASHORE.THEREisasomethingin\ida,more sometninngthananIndianstereamomanyfountainedida, omotherf\idahearkenereidie theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. 3.1numberedparagreapwhatios ja[ajfdpemld[apoewlsokwlspw;s;papwls  3.2besurertoindentcorrectlyoryouwillbeinhotwaterand thatwellbotbeaverygoodidea.shamsh Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Aconditionalpagebreak-potentialbreakonly... Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginmentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Conditionalpagebreak-newpagegenerated... Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakinThisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. Thisdocumentcontainsseveralscreensoftextandyouwill havetoscroll(usingeithercursordownorthemousewith theverticalscrollbar)toseeitall.Noticethedifferent typesofpagebreakintheleftmarginasyouscroll. HardpagebreakinsertedafterthislinewithF7... HorizontalScrolling ThislinehasbeeninputwithWordWrapturnedoffandextendsbeyondtheendoftheotherlines. Notethatthelineabovecanbeviewedbyhorizontal scrollingeitherusingthecursorwithinthelineorthe mousewiththehorizontalscrollbar. Correction Thesepargraphcontaneavrylaregnomberoffspeeling mistooks!UesingthCURSRkeesandBCKSPACEandDEELETEkees tyrttocorrekttheesbludners.Wenyoohavfinnished,goback adnpresf10innthfristlynefothpargraph. Theparagraphabovecontainsaverylargenumberofspelling mistakes.UsingthecursorkeysandBACKSPACEandDELETE keys,trytocorrecttheseblunders.Whenyouhavefinished, gobackandpressF10inthefirstlineoftheparagraph. ParagraphFormatting Thisparagraphhasbeensettothefulllinelengthjustbytyping withnopreamblecommands.Thedefaultconditioniswordwrapon andrightjustifiedasshownhere. Thisparagraphhasagainbeensettothefulllinelength,but thistimeJustifyhasbeenswitchedoff,sotheparagraphwillbe leftjustifiedasshown. Thisparagraphhasanindentonthefirstlinecreatedby pressingtheTABkeyatthebeginningoftheparagraph.Onlythe firstlineisindented. Thisparagraphisindentedoneveryline.Thiseffectis createdbypressingtheF9keyatthestartoftheparagraph togiveanIndentoneachlineautomatically.  Thisparagraphisindentedoneachlinebutthefirst lineisfurtherindentedbypressingTABimmediatelyafter theF9keyatthestartoftheparagraph.  Thisparagraphhasasmallerextraindentonthefirstline bypressingCONTROL+SPACEafterF9togenerateafixedspace character. 1Thisparagraphhasareferencenumberinthemargincreated bypressingF9afterthenumber. (a)ThisparagraphwasgeneratedbypressingTABfollowedby "(a)"thenF9. Thisparagraphhasa'hangingindent'.Thisiscreatedbyfirst typingtheparagraphnormallywithnoindent,thengoingback toline2andinsertinganindentwithF9followedbyF10to reformatfromline2onwards.Notethisstyleisnot automaticallyregeneratedwhenyoureformattheparagraphby pressingtheF10key. Thisparagraphwasinputbypressing F9threetimestogetherwithavery reducedrightmargin. Thisparagraphiscenteredbetweenthemargins.Itwasinputby typingnormallywithnoindentation.Followingthiseachlinewas centeredusingtheF8key.Notethatthisstyleisnot automaticallyregeneratedwhenyoureformattheparagraphby pressingtheF10key. * - N/A D7 * - N/A D8 * - N/A D9 * - N/A DA * - N/A DB * - N/A DC * - N/A DD, 1B, 52, 2, 40, 1B, 52, 0 * - German DE * - N/A DF * - N/A E0 * - N/A E1, 1B, 52, 2, 7E, 1B, 52, 0 * - German E2, 1B,38 * - Disable paper-out detector E3, 1B,39 * - Enable paper-out detector E4 * - N/A E5, 1B, 55, 31 * - Unidirectional printing E6, 19, 55, 30 * - Normal bidirectional printing E7 * - N/A E8, 1B,78,0,12,1B,57,0,1B,50 * - DRAFT PICA E9, 12,1B,57,0,1B,50,1B,78,1 * - NLQ PICA EA, 1B,78,0,12,1B,57,0,1B,4D * - DRAFT ELITE EB, 12,1B,57,0,1B,4D,1B,78,1 * - NLQ ELITE EC, 1B,78***************************************************************** * * * * * * * STAR LC 10 PRINTER CONFIGURATION * * ==================================== * * Written for 1stWord.PLUS by F.A.SHELMERDINE G6.WZG * * * * Provides for :- * * * * (a) The printing of Double size and Quadruple size * * Characters, * * * * (b) The selection of Pica, Elite, Condensed and * * Expanded Type Styles in both Draft and NLQ. * * ,0,1B,57,0,1B,50,F * - DRAFT CONDENSED ED, 1B,57,0,1B,50,F,1B,78,1 * - NLQ CONDENSED EE, 1B,78,0,12,1B,4D,1B,57,1 * - DRAFT EXPANDED EF, 12,1B,4D,1B,57,1,1B,78,1 * - NLQ EXPANDED F0, 3D, 8, 5F * - = BS _ F1, 2B, 8, 5F * - + BS _ F2, 3E, 8, 5F * - > BS _ F3, 3C, 8, 5F * - < BS _ F4, 1B, 70, 1 * - Proportional on F5, 1B, 70, 0 * - Proportional off F6 * - N/A F7, 47,36,20,57,5A,47 * - Copyright F8 * - N/A F9, 1B, 6B, 0 * - Courier NLQ FA, 1B, 6B, 1 * - Sanserif NLQ FB, 1B, 6B, 2 * - Orator w/small caps NLQ FC, 1B, 6B, 3 * - Orator w/lower case NLQ FD, 1B, 68, 1 * - Double size FE, 1B, 68, 2 * - Quad size FF, 1B, 68, 0 * - Cancel 0 * NULL terminator * * (c) The selection of Proportional or normal spacing. * * * * (d) The selection of Courier, Sanserif, Orator with * * small capitals or Orator with lower case Type * * Founts. * * * * (e) Paper Sensor Enable and Disable is provided at * * and . Disabling the paper sensor permits * * printing to the bottom of the sheet when using * * single sheets. * * * * (f) All foreign accented characters are now available * * * * G6 WZG 16th.June 1990 * ***************************************************************** * Printer name * ============ * * For display above the font table on the * 1st Word Plus desktop (max 32 characters) STAR LC-10 G6 WZG * Configuration variables * ======================= * * These six variables define certain printer * configuration details required by 1st Word Plus: * * (1) 1 for microspacing daisywheel, else 0 * (2) Character width in printer units (daisy) * (3) Linefeed height in printer units * (4) Mid-carriage (daisy) pixels/inch (matrix) * (5) Bold offset in printer units (daisy) * (6) 1 to pause printing between pages, else 0 0, 0, C, 0, 0, 1 * Printer characteristics * ======================= * * This table defines values to be sent to the * printer by 1st Word Plus to control its operation. * * An entry consists of: * * (1) Function number (these must be kept in order) * (2) Command bytes (hex commands and placeholders) * * A placeholder has the top bit set and is substituted * by an actual value by 1st Word Plus when printing. * * Lines preceded by an asterisk are commented out. * 0 * Character width 1, D, A * Carriage return and line feed * 2 * Forward print * 3 * Reverse print * 4, * Vertical tab to line * 5 * Absolute horizontal tab 6, 1B, 45, 1B, 47 * Draft bold on 7, 1B, 46, 1B, 48 * Draft bold off 8, 1B, 78, 1, 1B, 47 * NLQ bold on 9, 1B, 48 * NLQ bold off A, 1B, 34 * Draft italic on B, 1B, 35 * Draft italic off C, 1B, 78, 1, 1B, 34 * NLQ italic on D, 1B, 35 * NLQ italic off * E * Draft light on * F * Draft light off 10, 1B, 78, 0 * NLQ light on 11, 1B, 78, 1 * NLQ light off 12, 1B, 53, 0 * Draft superscript on 13, 1B, 54 * Draft superscript off 14, 1B, 47, 1B, 53, 0 * NLQ superscript on 15, 1B, 48, 1B, 54 * NLQ superscript off 16, 1B, 53, 1 * Draft subscript on 17, 1B, 54 * Draft subscript off 18, 1B, 47, 1B, 53, 1 * NLQ subscript on 19, 1B, 48, 1B, 54 * NLQ subscript off 1A, 1B, 2D, 1 * Draft underline on 1B, 1B, 2D, 0 * Draft underline off 1C, 1B, 2D, 1, 1B, 78, 1 * NLQ underline on 1D, 1B, 2D, 0 * NLQ underline off 1E, C * Formfeed *1F, 12 * Horizontal initialization *20, 1B, 42, 0, 0, B * Vertical initialization 21, 1B, 40 * Termination: printer reset *22, 8 * Backspace 23, D * Carriage return *24, 1B, 43, 71 * Form length in lines 25, 1B, 41, 80 * Set line feed to N units 26, 1B, 2A, 5 * Start graphics (mode 5) * 27 * Reserved 28, 1B,78,0,12,1B,57,0,1B,50 * Draft Pica (10 cpi) 29, 12,1B,57,0,1B,50,1B,78,1 * NLQ Pica (10 cpi) 2A, 1B,78,0,12,1B,57,0,1B,4D * Draft Elite (12 cpi) * 2B * NLQ Elite (12 cpi) 2C, 1B,78,0,1B,57,0,1B,50,F * Draft Condensed (17.2 cpi) * 2D * NLQ Condensed (17.2 cpi) 2E, 1B,78,0,12,1B,4D,1B,57,1 * Draft Expanded ( 6 cpi) * 2F * NLQ Expanded ( 6 cpi) * 30 * Black ink * 31 * Magenta ink * 32 * Cyan ink * 33 * Yellow ink 0 * NULL termination byte * Translation Table * ================= * * This table is used to translate the ST * character codes for output to the printer. * * Each entry consists of: * * (1) ST character code (these must be in order) * (2) The (possibly null) byte string to be output * * ST character codes with a NULL translation * string are printed as spaces. * * ST character codes NOT in the table are sent * directly to the printer without translation. 7F *  - N/A 80 * - N/A 81, 1B, 52, 2, 7D, 1B, 52, 0 * - German 82, 1B, 52, 1, 7B, 1B, 52, 0 * - French 83, 61, 8, 5E * - a BS ^ 84, 1B, 52, 2, 7B, 1B, 52, 0 * - German 85, 1B, 52, 1, 40, 1B, 52, 0 * - French 86, 1B, 52, 4, 7D, 1B, 52, 0 * - Danish 1 87, 1B, 52, 1, 5C, 1B, 52, 0 * - French 88, 65, 8, 5E * - e BS ^ 89, 65, 8,1B,52,1,7E,1B,52,0 * - e BS French 8A, 1B, 52, 1, 7D, 1B, 52, 0 * - French 8B * - N/A 8C * - N/A 8D, 1B, 52, 6, 7E, 1B, 52, 0 * - Italian 8E, 1B, 52, 2, 5B, 1B, 52, 0 * - German 8F, 1B, 52, 4, 5D, 1B, 52, 0 * - Danish 1 90, 1B, 52, 9, 40, 1B, 52, 0 * - Norwegian 91, 1B, 52, 4, 7B, 1B, 52, 0 * - Danish 1 92, 1B, 52, 4, 5B, 1B, 52, 0 * - Danish 1 93, 6F, 8, 5E * - o BS ^ 94, 1B, 52, 2, 7C, 1B, 52, 0 * - German 95, 1B, 52, 6, 7C, 1B, 52, 0 * - Italian 96, 75, 8, 5E * - u BS ^ 97, 1B, 52, 1, 7C, 1B, 52, 0 * - French 98, 79, 8,1B,52,1,7E,1B,52,0 * - y BS French 99, 1B, 52, 2, 5C, 1B, 52, 0 * - German 9A, 1B, 52, 2, 5D, 1B, 52, 0 * - German 9B, 63, 8, 1B, 52, 0, 7C * - USA Cent 9C, 1B, 52, 3, 23, 1B, 52, 0 * - UK 9D, 1B, 52, 8, 5C, 1B, 52, 0 * - Japanese 9E, 1B, 52, 2, 7E, 1B, 52, 0 * - German 9F, 66 * - f A0, 1B, 52, B, 40 * - a Acute A1, 1B, 52, B, 7B * - i Acute A2, 1B, 52, B, 7D * - o Acute A3, 1B, 52, B, 7E * - u Acute A4, 1B, 52, 7, 7C, 1B, 52, 0 * - Spanish A5, 1B, 52, 7, 5C, 1B, 52, 0 * - Spanish A6, 61, 8, 5F * - a BS _ A7, 6F, 8, 5F * - o BS _ A8, 1B, 52, 7, 5D, 1B, 52, 0 * - Spanish A9 * - N/A AA * - N/A AB * - N/A AC * - N/A AD, 1B, 52, 7, 5B, 1B, 52, 0 * - Spanish AE * - N/A AF * - N/A B0, 61, 8, 7E * - a BS ~ B1, 6F, 8, 7E * - o BS ~ B2, 1B, 52, 4, 5C, 1B, 52, 0 * - Danish 1 B3, 1B, 52, 4, 7C, 1B, 52, 0 * - Danish 1 B4 * - N/A B5 * - N/A B6 * - N/A B7 * - N/A B8 * - N/A B9, 1B, 52, 1, 7E, 1B, 52, 0 * - French BA * - N/A BB * - N/A BC * - N/A BD * - N/A BE * - N/A BF * - N/A C0, 79, 8,1B,52,1,7E,1B,52,0 * - y BS French C1, 59 * - Y C2 * - N/A C3 * - N/A C4 * - N/A C5 * - N/A C6 * - N/A C7 * - N/A C8 * - N/A C9 * - N/A CA * - N/A CB * - N/A CC * - N/A CD * - N/A CE * - N/A CF * - N/A D0 * - N/A D1 * - N/A D2 * - N/A D3 * - N/A D4 * - N/A D5 * - N/A D6 * - N/A D7 * - N/A D8 * - N/A D9 * - N/A DA * - N/A DB * - N/A DC * - N/A DD, 1B, 52, 2, 40, 1B, 52, 0 * - German DE * - N/A DF * - N/A E0 * - N/A E1, 1B, 52, 2, 7E, 1B, 52, 0 * - German E2, 1B,38 * - Disable paper-out detector E3, 1B,39 * - Enable paper-out detector E4 * - N/A E5, 1B, 55, 31 * - Unidirectional printing E6, 19, 55, 30 * - Normal bidirectional printing E7 * - N/A E8, 1B,78,0,12,1B,57,0,1B,50 * - DRAFT PICA E9, 12,1B,57,0,1B,50,1B,78,1 * - NLQ PICA EA, 1B,78,0,12,1B,57,0,1B,4D * - DRAFT ELITE EB, 12,1B,57,0,1B,4D,1B,78,1 * - NLQ ELITE EC, 1B,78,0,1B,57,0,1B,50,F * - DRAFT CONDENSED ED, 1B,57,0,1B,50,F,1B,78,1 * - NLQ CONDENSED EE, 1B,78,0,12,1B,4D,1B,57,1 * - DRAFT EXPANDED EF, 12,1B,4D,1B,57,1,1B,78,1 * - NLQ EXPANDED F0, 3D, 8, 5F * - = BS _ F1, 2B, 8, 5F * - + BS _ F2, 3E, 8, 5F * - > BS _ F3, 3C, 8, 5F * - < BS _ F4, 1B, 70, 1 * - Proportional on F5, 1B, 70, 0 * - Proportional off F6 * - N/A F7, 47,36,20,57,5A,47 * - Copyright F8 * - N/A F9, 1B, 6B, 0 * - Courier NLQ FA, 1B, 6B, 1 * - Sanserif NLQ FB, 1B, 6B, 2 * - Orator w/small caps NLQ FC, 1B, 6B, 3 * - Orator w/lower case NLQ FD, 1B, 68, 1 * - Double size FE, 1B, 68, 2 * - Quad size FF, 1B, 68, 0 * - Cancel 0 * NULL terminator STAR LC-10 G6 WZG  EGFHxG H 4 5 x4 5xxSTGSHTSTGSHT---x- !@# %A&* (xWP )WPx *xWM ,xWP .xMW R}R R{Ra^ R{R R@R R}R R\Re^ eR~R R}R R~R R[R R]R R @R R{R R[Ro^ R|R R|Ru^ R|R yR~R R\R R]RcR| R#R R\R R~RfR @R {R }R ~ R|R R\Ra_o_ R]R R[Ra~o~ R\R R|R R~R yR~RY R@R R~R89U1U0 xWP WPx xWM WMx xWP WPx xMW MWx=_+_>_<_ppG6 WZGkkkkhhh TAR LC-10 (G6 WZG)  EGFHxG H 4 5 x4 5EFxxSTGSHTSTGSHT---x- !@# %A&*R|^R|v-><-   0123456789#R#$R$@R@[R[\R\]R]^R^`R`{R{|R|}R}~R~C,R}R{aR^R{R@R}R\eR^eR~R}iR~iR^R~R[R]R @R{R[oR^R|R|uR^R|yR~R\R]cR|R#R\R~fa'i'o'u'R|R\a_o_R]R[aR~oR~R\R|AAOR~'yR~YR@R~=_+_>_<_RR:-R[ * * (b) The selection of Pica, Elite, Condensed and * * Expanded Type Styles in both Draft and NLQ. * * 0130000000066 1 2 9[....................................................]  Thisisjusttotryifthesecharactersprintoutwithboth configurationfiles. !"$%^&*()_+1234567890-=` QWERTYUIOP[];:{}@<>?,./|\ LET'SSEE. Founts. * * * * Copyright (C) 1986, GST Holdings Ltd * * * ***************************************************************** * Printer name * ============ * * For display above the font table on the * 1st Word Plus desktop (max 32 characters) STAR LC-10 G6 WZG * Configuration variables * ======================= * * These six variables define certain printer * configuration details required by 1st Word Plus: * * (1) 1 for microspacing daisywhSTAR LC-10 G6 WZG  EGFHxG H 4 5 x4 5xxSTGSHTSTGSHT---x- !@# %A&* (xWP )WPx *xWM +WMx ,xWP -WPx .xMW /MWx R}R R{Ra^ R{R R@R R}R R\Re^ eR~R R}R R~R R[R R]R R @R R{R R[Ro^ R|R R|Ru^ R|R yR~R R\R R]RcR| R#R R\R R~RfR @R {R }R ~ R|R R\Ra_o_ R]R R[Ra~o~ R\R R|R R~R yR~RY R@R R~R89U1U0 xWP WPx xWM WMx xWP WPx xMW MWx=_+_>_<_ppG6 WZGkkkkhhh * Forward print * 3 * Reverse print * 4, 0660203030466 1GST Software1st Word User Guide 23896.2 GST 36/1.04#23 January 1986 9[....................................................] 1STWORD USERGUIDE FORTHEATARIST  COPYRIGHT  Copyright(C)1985GSTHoldingsLimited.Allrightsreserved.No partofthispublicationmaybereproduced,transmitted, transcribed,storedinaretrievalsystem,ortranslatedintoany languageorcomputerlanguage,inanyformorbyanymeans, electronicormechanical,magnetic,optical,chemical,manualor otherwise,withoutthepriorwrittenpermissionofGSTHoldings Limited,91HighStreet,Longstanton,Cambridge,England. DISCLAIMER  GSTHOLDINGSLIMITEDMAKESNOREPRESENTATIONSORWARRANTIESWITH RESPECTTOTHECONTENTSHEREOFANDSPECIFICALLYDISCLAIMSANY IMPLIEDWARRANTIESOFMERCHANTABILITYORFITNESSFORANY PARTICULARPURPOSE.Further,GSTHoldingsLimitedreservesthe righttorevisethispublicationandtomakechangesfromtimeto timeinthecontentshereofwithouttheobligationofGSTHoldings Limitedtonotifyanypersonofsuchrevisionorchange. NOTICETOUSER  Fromtimetotimechangesaremadeinthefilenamesandinthe filesactuallyincludedonthedistributiondisk.Thismanual shouldnotbeconstruedasarepresentationorwarrantythatsuch filesorfacilitiesexistonthedistributiondiskoraspartof thematerialsandprogramsdistributed.Distributiondisksmay includea"README.DOC"file.Thisfileexplainsvariationsfrom themanualwhichdonotconstitutemodificationofthemanualand theitemsincludedtherewith.Besuretoreadthisfilebefore usingthesoftware. TRADEMARKS  1stWordand1stMailaretrademarksofGSTHoldingsLtd. GEMandGEMDesktoparetrademarksofDigitalResearchInc. AtariST,TOS,SF314andSF354aretrademarksofAtariCorp. EpsonRX-80,FX-80andLX-80aretrademarksofEpsonCorp. QumeSprintisatrademarkofQumeCorp. CONTENTS 1 INTRODUCTION 1.1 Welcometo1stWord 1.2ComponentsList 1.3 AbouttheUserGuide 1.4 EssentialReading 2 GETTINGSTARTED 2.1 MakingaBackupCopy 2.2 Loadingthe1stWordProgram 2.3 TheStartupScreen 2.4 HelpInformation 2.5 CreatingaDocumentFile 2.6 TheEditWindow 2.7 Typing 2.8 SavingtheDocumentFileonDisk 2.9 EditingaDocumentFile 2.10 ScrollingThroughtheDocument 2.11 PageBreakDisplay 2.12 PositioningtheCursor 2.13 DifferentTypesofSpaces 2.14 DeletingText 2.15 TextInsertandOverwriteModes 2.16 ParagraphFormatting 2.17 SavingtheDocumentFilewithaNewName 2.18 HowtoExitfrom1stWord 3 1STWORDUSERINTERFACE 3.1 TypingandEditing 3.2 WPMode 3.3 Keyboard 3.4 FontTable 3.5 FunctionKeyIcons 3.6 Drop-downMenus 3.7 EditWindows 3.8 Pagination 3.9 RulerLine 3.10 DocumentSizeRestrictions 4 ATARIMENU 4.1 1stWord... 4.2 DeskUtilities 5 FILEMENU 5.1 Open... 5.2 Print... 5.3 Save 5.4 Saveas... 5.5 Layout... 5.6 Read... 5.7 Write... 5.8 Delete... 5.9 Quit 6 EDITMENU 6.1 WPMode 6.2 InsertMode 6.3 Find... 6.4 Replace... 6.5 Repeatfind 6.6 Setmark 6.7 Gotomark 7 BLOCKMENU 7.1 Startblock 7.2 Endblock 7.3 Cutblock 7.4 Pasteblock 7.5 Copyblock 7.6 Moveblock 7.7 Deleteblock 7.8 Findstart 7.9 Findend 7.10 Hideblock 8 STYLEMENU 8.1 Bold 8.2 Underline 8.3 Italic 8.4 Light 8.5 Super 8.6 Subscript 8.7 Restyle 8.8 Justify 8.9 Wordwrap 8.10 Spacing 8.11 Center 8.12 Indent 8.13 Reformat 9 HELPMENU 9.1 Extrahelp 9.2 OtherHelpScreens APPENDIX A PRINTERDRIVERS A.1 StandardPrinterDrivers A.2 CreatingaNewPrinterDriver A.3 InstallingaNewPrinterDriver B 1STWORDDATAFORMAT B.1 CharacterSet B.2 ControlCodes 1 INTRODUCTION 1.1 Welcometo1stWord Welcometo1st WordfromGST Software,theprofessionalword processingpackagedesignedespeciallyforyourAtari ST computerandtheGEMoperatingenvironment. 1st Wordissuitableforallwordprocessingtasks,froma simplememoorlettertoan80pagereport,andis particularlyusefulinanenvironmentwheredocumentcutand pasteisacommonactivity.1st Wordcanalsobeusedto prepareformlettersformailmergeoperationswith1stMail, whichisavailableasanoptionalextrafromGST Software. 1st Wordhasbeendesignedtobeveryeasytolearnand operatewithoutimposingunnecessaryoverheadsonthe experienceduser.Fulladvantageistakenofuser-oriented GEMfeaturessuchaswindows,icons,drop-downmenusand forms.Thisensuresthattheonlytimeyouneedtousethe keyboardiswhenyouaretypingtext.Complexeditingtasks suchascutandpasteorchangesindocumentlayoutorstyle beingachievedbyuseofthemouseonly.  1.2ComponentsList 1st Wordissuppliedononesingle-sideddiskholding: README Initialinstructions GUIDE.DOC The1stWordUserGuide TUTORIAL.DOC Atutorialfileforediting 1ST_PRNT.DOT Installeddotmatrix... 1ST_PRNT.DSY ...anddaisywheelprintertables 1ST_PRNT.PRGTheprinterdriverprogram 1ST_WORD.PRG The1st Wordprogram... 1ST_WORD.RSC ...anditsGEMresourcesfile Inthefolder\PRINTER\youwillfind: ASCII.HEX Patchfile:ASCII-onlyprinter BRO_HR15.HEXPatchfile:BrotherHR-15/25daisy EPS_LX80.HEX Patchfile:EpsonLX80NLQmatrix EPS_RX80.HEX Patchfile:EpsonRX/FX-80matrix QUME .HEX Patchfile:QumeSprintdaisy SMM804.HEXPatchfile:AtariSMM804matrix INSTALL.PRGPrinterdriverinstallprogram Pleasecontactyourdealerifanyofthesecomponentsis missingordefective. 1.3 AbouttheUserGuide The1stWordUserGuideprovidesalltheinformationyouwill needtopreparedocumentsorprogramsourcefilesonyourST: *creatingdocumentsorsourcefiles, *editingexistingdocumentsorsourcefiles, *printingdocumentsonamatrixordaisywheelprinter. Thesearedescribedfully,butonlyintermsofoperatingthe program.TheUserGuidedoesnottellyou: *howtotype, *how(ingeneral)tooperateyourAtariST, *how(ingeneral)tooperateGEMwindows(thoughspecific GEMfunctionsusedby1st Wordaredescribedindetail). TheUserGuidecanbereadinthreeways: *asatutorialguidetohelpyougetstarted - essential forbeginnerswhohavenotusedawordprocessorbefore, *asareferencemanualforexperiencedusers, *asalastresortforthecomputerhackerwhonever botherstoreadthemanualinthefirstplace! Beforestartingtouse1stWord,werecommendthatyouread theUser Guideatleastonce,thoroughly. Chapter 2isatutorialthatwilltakeyoustep-by-step throughthebasic1stWordfeatures.BeginnerstoWPshould followthistutorialcarefullybeforeattemptingthemore advancedfeaturesdiscussedinlaterchapters.Experienced WPusersshouldreadchapter2butneednotworkthroughthe tutorial. WhetherornotyoualreadyhaveWPskills,afewsessions with1st Wordisallyou'llneedtobecomeanexpert. 1.4 EssentialReading Beforeattemptingtouse1stWord,itisessentialthatyou arefullyfamiliarwiththeoperationoftheAtariSTandthe GEMoperatingenvironment.Thesearedescribedindetailin yourAtariST Owner'sManual. 1.5 Using1stWordwithaSingleDiskSystem IfyourSThasasingleSF354diskdriveitisessentialto movesomeofthesuppliedfilesontoaseparatediskas follows: (a) ProgramDisk Makeabackupofthesupplieddiskasdescribedin2.1 andusethecopyasyourprogramdisk. (b) DataDisk Formatablankdisk.Copythefollowingfilesontoyour datadisk: 1ST_PRINT.PRG Printerdriver 1ST_PRINT.DOT Dotmatrixand/or... 1ST_PRINT.DSY...daisywheelprinttable(s) Notethattheprinttable(s)youcopyovershouldbe installedforyourprinterasdescribedinAppendixA. Tooperate1st WordwithasingleSF354disksystem,insert theprogramdiskandloadthe1st Wordprogramasdescribed in2.2.Whentheprogramhasloadedandthe1st Wordstartup screenisdisplayed(see2.3)removetheprogramdisk,insert thedatadiskandclicktheOKbuttonontheItemSelector form.Youmaynowproceedtoedityourdocument(s). Notethatyoumaycreateasmanydatadisksasyouwant,but eachdiskmustcontainthefilesdefinedin(b).Failureto dothiswillresultinanerrormessagewhenyouattemptto printafile. 1.6 FaultReportsandTechnicalEnquiries Ifyouhaveanyproblemsoperating1st Wordoranytechnical questions,youshouldfirstconsultyourdealerorlocal User'sGrouporAtariCustomerRelations. Iftheresponsefromthesesourcesisnotsatisfactory,you maycontactGSTdirectinwritingattheaddressgivenin AppendixB.Weregretthatwecannotanswerdirecttelephone enquiriesfromendusers. Faultreportsmustincludethe1st Wordversionnumbergiven ontheinformationscreen(see4.1)togetherwithadetailed descriptionoftheproblemandsufficientevidencetojustify thefaultreport.Wealsowelcomeyourcommentsandany suggestionsforproductenhancements. 2 GETTINGSTARTED 2.1 MakingaBackupCopy  Beforeyoudoanythingelse,itisessentialthatyoumakea backupcopyofthe1stWordmicrofloppydisk.Thisis carriedoutfromtheGEMDesktopprogramandtheprocedure dependsonwhetheryouhavesingle(SF354)ordouble-sided (SF314)diskdrivesandwhetheryouhaveoneortwodrives. Ifyouhavesingle-sideddrives,insertthe1st Worddisk intodrive Aandablankformatteddiskintodrive B.Now clickthemouseonthedrive Aiconanddragittothe drive Biconbyholdingdowntheleftbuttonandmovingthe mouse.Whenthedrive Biconchangestoblackreleasethe button.Answerthepromptsgivenbytheprogrambyclicking theOKbuttononlyifyouarecertainthatthedisksarein thecorrectdrives.Theprogramwillcopythecontentsof the1st Worddisktodrive B. Ifyouhavedouble-sideddrives,insertthe1st Worddisk intodrive Aandablankformatteddouble-sideddiskinto drive B.Obtainadirectorylistingofbothdisksby clickingineachofthediskwindowsandpressingtheESC key.Movethemousetothedrive Awindowanddragarubber bandaroundthefilelistoricons,thenreleasethebutton (thefilesshouldchangetoblack).Nowholddownthemouse buttoninsidetherubberbandanddragittothedrive B window,releasingthebuttonwhenthemouseiswithinthe window,answerthepromptandtheprogramwillcopyeachfile fromthe1st Worddisktodrive B. Ifyouonlyhaveonediskdrive,thesystemwillpromptyou toswapdisksfromtimetotimeduringthecopyoperation. Onceyouhavemadeacopy,storetheoriginal1st Worddisk inasafeplaceandusethecopyasyourworkingdisk. 2.2 Loadingthe1stWordProgram  1st Wordisbestusedinhighresolutionmodeonamonochrome monitor,thoughitcanalsobeusedsatisfactorilyinmedium orlowresolutionmodeonacolormonitororTV. Toloadtheprogram,insertthe1st Worddiskintoeither driveandobtainadirectorylistingofthediskbyclicking inthewindowandpressingtheESCkey.Nowmovethemouse totheiconordirectoryentrylabelled1ST_WORD.PRGand double-clicktheleftbutton.Thedesktopisclearedandthe titlelinewilldisplay1ST_WORD.PRGshowingthattheprogram isbeingloadedfromdisk.Afterashortwhile1st Wordwill displaythestartupscreen. 2.3 TheStartupScreen  When1st Wordisloaded(andbetweeneditingfiles)it displaysthestartupscreen.Thishasfourcomponents: (a) Drop-DownMenuBar  Thetoplineofthescreendisplaysthemenuheadings: Atari GEMdeskutilities File fileanddocumentlayoutfunctions Edit texteditingfunctions Block textcutandpastefunctions Style textformattingandcharacterstylefunctions Help on-screenhelpfunctions (b) FontTable(highandmediumresolutiononly) Atthecenterrightofthescreenisa(partially obscured)tableholdingthecharacterfont.Youmayuse themousetoselectcharactersfromthistablethatare notavailablefromthekeyboard. (c) FunctionKeyIcons(highandmediumresolutiononly) Thesearedisplayedatthebottomofthescreenand indicatetheWPfunctionsassignedtoeachoftheST functionkeys.KeysF1throughF5aretoggleswhich indicatethecurrentsettingsofthefollowing: F1 boldtexton/off F2 underlinedtexton/off F3 italictexton/off F4 lighttexton/off F5 insertmode/overwritemode KeysF6throughF10areactionsperformedwhenediting: F6 deleteline F7 newpage F8 centerline F9 indentparagraph F10 reformatparagraph Functionkeyscanbeoperatedeitherfromthekeyboard orbyclickingthemouseontheappropriatescreenicon. (d) GEMItemSelector Thisissuperimposedinthecenterofthescreenwhen theprogramisfirstloadedandisusedtoselectan itemforeditingfromalist.Forthemoment,ignore thisbyclickingtheCANCELbutton. 2.4 HelpInformation  1st Wordprovideshelpinformationatanytimebymovingthe mousetotheHelpdrop-downmenuandclickingonanyofthe menuentriestoobtainahelpwindow.Onceyouhavereadthe informationclicktheOKbuttontoremovethewindow.Trya fewhelpitemsnow. IfyouselecttheExtra helpentry,1st Wordwilldisplaya helpwindowautomaticallyeverytimeyouselectadrop-down menuitemandwillaskyoutoconfirmorcanceltheitem beforeproceeding. WerecommendthatyouselectExtra helpnow(anduseitfor yourfirstfewsessions)becauseyoucanbeconfidentthatno menuitemwillbeactioneduntilyouconfirmthatyouwantto proceed.TheExtra helpfeaturecanbeturnedoffby clickingtheExtra helpentryasecondtime. 2.5 CreatingaDocumentFile  Tocreateanewdocumentfile,firstmoveyourmousetothe Filedrop-downmenuandclicktheOpenitem.Thiswill displaytheGEM Item Selectorwhichcontainstwoeditable fieldsandalistoffiles: (a) DirectoryLine  Thiscontainsamasktodeterminewhichfilesare displayedinthefilelist,forexampleA:\*.DOCwhich means"allthefilesondiskAwitha.DOCextension". (b) DirectoryWindow  Thisshowsallthefilesontheselecteddisk(currently your1st Worddisk)witha.DOCextension.Becauseyou arecreatinganewfile,youcannotusethedirectory windowtoselectitsname. (c) SelectionLine  Thisfieldisusedfortypinganewfilename.First clearit(ifnecessary)bypressingESC,thentypethe nameofthedocumentyouwishtocreate,TEST.DOCfor example,andpresstheRETURNkey. YouhavenowcreatedanemptydocumentcalledTEST.DOCin memory.  2.6 TheEditWindow  EachfilethatyoueditappearsinaGEMwindow(youshould alreadybefamiliarwiththesefromusingtheGEMDesktop). Thewindowyouhaveopenedoccupiestheentirescreenexcept themenulineatthetopofthescreenandthefunctionkey iconsatthebottom. The1st Wordeditwindowconsistsofthefollowingareas: (a) TitleLine  Thisdisplaysthedocumentname(inthiscaseTEST.DOC) andisusedtochangethepositionofthewindowby dragging.Thetitlelineisboundedontheleftbythe GEMclosebox(usedtoquittheedit)andontheright bytheGEMfullbox(usedtoexpandthewindowtothe fullscreenarea). (b) RulerLine  Therulerlineisdisplayeddirectlybelowthetitle lineandshowstheleftandrightmarginandtabpoints inforceforthedocument. (c) TextArea  Thetexteditingarea(whichiscurrentlyblankbecause youarecreatinganewdocument)isdisplayedbelowthe rulerline.Thisareacontainsthetextcursor (displayedasareversevideorectangle)whichindicates wheretextinputoreditingoperationswilltakeplace. (d) PageMargin  Totheleftofthetextareaisthepagemarginwhich displaysuserdefinedandprogramgeneratedpagebreaks. Thiscurrentlydisplayspagenumber1.(Notinlow resolutionmode.) (e) VerticalandHorizontalScrollBars  Totherightofandbeneaththetextareaarethe standardGEMscrollbarswhichcanbeusedtoscroll textthroughthewindowbyline,pageordragging, eitherverticallyorhorizontally.Attheintersection oftheseareasinthebottomrightofthewindowisthe GEMsizebox.Thiscanbeusedtochangethesizeof thewindowbydragging. 2.7 Typing  Trytypingafewlinesoftextasyouwouldonatypewriter, usingtheRETURNkeytoendalineandtheBACKSPACEkeyto gobackandcorrectanymistakes.Usethisopportunityto getthefeelofthekeyboardandtoadjustthekeyboard variablesusingtheSTcontrolpanelandthevolumecontrol. NowtrytypingaparagraphwithoutusingtheRETURNkeyuntil theendoftheparagraph.Youwillobservetwoimportant features: (a) WordWrap  Attheendofeachline,whenyouattempttotypebeyond therightmargin,thewordyouaretypingwill automaticallybecarriedovertothenextline. (b) RightJustifiedText  Afterwordwraphastakenplace,eachlineisaligned withtherighthandmarginbytheautomaticinsertionof extrastretchspacesbetweenthewords.Notethatthe lastlineoftheparagraphisexcludedfromthis process. Bothwordwrapandrightjustificationcanbeswitchedoffby selectingtheappropriateentriesintheStylemenu,allowing longlinesandleftjustifiedtext. Notethat1st Wordwillscrollthetextthroughthewindow foryouautomaticallywheneveryouapproachtherightor bottomedgeofthewindow.Notealsohowthewhitesliders inthescrollbarscorrespondtothescrollingmovement. Finally,toendthisbriefexample,trychangingyourtext styleasyoutypebyusingthefunctionkeysoriconsmarked F1toF4toswitchthevariousstylesonandoff.Further textstyleoptionsareavailableusingtheStylemenu. Experimentwithpotentialstylecombinationstodiscover theireffect. 2.8 SavingtheDocumentFileonDisk  TosavethedocumentfileondiskmovethemousetotheFile menuandselecttheSaveoption.Thiswillsaveyour document(inthiscaseTEST.DOC)ondiskandwillclosethe documentwindow. 2.9 EditingaDocumentFile  Inthissectionyouwilldiscoverthebasicfunctionsusedin editingadocumentfile.Moreadvancedfunctions(suchascut andpaste)areexplainedlater. ToeditadocumentmovethemousetotheFilemenuandclick theOpenoption.ThiswilldisplaytheGEMItemSelectoryou usedwhencreatingadocument(inSection2.5). ThedirectorywindowshouldcontaintheentryTUTORIAL.DOC whichisthedocumentfileyouaregoingtoedit.Select thiseitherbyclickingthemouseonthedirectorywindow entryfollowedbyaclickontheOKbutton,oradouble-click onthedirectorywindowentry. 2.10 ScrollingThroughtheDocument TUTORIAL.DOCshouldnowbedisplayedinthetextwindow. Thisdocumentismuchlargerthanthewindowareasoyouwill needtoscrolltoviewitall.Thisisachievedusingthe GEMscrollbarsattherightandthebottomofthetextarea. Thewhiteslidersinthescrollbarsrepresentthevisible portionofthedocumentasfollows: *theverticalslidershowsthesizeandverticalposition ofthetextarearelativetothesizeofthewhole document, *thehorizontalslidershowsthehorizontalpositionof thetextarearelativetoamaximumlinelengthof160 characters. TryscrollingthedocumentusingtheGEMscrollbars, observingtheeffectsonthetextwindow,slidersandcursor position: *clickingthearrowboxesscrollsverticallybyoneline atatimeandhorizontallybyfivecharactersatatime, *clickingtheshadedareasscrollsbothverticallyand horizontallyone'screenful'atatime, *draggingtheslidersmovesthewindowtextareathrough thedocumenttothepositionindicated. Notethatittakesalittlewhiletodragtheverticalslider fromoneendofthedocumenttotheother - thisdelaywill increasewiththesizeofyourdocument. 2.11 PageBreakDisplay Examinethepagebreakdisplaytotheleftofthewindow whileyouscrollthetext.Youwillnoticethreetypesof pagebreakindicatedbyhorizontallinesinthepagemargin: *ahardpagebreakisindicatedbyasolidline.Youcan inserttheseyourselfwiththeF7keyorbyclickingthe mouseinthepagemarginatthedesiredposition, *asoftpagebreakisindicatedbya50%dashedline. Theseareinsertedautomaticallyby1st Wordwhenthe maximumpagelengthisexceeded. *aconditionalpagebreakisindicatedbya25%dashed lineaccompaniedbya25%dashedverticalline indicatingthescope.If1st Worddecidestoinserta pagebreakwithinscopeoftheconditionalthenthenew pagenumberisinsertedatthestartandthedashes increaseto75%. Ifyouareusingahighormediumresolutionmonitor,page numbersarealsoindicatedintheappropriatepositions withinthepagemargin. 2.12 PositioningtheCursor Tochangethetextinadocumentbydeletingorinserting characters,itisnecessarytomovethecursortothedesired position.Thiscanbeachievedinthreeways: *pointthemouseatthedesiredpositionandclick, *usethefourcursorkeys(markedwitharrows)tomove thecursorinthedirectionindicated, *presstherightorleftcursorkeywhentheCONTROLkey ishelddowntomovethecursorhorizontallywholewords atatime. Experimentwithcursorpositioning.Youwillnoticethatit ispossibletoscrollthetextbyattemptingtomovethe cursoroutofthevisibletextareawiththecursorkeys(but notwiththemouse). Notethatscrollingasaresultofcursormovementcannot keepupwithareasonableauto-repeatratefromthekeyboard. Thisisnotabugin1st WordbutafeatureofGEM(thereis nowaytoinhibitkeyboardbuffering),soyoushouldavoid usingkeyboardauto-repeatwhenscrollingtext. 2.13 DifferentTypesofSpaces Youwillhavenoticedwhenmovingthecursorhorizontally acrosswhitespaceinthetextthatitwilloccasionallyjump overoneormorespacepositions.Thisisbecausethereare fourdifferenttypesofspacethatarevisibleonthescreen: (a) VariableSpace Whenyoupressthespacebaravariablespaceis insertedintothetext.Thisspacemaybestretchedby 1st Wordduringtheprocessoflinejustification.You canalwaysplacethecursoronavariablespace. (b) StretchSpace Whenalineisjustifiedonthescreen,oneormore stretchspacesmaybeinsertedafteravariablespace. Thesearetreatedby1st Wordaspartofthevariable spaceitself.Youarenotpermittedtopositionthe cursoronastretchspace.Notealsothatwhena variablespaceisdeleted,anystretchspacesassociated withitaredeletedaswell. (c) FixedSpace WhenyoupressthespacebarwhiletheCONTROLkeyis helddownafixedspaceisinsertedinthetext.This spaceisneverstretchedorusedasapotentialword wrappointduringlinejustification.NotethattheTAB keyalsoinsertsfixedspacesintothetextuptothe nexthorizontaltabposition.Youcanalwaysplacethe cursoronafixedspace. (d) Indents WhenyoupresstheF9keyoneormoretimesanindentis insertedintothetext.Thisissimilarinappearance toaTABbutinsertsasingleindentspacefollowedby stretchspacestothenexthorizontaltabposition.The cursorcanbepositionedontheindentspaceonlyand deletingthiswilldeletetheassociatedstretchspaces. Theindentvalueinthefirstlineofaparagraphis usedby1st Wordtodeterminethelocalleftmarginfor theparagraphduringlinejustification,theindent valueforsubsequentlinesbeinggeneratedautomatically bytheprogram.Ifmorethanoneindentappearsinthe firstline,thepositionofthelatterisused. 2.14 DeletingText Fourtextdeletionfunctionsareprovidedby1st Wordfrom thekeyboard: *theBACKSPACEkeydeletesthecharactertotheleftof thecursorposition, *theDELETEkeydeletesthecharacteratthecursor position, *pressingDELETEwhentheCONTROLkeyishelddown deletesfromthecursorpositiontotheendoftheword, *theF6keydeletestheentirelinecontainingthe cursor. Muchlargerunitscanbedeletedusingthecutandpaste functionsdescribedlater. Afewpointstoremember: *bewarekeyboardauto-repeat,especiallywhenusing deleteline(F6), *bewarewhendeletingindentsandstretchedvariable spacesbecauseallthestretchspacesaredeletedtoo. Experimentwiththedeletefunctionsuntilyouarefamiliar withtheiroperation. 2.15 TextInsertandOverwriteModes Whenediting,itispossibletoenternewtextintoa documentinoneoftwomodes: *textinsert modeisthedefaultcondition,characters areinsertedatthecursorpositionwithoutdestroying theexistingtext, *textoverwrite modeisthealternativecondition.New textiswritten"ontopof"theexistingtextatthe cursorposition(exceptatendoflineordocumentwhen itisinsertedasusual).TABandRETURNkeysinthis modesimplymovethecursorwithoutinserting. YoucanswitchbetweenthesemodesbyusingtheF5keyor iconorbyusingtheInsertmodeentryintheEditmenu. 2.16 ParagraphFormatting TUTORIAL.DOCcontainsmanydifferentstylesofparagraphs, eachofwhichdescribeshowitwasformatted.Thissection describesthegeneralrulesforformattingparagraphswithin 1stWord: (a) Justification Aparagraphcaneitherberight justified(textis alignedontherightmarginbyinsertingstretchspaces) orleft justified(textisflushedleftwithnostretch spaces).Ineithercasenolineisallowedtoexceed therightmargin. Toswitchrightjustificationonandoff,selectthe JustifyoptionfromtheStylemenu.Notethattheentry ischecked(ticked)whenrightjustificationison. Whenyouaretypinganewparagraph,justificationis automaticandnospecialactionisrequired(otherthan settingtherequiredjustificationstyle).However,if youchangeeitherthejustificationstyleorcontentsof aparagraphyouwillneedtoreformatitbyusingthe F10keyoriconwhenthecursorisinthefirstline. (b)  IndentingtheWholeParagraph Toindentthewholeparagraphbythesameamountusethe F9keyoricontospecifytheindentsizebeforetyping theparagraph. Indentsarerememberedby1st Wordsoyoudonotneedto respecifythemwhenyoureformataparagraphunlessyou wanttochangetheindentsize.Tochangethesizeof anindentusethedeletionand/orindentfunctionsas requiredonthefirstlineoftheparagraphandthen reformatit. (c) IndentingtheFirstLineofaParagraph Toindentthefirstlineofaparagraphbyalarger valuethantheremaininglinesusefixedspaces (generatedbytheTABkeyorCONTROLkeyplusspacebar) afteranyindentandbeforethefirsttextcharacter. (d) HangingIndents(Outdents) Thisstylehasthefirstlineatstandardlengthwith subsequentlinesfurtherindented.Justifythetext withtheinitialindent(ifany),thenonthesecond lineinsertanextraindentandreformat.Thisstyleis notpreservedbyareformatfromthefirstline. (e) NumberedParagraphs Thisstyleisobtainedbytypingtheparagraphnumberor letterfollowedbyoneormoreindentsbeforethefirst textcharacter.Subsequentlineswillbeleftaligned ontheindent. Experimentwiththesebasicstylesandinventsomeofyour own. Although1st Wordisverygoodatrememberingthestylewhen youreformataparagraph,hangingindentsandcentered paragraphswillrequiremanualinterventionfromyou.You shouldalsoconfirmwhetheranyspecialformattingstyles thatyouhaveinventedrequiremanualinterventionwhen reformatting. 2.17 SavingtheDocumentFilewithaNewName Youhavenowlearnedhowtousemostofthebasicfeaturesof 1st Word,soTUTORIAL.DOCisnowreadytobesavedondisk. Evenintheunlikelyeventthatyouhavemadeacompletemess oftheediting,youroriginalversionofTUTORIAL.DOCwill notbedestroyedbecause1st Wordwillrenamethisto TUTORIAL.BAKforsecurity. Alternatively,youcansavetheeditedversioninanewfile inwhichcasetheoriginalversionretainsitsoriginalname. SelecttheSaveasentryintheFilemenuwhichwilldisplay aformcontainingthecurrentname(TUTORIAL.DOC).Youcan editthisfieldtogivethedocumentanewname(sayNEW.DOC) andthenclickonOK. 1st Wordwillsavethedocumentwiththenewfilenameand closethewindow,returningtothestartupscreen. 2.18 HowtoExitFrom1stWord Toexitfrom1st WordyoumustfirstselectSaveorSave as fromtheFilemenutocloseyourdocumentandreturntothe startupscreen.ThenselectQuitfromtheFilemenuto returntotheGEMDesktop. Thisendsthetutorialsectionofthemanual. 3 1STWORDUSERINTERFACE Thischapterdescribesthemajorcomponentsofthe1st Word userinterfaceingeneralterms. 3.1 TypingandEditing 1st Wordhasbeendesignedfortwomodesofoperation: (a) Typing Whenyouarecreatingadocumentforthefirsttimeor addingnewtexttoanexistingdocument,itisusualto operate1st Wordintypingmode,usingonlythemain QWERTYkeyboardandthe10functionkeyswhoseactions aredisplayedpermanentlyatthebottomofthescreen. Thefunctionkeycommandshavebeenchosentomaximize efficiencybyensuringthatyourfingersrarelyneedto leavethekeyboardwhenoperatingintypingmode. (b) Editing Whenyouhavecreatedadocument,youwillusuallyneed tochangeitatleastoncetocorrectstyle,spellingor grammarortorearrangethedocumentcontents. Ineditingmodeitisunusualtochangemorethana smallportionofthetext,thebulkoftheediting processbeingscrolling,searching,stylechangesand blockmovementoperations,wherecontinuoususeofthe keyboardisnotnecessary.Therefore1st Wordhasbeen designedtoenableeditingtobeachievedalmost entirelybyuseofthemouse.  Notethatthereisnoformaldistinctionbetweenthetwo modes(norarethereanycommandsprovidedtoswitchbetween them).Thedistinctionispurelyoneofoperation.Ifyou haveneverusedamouse-drivencomputerbefore,wesuggest thatyoutrythesuggestedmethodfirstbeforeselectingyour ownoperationalstyle. 3.2 WPMode TextcanbeenteredoreditedwithWPModeonoroff.This tells1st Wordwhethertostorespecialstylecodesinyour textortoproducepureASCIIfiles.SwitchWPModeonfor wordprocesseddocumentsandoffforprogramsourceordata files.1st Wordwillusuallydefaulttothecorrectmodefor thefileyouedit(see5.1fordetails). 3.3 Keyboard TheSTkeyboardisaverygoodexampleofamoderncomputer keyboard.Itslightactionandaudiofeedbackoptionenable veryfasttypingspeedstobeattained,comparablewiththe bestelectronictypewriters. Thekeyboardisdividedintofourareas: *theQWERTYbankisusedfortypingintheusualway, *thefunctionkeysareusedtoactionasubsetoftheWP stylecommands, *thecursorkeysareusedtomovethetextcursoraround thedocumentwindow, *thenumerickeypadisnotparticularlyusefulforWP, butcanbeusedtoenterlongstringsofnumbers. WiththeexceptionofALTERNATE,CAPSLOCK,CONTROLand SHIFT,allkeysonthekeyboardwillauto-repeatifhelddown forashortwhile.Thisisnotalwayssynchronizedwiththe screenupdateandyoumayfindthatthekeyboardwill occasionallyraceaheadofthescreen,especiallywhenyou areforcingthescreentoscroll. 1st Wordallocatesspecialfunctionstocertainkeysandkey combinations: * INSERT insertline * CONTROL+SPACE fixedspace * CONTROL+or moveleftorrightoneword * CONTROL+DELETE deletefromcursortoendofword NoactionisperformedbytheHELP,UNDOorCLR/HOMEkeys. 3.4 FontTable NotalloftheST's256charactersetisavailablefromthe keyboard,andtheparticularcharactersavailablewilldiffer fromcountrytocountry.Toremedythis,1st Wordprovidesa fonttableonthedesktop.(Highandmediumresolutiononly.) Toselectacharacterfromthedesktop,dragtheGEMsizebox atthebottomrightofyourdocumentwindowtorevealthe fonttable.Thenselectthecharacteryouwantbyclicking themouseattheappropriatepositionand1st Wordwillcopy thecharactertoyourwindowatthecurrentcursorposition. 3.5 FunctionKeyIcons 1st Wordprovides10functionkeyiconsatthebottomofthe screen.(Onlyinhighandmediumresolution.)Theseare providedforthreepurposes: * asavisualreminderoftheactionsoffunctionkeys, *asavisualreminderofthestatusofsomeofthestyle functions, *asanalternativetothefunctionkeysduringeditingby clickingtherequirediconwiththemouse. NotethattheF1-F5iconsaretoggleswhichareshownin reversevideo(whiteonblack)iftheeffectisinforce. 3.6 Drop-downMenus Sixmenuheadingsareshownatthetopofthescreen: (a) Atari 1st WordprograminformationscreenandyourSTdesk utilities. (b) File Fileopenandclosefunctionsanddocumentlayout commandsthathavescopeacrossanentirefile. (c) Edit Texteditingmodeselectionandsearch,replaceand positionmarkerfunctions. (d) Block Textblockmanipulationfunctionsforcutandpaste operations. (e) Style Commandsthataffectlocaltextstyleandformatting. (f) Help Briefhelpscreens,displayedeitherondemandor automaticallywhenadrop-downmenuitemisselected. Atcertainstagesduringaneditsomeofthemenufunctions willbeinvalid(showninlightface).Ifamenuentryisa togglefunctionitwillbechecked(ticked)wheninforce. 3.7 EditWindows  Typingandeditingisperformedineditwindows.Youcan openuptofourwindows,enablingcutandpasteoperations betweendocuments.Toswitchwindows,clickthemouseatany pointinthetargetwindowtomakeitthecurrentwindow.  Windowscrollingandsizeandpositionmanipulationcanbe performedbyusingthemouseintheeditwindowborder: (a) VerticalScrolling Textinthewindowcanbescrolledverticallywiththe verticalscrollbartotherightofthewindow: *clickthearrowstoscrollalineatatime, *clicktheshadedareastoscrollapageatatime, *dragthewhitesliderbartotherequiredposition. (b) HorizontalScrolling Textinthewindowcanbescrolledhorizontallywiththe horizontalscrollbaratthebottomofthewindow: *clickthearrowstoscroll5characterpositions, *clicktheshadedareastoscrollapageatatime, *dragthewhitesliderbartotherequiredposition. (c) SizingtheWindow Theeditwindowcanhaveitssizechangedasfollows: *clicktheGEMfullboxinthetoprightcornerto expandtofullsizeorshrinktooriginalsize, *dragtheGEMsizeboxinthebottomrightcornerto changethehorizontalandverticaldimensions. (d) MovingtheWindow Dragthewindowtoanewpositionusingthetitleline. (e) ClosingtheWindow Theeditwindowcanbeclosed(andtheeditabandoned) byclickingtheGEMcloseboxatthetopleftcorner. Inadditiontowindowmanipulationfunctions,paginationand rulerfunctionsarealsocarriedoutinthewindowborders. 3.8 Pagination 1st Worddisplayspagebreaksandactionspaginationcommands intheleftmarginoftheeditwindow.Threetypesofpage breaksarerecognizedby1st Word: (a) HardPageBreak Ahardpagebreakisalwaysinsertedbytheuserandis indicatedbyasolidhorizontallinewiththenewpage numberdirectlybeneathit. Youcansetorclearthesebyclickingthemouseinthe leftmarginatthedesiredposition.Ahardpagebreak canalsobeinsertedabovethelinecontainingthetext cursorwiththeF7keyoricon. (b) ConditionalPageBreak Aconditionalpagebreakwithadefinednumberoflines ofscopeisalsoinsertedbytheuser.Itisusedto protectagroupoflinesthatyoudonotwishtobe splitacrossapageboundary.Ifthescopeofthe conditionalbreakspansapotentialpageboundarythena newpageisinsertedatthestartpositionofthescope. Aconditionalpagebreakiscreatedbydraggingthe mousedownintheleftmargintoindicatethescope. Thiscansubsequentlybeincreasedordecreasedinscope bydraggingtheendpositioninthedesireddirection, ordeletedbyclickingthemouseatthestartposition. If1st Wordinsertsapagebreakatthestartposition, theconditionalbreakisdisplayedasa75%dashed horizontallinewiththenewpagenumberdisplayed directlybeneathit.Otherwisetheconditionalpage breakisdisplayedasa25%dashedlinewithnopage number.Ineithercasethescopeisdisplayedasa verticallineinamatchinglinestyle. (c) SoftPageBreak Asoftpagebreakisinsertedbythe1st Wordprogramif youhaveexceededthetotalnumberoflinespermittedon apageandisindicatedbya50%dashedhorizontalline withthenewpagenumberdirectlybeneathit. Youcanconvertthesetohardpagebreaksbyclickingat theappropriatepositioninthemargin. Notethatthetotalnumberoftextlinesonapageisdefined globallyforadocumentbyusingtheLayoutcommandinthe Filemenu. 3.9 RulerLine Therulerlineisdisplayedimmediatelybeneaththedocument titleandisusedtoindicateandchangethemarginandtab positionsforformattingthedocument.Ifyouchangethe rulerline,onlythoseparagraphsyoutypeorreformatafter thechangewillbeaffected. ThedefaultrulerlineissetupforPicapitch(10cpi)on 81/2by11inchpaperandallows66characterpositionsper linewithtabpointsevery5characters. Therulerlineismodifiedbyuseofthemouseasfollows: (a) TabPoints Tabpointsareusedtodeterminehowmanyfixedor indentspacestoinsertwhenusingtheTABandF9keys.  Tabpointscanbesetandclearedbyclickingthemouse intherulerlineatthedesiredposition. (b) LeftMargin Itisneitherpossiblenornecessarytochangetheleft margininadocument. Theeffectiveleftmarginpositioncanbechangedeither byusingindentsinthedocumentorbyspecifyingapage offsetatprinttime. (c) RightMargin Therightmarginisusedtoindicatewherewordwrapand rightjustificationoccur. Youmaychangetherightmarginbydraggingitwiththe mousetothedesiredposition.Tosetarightmargin outsidethecurrentwindowarea,youmustfirst horizontallyscrollthewindow. TherulerlineineffectwhenyouSavethedocumentwillbe storedtogetherwiththetext(WPmodeonly).Thestored rulerwillberedisplayedwhenyounextOpenthedocument. 3.10 DocumentSizeRestrictions Ona520STwiththeoperatingsysteminROM,thereisenough spacetoeditadocumentofaround80pages.Thisreducesto around40pagesonearlysystemswithaRAMbasedoperating system.1st Wordwillwarnyouwhenyouarerunningshortof spaceinRAMorondisk. 4 ATARIMENU Menuentriesendingwith"..."invokeadialogue,othersare actionedimmediately. 4.1 1stWord... Thisfunctiondisplays1st Wordprograminformationincluding theauthors'namesandprogramrevisionnumber.ClicktheOK buttontocontinue. 4.2 DeskUtilities TheremainingitemsintheAtarimenuarethedeskutilities thatwereloadedwithyourversionoftheSToperatingsystem whenyoubootstrappedthesystem. Anynumberofdeskutilitiesmaybestartedorquitduring 1st Wordoperationwithoutaffectingyourtext(providedthat yourdeskutilitiesarewellbehaved)!Thisisbecausethey areallocatedmemorywhenyoubootstrapthesystemanddonot grabanymorewheninvokedfromthedrop-downmenu. 5 FILEMENU Menuentriesendingwith"..."requireadialogue,othersare actionedimmediately. 5.1 Open... ThiscommandinvokestheGEMItemSelectortoselectafile forediting(uptofourdocumentscanbeeditedatonce). TheItemSelectorhasthreefieldswhichyoucanmodify(use thecursorkeysorthemousetoselectthefields): (a) DirectoryLine Thisfieldholdsamasktodeterminewhichfilesare displayedinthedirectorywindow.Bydefaultthiswill besettodisplayallthe.DOCfilesonthediskfrom whichyouloaded1st Word,forexampleB:\*.DOC.Ifyou editthismasktochangethefilesdisplayedinthe directorywindowyoumustalsoclickthemouseinthe directorywindowtodisplaythenewlist. (b) DirectoryWindow Thisdisplaysallthefilesmatchingthedirectoryline maskandcanbescrolledjustlikeaGEMDesktopwindow. Clickonanentryinthiswindowtocopyittothe selection lineordouble-clickanentrytoopenitfor editing.  Notethatifafolderisdisplayedinthiswindowits contentscanbedisplayedbyclickingit.Thishasthe sideeffectofupdatingthedirectorylinemask. (c) SelectionLine Thisdisplayseitherthelastfileyouopenedorthe fileyouhavejustselectedfromthedirectorywindow, andyoucaneditthislineifyouwishtochangethe name.Whentheselectionlinecontainsthefilenameyou want,clicktheOKbuttonorpresstheRETURNkey. Ifyouhaveselectedafilenamethatdoesnotexist, 1st Wordwillconfirmthatyouwishtoopenanewfile. Afteryouhaveselectedthefiletoopen,1stWordwill createaneditwindow,readthetextfromdiskintomemory anddisplaythestartofthedocumentintheeditwindow. Ifthefilehasa.DOCextensionorifrulerandpagination dataareheldinthetext,thefileisopenedinWPmode. Otherwiseitisopenedinnon-WPmode. 5.2 Print... Usethiscommandtoprintadocumentfileafteryouhave savedittodisk.Youcanonlyprintafileifthereareno editwindowsopen,otherwise1st Wordwillissueanerror prompt. ThePrintcommandwilluseeithertheinstalleddotmatrix printerdriverortheinstalleddaisywheelprinterdriver, dependingonthestatusoftheInstallPrintermenu.(See AppendixAfordetailsofprinterdriverinstallation.) WhenyouprintadocumentthePRINTFILEformisdisplayed. Thisasksanumberofquestions: *startandendpagenumbers, *pagenumberoffsettobeaddedtothepagenumbers generatedinthedocument, *leftmarginoffsettofurtherindentthedocumentat printtime(tocopewithsheetandtractorpaperfeeds), *swapleft&rightheadingsonalternatepages.Ifthis optionisselected,evennumberedpageswillhavethe leftandrighthandcomponentsoftheheadandfoot linesinterchanged, *printquality.Ifyouhaveinstalledandselecteda near-letterqualitydotmatrixprinterthendraftorNLQ printingisselectedbythisoption. Ifyouhaveinstalledandselectedadaisywheelprinter thenselectingNLQmodewillmaketheprinterpause wheneveritisaskedtoprintitalicorlighttext.The printerdriverwillpromptyoutochangedaisywheelsat eachstylechange. Whenprinting,1st Worddisplaysasmallwindowwhosetitle lineshowstheprintertype.Thiswindowdisplaysthename ofthefilebeingprintedandtheprintquality. Topauseprinting,holdthemousebuttondownuntilthe pointerappears.Torestartprintingclickinthewindow. Toabandonprintingclickintheclosebox. 5.3 Save  Thiscommandwillwritethecontentsofthecurrentedit windowtodiskwiththesamefilenameastheoriginalfile, afterfirstrenamingtheoriginalwitha.BAKextension.The editwindowisthenclosed. Ifthereisnotenoughspaceonthediskwhenyousavethe file,analertwillbedisplayedsayingthatthediskis full.Thefileisnotsaved,andyouhaveanopportunityto deletefilestomakespace,oryoucanchangedisksifyou wishandthensaveontoanotherdisk. 5.4 Saveas... Thiscommandpromptsforanewfilenameandthenwritesthe contentsofthecurrenteditwindowtodiskwiththefilename specified.Ifafilealreadyexistswiththesamenameit willberenamedwitha.BAKextension.Theeditwindowis thenclosed. 5.5 Layout... Thiscommanddisplaysaformthatallowsyoutospecifythe runningheadandfootlinesandpagelayoutforadocument: (a) HeadLCandR Thesefieldsspecifytheleftaligned,centeredand rightalignedcomponentsoftherunningheadlinethatis outputatthestartofeachpage. (b) FootLCandR Thesefieldsspecifytheleftaligned,centeredand rightalignedcomponentsoftherunningfootlinethatis outputattheendofeachpage. Notethatahashcharacter(#-ASCIIhexadecimal23)placed inanyofthesixheadorfootlinefieldswillbereplacedat printtimebythepagenumber. (c) Paperlength Totallengthofthepaperinlines(defaultvalue66). (d) TOFmargin Numberoflinesbetweentopofformandtheheadline excludingtheheadline(defaultvalue1). (e) Headmargin Numberoflinesbetweentheheadlineandfirsttextline includingtheheadline(defaultvalue3). (f) Footmargin Numberoflinesbetweenthelasttextlineandthe footlineincludingthefootline(defaultvalue3). (g) BOFmargin Numberoflinesfromthefootlinetothebottomofform, excludingthefootline(defaultvalue5). Values(c)through(g)canbemodifiedbyclickingthearrows asrequired.Thevaluesareusedtocalculate: (h) Lines/page Thisvalueisgivenbytheformula:h=c-(d+e)-(f+g) Alittleexperimentationwillbenecessaryforyourprinter. 5.6 Read... Thiscommandrequeststhenameofafiletobereadintothe currentdocument.Thetextisinsertedatthecurrentcursor position. 5.7 Write... Thiscommandwritesthecontentsofthecurrentmarkedblock (seechapter7)tothespecifiedfile.Allstylecommands arestrippedoutofthetext. 5.8 Delete... Usethiscommandtodeleteafilefromyourdiskifthereis insufficientroomtostoreyourdocument.Deleteinvokesthe GEMItemSelector(see5.1)tospecifythefiletodelete. Deleterepeatsdisplayingafileselectoruntilyouselect CANCEL,toallowseveralfilestobedeletedatonce. Notethatitissafetodeletetheoriginalversionofthe documentand/orthe.BAKversionprovidedyouarecertain thatyouhavenotlostanytextduringthecurrenteditand youSavethedocumentimmediatelyafterwards.  Alternatively,youcanalwaysSaveyourfiletoanotherdisk. 5.9 Quit Thiscommandhastwofunctions: (a) AbandonEdit IfQuitisusedwhenyouareeditingadocument,the currenteditisabandoned(retainingtheoriginal versionofthedocument)andtheeditwindowisclosed. (b) Quitfrom1stWord IfQuitisusedwhennodocumentsarebeingeditedor printed,1st Wordwillterminateandreturncontrolto theGEMDesktop. Notethatyoucanalsoquitadocumenteditbyclickingthe windowclosebox. 6 EDITMENU Menuentriesendingwith"..."requireadialogue,othersare actionedimmediately.TheWPmodeandInsertmodeentries willbechecked(ticked)whenenabled. 6.1 WPMode ThiscommandswitchesWPmodeonandoff. WP modeisdesignedforwordprocesseddocumentssuchas lettersorreports.SwitchWP modeontotell1st Wordto storetherulerline,paginationdataandstylechangesin yourdocument. Non-WPmodeisdesignedforprogramsourcesanddatafiles. SwitchWP modeoffforprogramsourceordatafiles,only ASCIIdataisstoredinthefile. 6.2 InsertMode Thiscommandswitchesinsertmodeonandoff. Insertmodedetermineswhethernewtextbeingenteredatthe cursorpositionisinsertedoroverwritesanyexistingtext. Notethatattheendofalineordocument,overwritemode doesallowtexttobe'inserted'.Notealsothattheaction oftheTABandRETURNkeysinoverwritemodeisoneofcursor movementonly. 6.3 Find... Thiscommandisusedtosearchforaspecifiedtextstringin yourdocument.Aformisdisplayedaskingyoutospecify: * Stringtext, * Directionofsearch(forwardorbackward), * Casematchingduringstringcomparison. Findwillsearchforthefirstoccurranceofthespecified string.Ifthestringisfound,thecursorwillbeplaced eitheronthefirstcharacterofthestring(backwardsearch) oronthecharacterimmediatelyafterthestring(forward search).  Ifthestringisnotfound,thecursorwillbeplacedatthe startorendofdocumentdependingonthesearchdirection. 6.4 Replace... Thiscommandisusedtosearchforaspecifiedtextstringin yourdocumentandreplaceitwithasecondstring.Aformis displayedaskingyoutospecify: * Searchstringtext, * Replacementstringtext, * Directionofsearch(forwardorbackward), * Casematchingduringstringcomparison. * Scopeofsearch(replaceone,someorallmatches) Ifyouhavespecifiedreplacementofoneorallmatches, Replacewillsearchandreplaceautomatically,withoutuser intervention. Ifyouhavespecifiedreplacementofsomematches,Replace willfindanddisplayeachmatchandaskyouwhetherornot toreplacethestringorcancelthesearch. Ifthesearchstringisnotfound,thecursorwillbeplaced atthestartorendofdocumentdependingonthesearch direction. 6.5 Repeatfind ThiscommandwillrepeatthelastperformedFindorReplace operation,usingthesameparametersasdefinedinthe originalcommand. IftheFindorReplacecommandterminatedatthestartorend ofthedocumentthenthesearchdirectionisautomatically reversedfortheRepeatoperation. 6.6 Setmark Usethiscommandtosetorredefineoneofthefourposition markersanywhereinyourdocument.Themarkerpositionis definedbythecurrentcursorposition.  6.7 Gotomark Usethiscommandtomovethecursortooneofthepreviously definedpositionmarkers. 7 BLOCKMENU Thesecommandscreateandmanipulatetextblocksusedincut andpasteoperations.Thesearevariablelengthtext strings,highlightedbyastippledbackground(monochrome monitor)orfluorescentyellowbackground(colormonitor). Eachdocumentopeninawindowmayhaveoneandonlyone blockdefinedatanytimeanddefiningasecondblockwill causethefirsttobehidden.Althoughblockstartandend positionsmustbewithinthewindowwhentheyaredefined, 1st Wordwillremembertheblockpositionwhenitisscrolled offthescreen. TheBlockmenucommandsgiveyoutheflexibilitytocreate irregularshapedblocksbydefiningthestartandend positionsinseparateoperations.Amoreconvenientmethod fordefiningregularshapedblocksistousearubber band asfollows: *Tomarkasectionofasinglelineasablock,pointthe mouseatthefirstcharacteranddragithorizontallyto thefinalcharacter,thenreleasethebutton. *Tomarktwoormorecompletelinesasablock,pointthe mouseatanypositioninthefirstlineanddragitto anypositioninthefinalline,thenreleasethebutton. (Itisnotnecessarytoenclosethelinesintherubber band.) Blocksdefinedinthiswaycanhavetheirstartandend positionsmodifiedbytheBlock startandBlock endcommands. 7.1 Startblock Usethiscommandtodefineorredefinetheblockstart positionatthecurrentcursorposition. 7.2 Endblock Usethiscommandtodefineorredefinetheblockendata positionimmediatelyprecedingthecurrentcursorposition. Blockstartandendpositionscanbedefinedinanyorder, butthestartpositionmustplacedbeforetheendpositionin thedocument,orthecommandisignored. Whenavalidblockisdefined,theblockbackgroundisdrawn inandwillremainuntiltheblockishiddenordeletedora Reformatcommandisactioned.  7.3 Cutblock Usethiscommandtocopythecontentsofthemarkedblockin thecurrentwindowexcludingstylecommandstothecutand pastebuffer.Theblockinthewindowremainsmarked.The textinthebuffercanlaterbepastedtoanypositionin oneoftheopendocumentwindows. 1st Wordmaintainsasinglecutandpastebuffer.Youwill bewarnedwhenyouattempttocutablockintothebufferif thecurrentbuffercontentshavenotbeenpastedtoawindow. NotethatCopyblockandMoveblockalsousethecutand pastebufferandwillchangeitscontents. 7.4 Pasteblock Usethiscommandtoinsertacopyofthecutandpastebuffer tothecursorpositioninthecurrentwindow.Thetextin thebufferremainsintact,soyoucanpasteittomorethan onepositionordocument. 7.5 Copyblock Usethiscommandtoinsertcopiesofthemarkedblocktothe currentcursorpositionwithinthesamewindowandthecut andpastebuffer. Themarkedblockremainsunaffected,butthecopiedtexthas allstylechangesremoved. 7.6 Moveblock  Usethiscommandtoinsertcopiesofthemarkedblocktothe currentcursorpositionwithinthesamewindowandthecut andpastebuffer. Themarkedblockisdeletedandthecopiedtexthasallstyle changesremoved. 7.7 Deleteblock Usethiscommandtodeletethecontentsofthemarkedblock. Thecontentsofthecutandpastebufferareunaffected. 7.8 Findstart Thiscommandmovesthecursortothestartofthemarked block.Thecontentsofthecutandpastebufferare unaffected. 7.9 Findend Thiscommandmovesthecursortotheendofthemarkedblock. Thecontentsofthecutandpastebufferareunaffected. 7.10 Hideblock Thiscommandremovestheblockmarkersandthestippledor coloredbackgroundfromthemarkedblock.Thecontentsof thecutandpastebufferareunaffected. 8 STYLEMENU TheStylemenuisusedtodeterminethecharacterstyleand textformattingparameters.Allstylecommandsareactioned immediately. 8.1 Bold Usethiscommandtoselectorturnoffboldfacecharacters beforeyoutypeandbeforeaRestylecommand.TheF1icon displayisinverted. ThiscommandhasanidenticaleffecttotheuseoftheF1key oricon. 8.2 Underline Usethiscommandtoselectorturnoffunderlinedtextbefore youtypeandbeforeaRestylecommand.TheF2icondisplay isinverted. ThiscommandhasanidenticaleffecttotheuseoftheF2key oricon. Notethatunlikemostwordprocessors,1st Wordcorrectly underlineswholeparagraphs,bothonscreenandinthe printedoutput,includingstretchedspacesbutexcludingthe paragraphindent!  8.3 Italic Usethiscommandtoselectorturnoffitaliccharacters beforeyoutypeandbeforeaRestylecommand.TheF3icon displayisinverted. ThiscommandhasthesameeffectasusingtheF3keyoricon. Becausethefinalitaliccharacterinastringoverlapsthe nextcharacterpositionitisagoodideatofinishanitalic stringwithanitalicspace.Thisitalictrailingspace ensurescorrectscreendisplayofitalictext. 8.4 Light  Usethiscommandtoselectorturnofflightcharacters beforeyoutypeandbeforeaRestylecommand.TheF4icon displayisinverted. ThiscommandhasthesameeffectasusingtheF4keyoricon. 8.5 Super Usethiscommandtoselectorturnoffsuperscriptcharacters beforeyoutypeandbeforeaRestylecommand. 8.6 Subscript Usethiscommandtoselectorturnoffsubscriptcharacters beforeyoutypeandbeforeaRestylecommand. 8.7 Restyle Otherthandeletionandretyping,thiscommandistheonly methodprovidedby1st Wordtochangetextstyle. Convertthestringyouwishtorestyleintoamarkedblock usingarubberbandortheStartblockandEndblockcommands describedinChapter7.Nextselectthestylecombination youwantusingthefunctionkeys,functionkeyiconsorthe Stylemenu.FinallyclicktheRestylemenuentrytocomplete theoperation. 8.8 Justify Usethiscommandtotell1st Wordwhethertoleftjustifyor rightjustifyyourparagraphs.IfJustifyisswitchedon, themenuentryischecked(ticked)andparagraphswillbe rightjustified. 8.9 Wordwrap Usethiscommandtotell1st Wordwhethertowrapwordsonto thenextlinewhenyouexceedtherightmargin.IfWordwrap isswitchedon,themenuentryischecked(ticked)andwords arewrappedattheendofline,otherwisetherightmarginis releasedandyoucancontinuetypingonthesamelineuntil youpressRETURNorreachthe160characterlimit. 8.10 Spacing Usethiscommandtotell1st Wordwhethertousesingleor doublelinespacing.IfSpacingisswitchedon,themenu entryischecked(ticked)andlinesaredouble-spacedwhen youtypeorreformatparagraphs.Thedefaultconditionhas Spacingswitchedoffandsinglelinespacing. 8.11 Center Usethiscommand(ortheF8keyoricon)tocentertheline containingthecursorbetweenthemarginswithequalspacing ontheleftandright. 8.12 Indent Usethiscommand(ortheF9keyoricon)toindentyourtext byoneormoretabstopsforthedurationofaparagraph. Thetabpositionsaretakenfromtherulerline.  Atthestartofeachparagraph,Indenttotherequired positionthensimplytypethetext.Whenwordwraptakes place1st Wordwillautomaticallyindentthenextline.When youpressRETURNattheendoftheparagraph,theindentis cancelled. 1st Wordremembersindentvalues,soyouwillnotneedto respecifythemwhenreformattingafteratextchange. Ifyouwanttochangetheindentvalue,movethecursorto thestartofparagraph,theneitherdeletetheindent(be careful,onlyonekeystrokeisrequired)oraddtothe indentvalueandReformattheparagraph. Theindentneednotbeplacedatthestartofalineandyou canevenhavemorethanoneindentinthesameline. 1st Wordwillalwaysalignsubsequentlinesonthefinal indentdetected.(Section2.16containsdetailsofusing indentstocreatethemostcommonlyusedparagraphstyles.) 8.13 Reformat Alwaysusethiscommand(ortheF10keyoricon)toreformat aparagraphifyou: * changethetextbydeletionorinsertion, * changetheindentvalueorstyle, * changethejustificationmode, * changetherightmargin. Youwillnotneedtoreformatifyouhaveonlychangedthe textstyle. 9 HELPMENU Thehelpmenuisprovidedtogiveyoubriefnotesonprogram operationwhileyouarestilllearning1st Word.AllHelp functionsgenerateahelpwindowandyoumustclickOKto removethem. 9.1 Extrahelp Ifyouselectthisoption,1st Wordwillgenerateahelp windowwheneveryouuseamenufunction.Thehelpwindow informsyouwhatthecommandwilldoandgivesyoutheoption ofproceeding(clickOK)orcancelling(clickCANCEL). Thisfeatureisrecommendedforyourinitialsessionswith 1st Word. 9.2 OtherHelpScreens Theremaininghelpscreensprovidegeneralinformationabout thoseaspectsof1st Wordoperationnotfullycoveredbythe Extrahelpmenus. A PRINTERDRIVERS Thischaptertellsyouhowtocreateandinstallprinter driversfor1stWord. Installingaprinterdriverisacomplexoperationrequiring greatattentiontodetailandadegreeoftrialanderror. However,thismethodprovidesthegreatestpossible flexibility,andyoucanbesurethatthedriveryouproduce willmatchyourprinterexactly. Thetemplatepatchfilessuppliedfordotanddaisywheel printershavetheircodesdefinedinhexadecimal.Youshould ensurethatalistofyourprinter'scontrolcodefunctions inhexadecimalisavailable,beforeattemptingtoinstalla specialprinter. A.1 StandardPrinterDrivers 1st Wordissuppliedwithpatchtemplatesforthesestandard printerdrivers: * ASCIIonlydrivertodriveanyprinter, *EpsonLX-80,EpsonRX-80andAtariSMM804dotmatrix printerdrivers, *QumeSprintseriesandBrotherHR-15/25series daisywheelprinterdrivers. Onthe1st Worddisksupplied,theinstalleddotmatrix driver(1ST_PRNT.DOT)isconfiguredforASCIIoperationand theinstalleddaisywheeldriver(1ST_PRNT.DSY)isconfigured forQumeoperation. Evenifyouhaveoneofthestandardprinters,itmaybe necessarytomodifytheprinterconfigurationfile.For example,ifyouuseanon-standardpaperlength(1st Word assumes11inchpaper),itmaybenecessarytoincludea commandintheprinterverticalinitializationsequenceto makeformfeedsworkproperlywithatractorfeedinstalled. A.2 CreatingaNewPrinterDriver Thefolder\PRINTER\containsthesourcesofthepatchfiles forthestandardprinters(theseareheavilycommentedand shouldbeself-explanatory): ASCII.HEX ASCII-onlyprinter BRO_HR15.HEXBrotherHR-15/25daisy EPS_LX80.HEX EpsonLX80NLQmatrix EPS_RX80.HEX EpsonRX/FX-80matrix QUME .HEX QumeSprintdaisy SMM804.HEXAtariSMM804matrix Use1st Wordtoeditthefileclosesttothespecificationof thetargetprinter,thenuseSaveastogivethenewfilea uniquenamewitha.HEXextension. LinesintheHEXfilestartingwithanasterisk(*)are comments.Forexample,therearesomecommented-outentries intheEpsonRX-80fileforcommandssupportedbytheFX-80, removetheasteriskstoinstallthesefeatures. A.3 InstallingaNewPrinterDriver Toinstallanewprinterdriver,selectthe\PRINTER\folder andruntheprogramINSTALL.PRGwhichdisplaystheGEMItem Selector.Selectyournew.HEXfile. INSTALL.PRGwillreadyourfileandcreateeither 1ST_PRNT.DOTor1ST_PRNT.DSY(dependingonwhetheryouare creatingadotmatrixordaisywheeldriver). Havingcreatedyournewdriver,youmustcopythenew.DOTor .DSYfiletothe1st Wordrootdirectory(aftersavingthe currentversionifrequired).Ifyouareusingasingle-disk systemyoumustalsocopythisontoyourdatadisk(s)as definedin1.5. B 1STWORDDATAFORMAT AppendixBisprovidedforprogrammerswhointendtoprocess the1st Wordtextfilesforinputtoothercomputer applications(suchasspellingcheckers,typesettingfront- endsystems,databasesorelectronicmailsystems). GSTreservestherighttoenhanceandupdatethisdataformat withoutnotice,thoughwewillattempttousethoseareas definedas"reservedforexpansion"whereverpossible. Companiesintendingtoproducecommercialsoftwareproducts basedon1st WorddataformatsareurgedtocontactGST directlyfornewsofpotentialupdatestothedataformat. Nochargewillbemadeforreasonableuseofthisservice. Pleasecontact: GSTSoftware TheGreen Willingham  CAMBRIDGE CB45JA England B.1 CharacterSet 1st WordusesthefullSTstandard256-codecharactersetas showninthefonttableonthe1st Worddesktop.Ofthese,a numberofthecontrolcodesintherange00to20hexadecimal areusedforspecialpurposes. Enhancementsto1st Wordwillalmostcertainlyusemorecodes inthisrange,andprogrammersarerecommendedtoregardthe entirecontrolcoderangeasreservedforexpansion. Theremainingcodesintherange21toFFhexadecimalare definedtobeprintingcharacterswithnospecialsemantics. 1st Wordwillemployidenticalcoderangesformultiplefonts whentheseareimplemented. B.2 ControlCodes  Regardthisentirerangeasreserved: Code Display Data Function  00 Null:reserved 01  02  03  04  05  06  07  08  09 Tab:reserved 0A Linefeed 0B 1 Conditionalpagebreak 0C Formfeed 0D Carriagereturn 0E  0F  10  11  12  13  14  15  16  17  18  19  1A 1B 1 Stylechange 1C Stretchspace 1D Indentspace 1E Variablespace 1F N Formatline 20 Fixedspace Notes: (1)Thenumberofdatabytesthatfolloweachcontrolcode isshowninthe"Data"column. (2)Formatlinescontainrulerandlayoutdata.Ignoreall datauntilendofline. 0660103030566 9[....................................................]  THISISTHESECONDATEMPTTO CREATEAFILE8/11/1991 Thisisadditionalwritingtotheabovemadeonthesameday  e installed dot matrix driver (1ST_PRNT.DOT) is configured for ASCII operation and the installed daisywheel driver (1ST_PRNT.DSY) is configured for Qume operation. Even if you have one of the standard printers, it may be necessary to modify the printer configuration file. For example, if you use a non-standard paper length (1st Word assumes 11 inch paper), it may be necessary to include a command in the printer vertical initialization sequence to make formfeeds work properly with a tractor feed installed. A.2 Creating a New Printer Driver The folder \PRINTER\ contains the sources of the patch files for the standard printers (these are heavily commented and should be self-explanatory): ASCII .HEX ASCII-only printer BRO_HR15.HEX Brother HR-15/25 daisy EPS_LX80.HEX Epson LX80 NLQ matrix EPS_RX80.HEX Epson RX/FX-80 m0660103030549 9[......................................]   THISDOCUMENTSHOWSOURINCOMEFROMTHE PENSIONSCHEMESWHICHWECONTRIBUTEDTO:- MYPENSIONPAIDFROMAPRUDENTIALASSURANCE Co.ANNUITYINTOTHEROYALBANKOFSCOTLAND ACCOUNTNo12004637ISASFOLLOWS:-  (a)149.66ANNUITYNo195723POLICYNo 12450298PAYABLEMONTHLY  (b)39.85ANNUITYNo195722POLICYNo 13059225PAYABLEMONTHLY  (c)39.36ANNUITYNo196763POLICYNo 50096071PAYABLETWICEYEARLY ALLTHEABOVEPAYMENTSCOMMENCEDJANUARY 1991&AREGUARANTEEDFORTENYEARSFROM THATDATE REFERANCE PRUDENTIALASSURANCECo.Ltd.FORBURYHOUSE 18-20THEFORBURYREADINGRG13ES   MAY'SPENSION ISPAIDINTOHALIFAXBUILDINGSOCIETY'SBANK (BARCLAYSBANKALTRINCHAM)&THENINTOTHE 90DAYACCOUNTROLLNo2/16016atrix QUME .HEX Qume Sprint daisy SMM804 .HEX Atari SMM804 matrix Use 1st Word to edit the file closest to the specification of the target printer, then use Save as to give the new file a unique name with a .HEX extension. Lines in the HEX file starting with an asterisk (*) are comments. For example, there are some commented-out entries in the Epson RX-80 file for commands supported by the FX-80, remove the asterisks to install these features. A.3 Installing a New Printer Driver To install a new printer driver, select the \PRINTER\ folder and run the program INSTALL.PRG which displays the GEM Item Selector. Select your new .HEX file. INSTALL.PRG will read your file and create either 1ST_PRNT.DOT or 1ST_PRNT.DSY (depending on whether you are creating a dot matrix or daisywheel driver). Having created your new driver, you must copy the new .DOT or .DSY file to the 1st Word root directory (after saving the current version if required). If you are using a single-disk system you must also copy this onto your data disk(s) as defined in 1.5. B 1ST WORD DATA FORMAT Appendix B is provided for programmers who intend to process the 1st Word text files for input to other computer applications (such as spelling checkers, typesetting front- end systems, databases or electronic mail systems). GST reserves the right to enhance and update this data format without notice, though we will attempt to use those areas defined as "reserved for expansion" wherever possible. Companies intending to produce commercial software products based on 1st Word data formats are urged to contact GST directly for news of potential updates to the data format. No charge will be made for reasonable use of this service. Pl02029-2 THEAMOUNTIS295.87PAYABLEEACHMONTHTHE FIRSTPAYMENTWASONTHE27thJUNE1991& PAYMENTISGUARANTEEDFORTENYEARS REFERANCE MEDICALINSURANCEAGENCYLtd.PLYMOUTHHOUSE 166PLYMOUTHGROVEMANCHESTERM130AH tel.0612735354 MARINE&GENERALMUTUALLIFEASSURANCE SOCIETYMGMHOUSEHEENEROADWORTHINGWEST SUSSEXBN112DY REFGPC/5580/0000513/00002  0660103030567 9[......................................................]  THEFOLLOWINGAREAMOUNTSOFSAVINGSINTHEVARIOUSACCOUNTS ON09/11/91  1NORWICHUNION...........................20,OOO  2TESSA(ROYALBANKOFSCOTLAND)..........3,800  3SAVINGCERTIFICATES.....................3,00O  4HALIFAX90DAYACCOUNT..................1,093 TOTAL...................................28,410    THENORWICHUNIONCAPITALPLANWASPURCHASEDINTWOPARTS,THE FIRSTPARTFORSUMOF15,000YIELDEDATOTALOF13.125.12UNITS.  TODATETHENUMBEROFUNITSFROMTHEADDITIONAL5,000ISNOT KNOWN  INORDERTOASCERTAINTHECURRENTVALUEOFTHEPLANITIS NECESSARYTOREFERTOTHEINSURANCE&PROPERYBONDSECTIONOFTHE DAILYTELEGRAPHORFINANCIALTIMES,THELOWEROFTHETWOFIGURES SHOWNAGAINSTTHE"WITHPROFITSFUND"ISMULTIPLIEDBYTHENUMBER OFUNITS E.G.THELASTFIGURENOTEDFROMACOPYOFTHEF.T.(INCOPPICE AVENUELIBRARY)WAS116.77 THEREFORETHEVALUEONTHATDAYWAS15,326.202ie13125.12*1.1677  NORWICHUNIONWITHPROFITSFUND DATEF.T.No.BIDPRICEOFFERPRICE+OR-FUND 16/11/9131,160117.10123.27+.0415,369.52           0       TEFTNo.BIDPRICEOFFERPRICE+OR-FUND 16/11/9131,160117.10123.27+0.0415,369.52 ease contact: GST Software The Green Willingham CAMBRIDGE CB4 5JA England B.1 Character Set 1st Word uses the full ST standard 256-code character set as shown in the font table on the 1st Word desktop. Of these, a number of the control codes in the range 00 to 20 hexadecimal are used for special purposes. Enhancements to 1st Word will almost certainly use more codes in this range, and programmers are recommended to regard the entire control code range as reserved for expansion. The remaining codes in the range 21 to FF hexadecimal are defined to be printing characters with no special semantics. 1st Word will employ identical code ranges for multiple fonts when these are implemented. B.2 Control Codes Regard this entire range as reserved: Code Display Data Function 00 Null: reserved 01  02  03  04  05  06  07  08  09 Tab: reserved 0A Line feed 0B 1 Conditional page break 0C Form feed 0D Carriage return 0E  0F  10  11  12  13  14  15  16  17  18  19  1A 1B 1 Style change 1C Stretch space 1D Indent space 1E Variable space 1F N Format line 20 Fixed space Notes: (1) The number of data bytes that follow each control code is shown in the "Data" column. (2) Format lines contain ruler and layout data. Ignore all data until end of line. SINTHEVARIOUSACCOUNTS ON09/11/91  1NORWICHUNION...........................20,OOO  2TESSA(ROYALBANKOFSCOTLAND)..........3,800  3SAVINGCERTIFICATES.....................3,00O  4HALIFAX90DAYACCOUNT..................1,093 TOTAL...................................28,410    THENORWICHUNIONCAPITALPLANWASPURCHASEDINTWOPARTS,THE FIRSTPARTFORSUMOF15,000YIELDEDATOTALOF13125.12UNITS.  TODATETHENUMBEROFUNITSFROMTHEADDITIONAL5,000ISNOT KNOWN  INORDERTOASCERTAINTHECURRENTVALUEOFTHEPLANITIS NECESSARYTOREFERTOTHEINSURANCE&PROPERYBONDSECTIONOFTHE DAILYTELEGRAPHORFINANCIALTIMES,THELOWEROFTHETWOFIGURES SHOWNAGAINSTTHE"WITHPROFITSFUND"ISMULTIPLIEDBYTHENUMBER OFUNITS E.G.THELASTFIGURENOTEDFROMACOPYOFTHEF.T.(INCOPPICE AVENUELIBRARY)WAS116.77 THEREFORETHEVALUEONTHATDAYWAS15,326.202ie13125.12*1.1677  ONTHE4/12/91WERECEIVEDNOTICEOFTHENUMBEROFUNITS ALLOCATEDFOROUR5,000.INVESTMENTTHISAMOUNTEDTO4316.62UNITS ONTHELASTBIDPRICENOTED(SEEBELOW)THISFUNDAMOUNTSTO 5,054.76THETOTALNUMBEROFUNITSNOWOWNEDIS17441.74  NORWICHUNIONWITHPROFITSFUND DATEF.T.No.BIDPRICEOFFERPRICE+OR-FUND 16/11/9131,160117.10123.27+.0415,369.52           0       0660103030566 9[....................................................]  isprintingcommencesonthetoplineofthescreenandwiththe papersetslightlyabovethebailerrollers Thedistancetheprintingstartsfromthetopofthepaperis aboutinches(measure) Callthisdocument1 Thistimethepaperisinthepositionresultingfromcarryingout theinstructionsonpage18ofthemanualtotestwhetherthe paperhasgonebacktowhereitleftoff Callthisdocument2 Indocument1theprintingis1.5"fromtop Indocument2theprintingis2.5"fromtop Thisdocument3theprintingisfromtop ThistimeinstructionsforTopofformpage26ofthemanualhave beencarriedoutpapersetasindoc.1 Document4 Document5  0       0660103030566 9[....................................................] Thisprintingcommencesonthetoplineofthescreenandwiththe papersetslightlyabovethebailerrollers Thedistancetheprintingstartsfromthetopofthepaperis aboutinches(measure) Callthisdocument1 Thistimethepaperisinthepositionresultingfromcarryingout theinstructionsonpage18ofthemanualtotestwhetherthe paperhasgonebacktowhereitleftoff Callthisdocument2 Indocument1theprintingis1.5"fromtop Indocument2theprintingis2.5"fromtop Thisdocument3theprintingisfromtop ThistimeinstructionsforTopofformpage26ofthemanualhave beencarriedoutpapersetasindoc.1 Document4 0660103030567 9[......................................................]           0