30 ?30 @30 A42 B42 C42 D42 E36 F36 G42 H42 I24 J30 K42 L36 M42 N42 O42 P36 Q42 R42 S36 T42 U42 V42 W42 X42 Y42 Z36 [30 \30 ]30 ^30 _30 `30 a30 b36 c30 d36 e30 f24 g36 h36 i18 j18 k36 l18 m42 n36 o30 p36 q36 r30 s30 t24 u36 v36 w42 x36 y36 z30 {30 |30 }30 ~30 42 36 30 30 30 30 30 30 30 30 30 18 18 18 42 42 36 42 42 30 30 30 36 36 36 42 42 30 30 30 42 30 30 18 30 36 36 42 30 30 30 30 30 30 30 30 42 42 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 36 36 36 42 36 36 30 42 42 42 30 30 42 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 20 30 30 42 36 42 36 36 36 36 36 18 42 36 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 6343 6343 6343 6343 8782 6343 6343 6343 5042 6668 6343 5042 4716 2440 4716 3690 2114 5367 5204 5042 2 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 87V6STABOUTUSINGMAINMENUTOPICSCOMMANDMENUCLIGENERALMENUSTOREDMENUUUSUNDRYlMISCELLANEOUSlTEXTDISK"FILE"PRINTING((BACKGROUNDn,BACKn,MACROS0EXECFILES0EXTERNAL5PROGRAM5DICTIONARY$7LEX$7QICP<P<FILENAMES=NAMES=DRIVER+BPPD+BPATHDDMENUS GMENU GBLOCKSKBLOCKKLANGUAGESBOBOLIFEZPZPARNORPPPROTEXTQQQQBUGSQBUGQSTOREDvSvSRULER(V(VMESSAGE>Y>YLAYOUT\\PAGE]]CONTROLffVARIABLESNiNiMAILMERGE~kMAIL~kCLEARnnDOCoPROGoEXT6s6sLOADuLuMERGEuMuNAMEvNvPRINTFvPFvPRINTFBxPFBxSAVEAySAySAVEALLhzSALhzSAVEAB{SAB{SAVE{S{SAVEBH}SBH}SPLIT}SPL}SPOOL~SPON~SPOOLOFFHSPOFFHSWAPSWTYPEATAPRINTPPRINTBPBPRINTPOPPOPRINTPQPPQPRINTPS~PPS~PRINTSPSPRINTSBPSBPRINTQXPQXPRINTQB'PQB'ABANDON|AB|PARALLEL1PAR1PRINTERPRSERIAL؊SER؊PRINTONPRONPRINTOFF2PROFF2TYPEWRITERTWABCύύDECATFDIRFCHDIRېCDېMKDIRhMDhRMDIR͒RD͒ERASEZDELZACCESSACCPROTECTPROTRENAMERENCOPY~UPDATE~UP]]FINDREPLACEFINDBFBREPLACEBRBF R FIXFIXBFORMATuFTuFORMATB2FTB2NUMBERNUMNUMBERB,NUMB,TABANAGRAMͥANͥBUILD$BU$COUNTDרCODרDELWORDSDWFINDWΪFWΪINSWORDSIWLISTDLDLOOKUPLKMAKEDMKDSPELLSCSPELLB5SCB5CODEggEXEC-X-EXECSXSLMACROSZLMZMACRO!KEY!CALCCACOUNT*CT*COUNTBCTBGOTOHELPHLOADCFGMLCFGMPAUSEQUITKQKSTATUSSTATCONFIGIICONVERTCVFSORT+SORTING+CONTsCOsSTOPSTCLEARKEYSCLRKLOADKEYSLDKSAVEKEYSSVKFF ECHOWWSYMBOLSYMINK\\TOUCH__LINKWINDOWRWINRSHOWSHINDEXIXKEYDEFDESKTOP ACC STYLESTOKENSGRAPHICSEEINDEXINGPRINTERSPRINTERUPGRADING11README LATEST `ABOUT`USING` ABOUT : How to use Help The main help menu, which is called up by pressing F1 or from the File menu, provides access to all the help information. Some of the options such as 'General help topics', 'Command line help' and 'Help about stored commands' will bring up a further menu of help subjects. 'Command line help' includes general information which relates equally to using the menus as well as the command line. Each screen of help information is displayed in a window which may be scrolled up and down using the cursor keys. Sometimes words are highlighted in bold or a different colour. This means that you can click on the word to get help on that subject. Pressing  will move back to the previous help screen. Pressing CTRL- will move straight back to the opening help menu. More detailed help on each command, including the command syntax and any abbreviations, is available, either by selecting the 'Named subject...' option from the Help Menu and entering the command name, or by entering HELP at the command prompt. This gives the syntax of the command and, in brackets, the abbreviated form of the command if any. In many cases, examples and additional information are given as well. If you are still unable to find the help you require, the manual provides full details on all aspects of the program. `MAINMENU`` *TOPICS `TOPICS`` # Help main menu USING How to use help EDITING Editing keys GENERALMENU General help topics ... COMMANDMENU Command line help ... STOREDMENU Help about stored commands ... PRINTERS Notes about specific printers UPGRADING Upgrading notes README Latest information about this version ? Help on named subject `COMMANDMENU`CLI` # Command mode help TEXT Text handling commands FILE File handling commands NAMES Using file names BLOCK Block operation commands PRINTING Printing commands BACK Controlling background printing PPD Printer drivers MACROS Macros and EXEC files DICTIONARY Dictionary commands QIC Details of the quick dictionary `GENERALMENU`` # General help topics MENUS How to use menus DIALOGS How to use dialogue boxes INDEXING Index and contents GRAPHICS Graphics import STYLES Styles TOKENS Key tokens `STOREDMENU`` # Stored command help STORED About stored commands RULER Ruler lines LAYOUT Paper layout PAGE Page formatting CONTROL Printer control MAIL Mail merging VARIABLES Variable and data input MESSAGE Messaging and miscellaneous `SUNDRY`MISCELLANEOUS` SUNDRY : Miscellaneous command mode commands STATUS (STAT) : lists useful settings in current configuration file. LOADCFG (LCFG) : loads a new configuration file. CONFIG (CFG) : allows changes to current or other configuration file. SYMBOL (SYM) : changes the appearance of a character on screen. TIME : sets system time. DATE : sets system date. INK : changes the colours. Alternatively use CONTROL.ACC. CONFIG determines how colours are used. SPOOL (SPON) : echo all command mode screen output to a file. Turn off with SPOOLOFF. PRINTON (PRON) : echo all command mode screen output to printer. Turn off with PRINTOFF QUIT (Q) : ends the Protext run. CALC (CA) : calculates simple expressions. HELP (H) : gives information on specified subjects and individual commands - e.g.: BLOCK, TEXT, FILE, NAMES, PRINT, BACKGROUND, MACROS, MENUS, PPD. `TEXT`` TEXT : Text handling from command mode. SWAP (SW) : switches between the two documents in memory. CLEAR : clears text from memory. FORMAT (FT) : re-formats entire text according to configuration, rulers and stored commands. FIX : fixes text, so that it cannot be further re-formatted. COUNT (CT) : counts the words in the text. GOTO (G) : enters edit mode with cursor on specified row, page or column. FIND (F) : searches for any string (any sequence of letters or symbols). REPLACE (R) : replaces any string by another. PROG : selects program editing/printing mode. DOC restores document mode. TAB : sets tab positions in PROG mode. NUMBER (NUM) : numbers lines of text, or removes numbers. Other HELP subjects: FILE, PRINT, BLOCK, SPELL, FIND `DISK`FILE` LOAD (L) : retrieves a document from disk ready for editing. MERGE (M) : merges the text from a file into the current document. SAVE (S) : stores the edited document in a disk file. SAVEA (SA) : creates an ASCII file. (works as a PRINT command). SAVEALL (SAL) : saves all named files. Unnamed files are autosaved. CONVERT (CV) : converts text files to and from other programs and computers. FSORT : sorts files. For options type: FSORT ? SPLIT (SPL) : splits a large text file into smaller ones. TYPE (T) : types the contents of a file to screen. CAT or DIR : lists the files in the current or another directory. CHDIR (CD) : changes the current directory. A,B,C,D,E change current drive. MKDIR (MD) : creates a new directory. RMDIR (RD) : removes a directory if it is empty. ERASE (DEL) : erases file(s) in a directory on disk. PROTECT (PROT) : protect file(s) from being erased. Cancelled with ACCESS. RENAME (REN) : renames file on disk (NAME assigns filename to text in memory) COPY : copies file(s) regardless of date & time. UPDATE (UP) : copies new files only. Compare with COPY. TOUCH : 'touches' file so that date stamp is set to current date & time Other HELP subjects: NAMES, BLOCK, DICTIONARY, MACROS, PRINT, SUNDRY, SPELL See the MSDOS manual. `PRINTING`` PRINT : Protext print commands PRINT (P) : prints the whole text, PRINTB prints the marked block. PRINTQ (PQ) : prints in Near Letter Quality. PRINTP (PP) : prints selected pages. ( PRINTPQ = PRINTP + PRINTQ ). STOP (ST) : stops background printing. CONT resumes it again. ABANDON (AB) : aborts printing (on certain printers immediately). TYPEWRITER (TW): allows the computer to be used as a typewriter. FF : causes the printer to feed to the top of the next page. PRINTS (PS) : displays the text on the screen as it would be printed. PRINTF (PF) : prints to a file, that later can be 'dumped' to printer. SAVEA (SA) : prints to an ASCII file. SERIAL (SER) : selects a serial printer. PARALLEL (PAR) : selects a parallel printer. PRINTER (PR) : loads a printer driver. Also try BACKGROUND, BLOCK, PPD. `BACKGROUND`BACK` BACKGROUND : Background printing When printing, Protext sends the output not directly to the printer, but to a buffer in memory. From there it is passed on to the printer as fast as the printer can print it. BACK ON : turns background printing facility on. BACK OFF : turns background printing facility off. Without the need to wait for the printer, Protext can quickly work through the text, and after that make itself available for editing or other tasks. The so called 'background printing' that will be going on in the background can be controlled with various commands: STOP (ST) : temporarily stop printing. CONT (CO) : resume printing halted with STOP command. ABANDON (AB) : erase contents of buffer, and, in addition, cause certain printers to immediately abandon the printing. (The printer has to be able to recognize and give priority to a special abort command capable of making it erase its own built in buffer). `MACROS`EXECFILES` Commands for EXEC FILES and MACROS EXEC (X) : executes a file of commands. EXECS (XS) : executes a string of commands given with EXECS. ECHO : turns on/off echoing to screen of commands in an executed exec file. PAUSE : pauses execution until key is pressed. LMACROS (LM) : lists defined macros. SAVEKEYS (SVK) : saves macros. LOADKEYS (LDK) : loads macros. CLEARKEYS(CLRK) : erases user defined macros and restores the default ones. CLEARKEYS N : erases all macros. MACRO (KEY) : allows definitions of macros. CODE : displays the function/character codes that each key produces. Escape characters: Use | in exec files and ^ in macros Escape characters are used around numbers that are to be interpreted as codes. e.g. ^766^FIND^13^ - causes the program to enter command mode, then to type the letters 'FIND' and conclude with a carriage return. `EXTERNAL`PROGRAM` EXTERNAL : Execute external commands and programs from within Protext Other programs can be run from within Protext if there is enough free memory. Simply type the program name as if it were a Protext command. If the name of the program clashes with a real Protext command, it can be prefixed with an asterisk (*) to indicate that the Protext command is not to be used. Three of Protext's own commands - CONFIG, CONVERT and FSORT - are in fact separate programs, and can also be run as such. `DICTIONARY`LEX` Dictionary Commands : Spell checking is carried out against several (up to five) dictionary files simultaneously. These dictionaries (LEX files) are in a compressed format and a number of commands are provided to allow editing/modification/searching of these dictionaries. NB: Not all commands may be used with all LEX files for copyright reasons. SPELL (SC) : spell checks and allows correction of words not recognised. BUILD (BU) : spell checks but sends unrecognised words to disk file. LISTD (LD) : lists the words in a LEX file (optionally to a file). MAKED (MKD) : makes a new LEX file from the words in a text file. INSWORDS (IW) : inserts words in text file into LEX file. DELWORDS (DW) : deletes words in text file from LEX file. COUNTD (COD) : counts the words in a LEX file. LOOKUP (LK) : searches a LEX file for all words similar to specified word. FINDW (FW) : searches for all words matching a specified pattern. ANAGRAM (AN) : searches for all words containing certain specified letters. CONFIG is used to specify which LEX files are to be used. Other HELP subjects: QIC LANGUAGES `QIC`` The quick dictionary, or QIC file, is a special dictionary file, containing some of the most commonly used words. It is loaded into memory in its entirety, in contrast to the ordinary dictionary files (the LEX files) from which just an index is loaded and which Protext then has to call from disk each time they are needed for checking. Other HELP subjects: LEX `FILENAMES`NAMES` When entering a file name to a command, a drive and/or directory can be specified as well, if required. This applies to all commands requiring file names. The filename extension can in most cases be left out, when entering file names for commands which only operate on files of a certain type. For instance it is sufficient to type 'PRINTER epson' to load the printer driver EPSON.PPD, since printer drivers always end with '.PPD' anyway. There is no standard extension to distinguish text files, but the command EXT (or CONFIG) may be used to specify a default extension to be used when text is loaded (with LOAD and MERGE). Some commands can handle so called 'ambiguous file names', i.e. names containing 'wildcards'. A question mark (?) stands for a character that could be anything - except a full stop - or nothing. An asterisk (*) is equivalent to any number of '?'. E.g.: PROT test?? - protects all files named 'test' + up to two more characters. DEL *.* - erases all files in the current directory. `DRIVER`PPD` All output sent by Protext to a printer is done according to rules set up in a printer driver (PPD file). The currently loaded printer driver is always displayed on the banner line. A new printer driver can be loaded, using the PRINTER command. A certain printer driver can be made the default driver using CONFIG. (optionally, one driver for each port on the computer if several printers have been connected). The PPD files can be edited as ordinary text files. Details on the various instructions found in these files are given in the manual. Compare the commands PRINTER, PARALLEL and SERIAL. `PATH`` The 'path', or 'search path' specifies the directory in which Protext looks for auxiliary files and programs. Examples of files that Protext tries to find here are dictionaries, printer drivers, the help file, macro files, exec files and external utilities (CONFIG and CONVERT). It will normally refer to a directory called 'PROTEXT'. The path can be changed using CONFIG. The 'temporary file path' specifies the directory which Protext uses for storing parts of a file which is too large to fit entirely into memory. The temporary path can be changed using CONFIG. `MENUS`MENU` Menus are provided as an alternative to command mode. Commands can be selected from menus in two ways, either using the mouse or the keyboard. To use the menus with the mouse first click the right mouse button. This will cause the menu bar to be displayed. Then move the mouse pointer over the menu bar. As the pointer moves over each menu title that menu will be displayed. To select a menu option move the pointer over the required line of the menu, which will then be highlighted. Click the left mouse button to perform the operation. To use the menus with the keyboard first press the menu key (F3), use the left and right cursor keys to select a menu and then the up and down cursor keys to select a menu line. Press RETURN to perform the operation. Some menu items are shown fainter than the rest and cannot be highlighted. These options are unavailable in the current context - for example block operations when no block is defined. Some menu items are marked with ''. This means that when selected another 'submenu' will be called up. The descriptions in the menus include the equivalent keyboard commands. In these '^' means press the CTRL key, 's' means SHIFT, 'a' means 'ALT'. `BLOCKS`BLOCK` Most of those commands that in various ways operate on the loaded text, are available as block versions as well, which only operate on the section of text that has been marked with the block markers. There is no need to learn these specifically, since they all have the same name as the main command with just a 'B' appended. For example, COUNT counts all the words in the document. COUNTB just the words between the block markers. The following commands are available as block versions: SAVE, SAVEA, SAVEALL, PRINTF, PRINTS, PRINT, PRINTQ,  SPELL, FIND, REPLACE, FORMAT, FIX, COUNT, NUMBER. Block markers are set in edit mode by placing the cursor at the required position and pressing CTRL-Z or by 'clicking and dragging' the mouse. `LANGUAGES`` Spell checking dictionaries are available in several different languages. At April 1991 the languages available are: English French German Swedish American Contact Arnor to order extra languages (see HELP ARNOR). `LIFE`` Can't help you with that one! `ARNOR`` See "The Lord of the Rings" by J.R.R. Tolkien. Alternatively, write to: Arnor 611 Lincoln Road PETERBOROUGH PE1 3HA England Tel: +44 (733) 68909 Fax: +44 (733) 67299 `PROTEXT`` Almost everything you might wish to know is covered in the manual. For the latest information see the file 'README'. `BUGS`BUG` If you think you have found a bug in Protext, please write to Arnor giving as full a description of what you were doing when it occurred. Please quote the Protext version as displayed on the banner line, and please also give details of your computer and operating system, for example: Protext v6.00 Atari STe with 1Mb memory and TOS version 1.4 Type 'HELP ARNOR' for the address. `STORED`` Stored commands are lines within a document that are not printed but provide instructions for Protext when printing. These lines are marked by the stored command prefix character, > ('greater than symbol' or 'chevron'). This character must be typed in the first column on a line. If column one contains '>', and columns two and three each contain one of: space, 'L', '-', or '!' then the line is a ruler line. See HELP RULER. For summaries of the stored commands see the following help subjects: LAYOUT, PAGE, MESSAGE, CONTROL, VARIABLES, MAILMERGE, For a full explanation of abbreviations used see the Reference Manual `RULER` A ruler line is a special stored command line which defines margins and tabs. The stored command prefix > must be in column 1. Other characters which may be used in a ruler line are: L marks the left margin (omitted if left margin is column 1) R marks the right margin ! a tab position . a decimal tab C a centre tab - none of the above (space may also be used) The ruler may be edited directly as it is simply part of the text. Alternatively the mouse may be used on the status line ruler (shown at the top of the screen). Double clicking at a position on the ruler cycles through the various types of tabs. The left and right margins may be dragged in either direction. `MESSAGE`` Messaging and miscellaneous stored commands >CO text Comment line. >CS text Clear screen and display message. >DM text Display message. >EX (?)text Execute command. >GC f Generate contents. >GI f Generate index. >IB (?)f (sz) Insert binary file and copy directly to output. >IG f Import graphic image. >IN f Insert file. >SC ON/OFF Spell checking on/off. >SL n {f} Define spell language and dictionaries. >ST text Stop printing and display text. >TL a Define tab leader character. >WT text Wait and display text. `LAYOUT`` Paper layout commands # >BM sz Bottom margin. >EM sz Even side margin. # >FM sz Footer margin. # >HM sz Header margin. >OM sz Odd side margin. # >PL sz Page length. >SM sz Side margin. # >TM sz Top margin. # >ZM Zero margins. All parameters are may be in inches or cm. The commands marked '#' take effect at the next new page printed. `PAGE`` Page formatting commands >BL ON/OFF Blank line suppression. >CE text Centre line. # >CP ON/OFF Continuous/Single sheet printing. >DE Dump endnotes at foot of page. >EA nn End at page no. >EC End column. # >EF text Define even footer text and turn footers on. # >EH text Define even header text and turn headers on. >EN ON/OFF Turn use of endnotes instead of footnotes on/off. >EP (sz) Even page throw (can be conditional). >FE End footnote definition. >FC ON/OFF Continuous footnote numbering. # >FF ON/OFF Form feeds enabled/disabled. >FN Start multi-line footnote definition. >FN text Define single line footnote. # >FO text Define footer text and turn footers on. # >FO ON/OFF Turn footers on/off. >FP ON/OFF Formatting whilst printing on/off. >FX ON/OFF Fix text (will not be reformatted during reformatting). # >HE text Define header text and turn headers on. # >HE ON/OFF Turn headers on/off. >HY ON/OFF Hyphenation on/off. >HY n Hyphenation factor. >IP ON/OFF Inter-paragraph space increased by half a line on/off. # >LF ON/OFF Turns last page footer on/off. >LS n Line spacing. >NC n Number of copies. >NP ON/OFF Enable/disable new page at end of printing. # >OF text Define odd footer text and turn footers on. # >OH text Define odd header text and turn headers on. >OP (sz) Odd page throw (can be conditional). >PA (sz) Page throw (can be conditional). >PC n (n) Print columns. # >PE ON/OFF Print even pages only. # >PN nn Page number of next page. # >PO ON/OFF Print odd pages only. >PS ON/OFF Paper sensing on/off. >RJ ON/OFF Right justifying on/off. >SA nn Start at page no. >WO ON/OFF Widow and orphan elimination. The commands marked '#' take effect at the next new page printed. `CONTROL`` Printer control commands >AS ON/OFF Auto-spacing on/off. >CC a {n} (;a{n}) Define printer control code. >LA ON/OFF Landscape printing on/off. >MP ON/OFF Multiple copy printing on/off. >MS ON/OFF Microspacing on/off. >OC n {n} Output codes to printer. >PP ON/OFF Proportional printing on/off. >PQ ON/OFF Proper quotes on/off. >PR f Load printer driver. >RC a {n} Redefine character. >US (=)a Use style. >US $ Use no style. `VARIABLES`` Variable and data input - mail merging >AV v {v} Ask for variables. >CF Close data file. >DC ,|. Set the decimal character. >DF f {f} Define data file. >DP n|R Set number of decimal places or Roman numerals. >DU Dumps currently defined variables to screen. >RL v {v} Read lines. >RU v {v} Read variables unconditionally. >RV v {v} Read variables and pad with nulls. >SV v=expr Set variables. `MAILMERGE`MAIL` Conditional printing and mail merging >EI End of ID, IE, IF or IU block. >EL Else - print block if previous IF condition false. >ID v Print block if variable defined. >IE Print block if data file exhausted. >IF cond Print block if condition true. >IU v Print block if variable undefined. >RP Repeat - until following UN condition is true. >SK cond Skip printing if condition true. >UN cond Until condition is true - repeat from RP command. >WC Write file close. >WF f (A) Open file for writing (appending). >WF ON/OFF Writing to file on/off. >WM text Write message to file - used with WF. `CLEAR`` CLEAR Clears text from memory. Syntax: CLEAR Clears currently viewed text. Syntax: CLEAR ALL Clears all text in memory. Syntax: CLEAR [] ... Clears text n1, n2 from memory `DOC`PROG` PROG Selects program text editing and printing. The effect on printing is that stored commands will be printed instead of acted upon. The effect on editing is that formatting commands are disabled. Ruler lines are not active but tabs can be set as required, using the TAB command. Auto indent mode can be toggled on/off with the editing command, SHIFT-CTRL-I. DOC Selects document editing/printing. All formatting effects, stored commands and printer control codes are acted on. Syntax: PROG DOC When text is loaded, Protext automatically selects DOC or PROG mode according to the name extension of the loaded file. (e.g. the extensions associated with which kind of file, is user selectable with CONFIG. If the name extension does not match any of those specified, the default mode specified in CONFIG is used. `EXT`` EXT Determines default name extension for text files. When the LOAD and MERGE commands search for text files to load, they will begin trying to find the literal name they have been given, but should they not find a file with this name and no filename extension was given, they make a second attempt, using the extension specified by EXT. Syntax: EXT Example: EXT DOC `LOAD`L` LOAD (L) Loads new file from disk for editing. Syntax: LOAD Compare MERGE, EXT and SAVE. `MERGE`M` MERGE (M) Merges file into the current text. Syntax: MERGE Compare LOAD and EXT. `NAME`N` NAME (N) Assigns a file name to current text. Syntax: NAME Compare SAVE and RENAME. `PRINTF`PF` PRINTF (PF) Prints to disk, including printer control codes. The resulting file can later be printed without help from Protext, with any function capable of 'dumping' the file to the printer. Syntax: PF () Examples: PF text1 ; prints current text to file 'text1' PF text1 text ; prints from file 'text' to file 'text1' Also available as Block version PRINTFB. `PRINTFB`PFB` PRINTFB (PFB) Prints block to disk, including printer control codes. Syntax: PFB Compare PRINTF. `SAVEA`SA` SAVEA (SA) Creates ASCII file. Works like a print command, with >ZM implicitly defined at the start. All printer control codes etc... are stripped out. Syntax: SA () Also available as block version SAVEAB. Compare CONVERT. `SAVEALL`SAL` SAVEALL (SAL) saves all files currently loaded. Named files will be saved under their current name. Unnamed ones will be saved under their autosave name. Syntax: SAL Compare SAVE, SHOW, QUIT, AUTOSAVE `SAVEAB`SAB` SAVEAB (SAB) Prints marked block to disk as ASCII file. Syntax: SAB Compare SAVEA. `SAVE`S` SAVE (S) Saves current text onto disk in a file with specified name. If the file name is omitted the text is saved under original file name, or under name given with NAME. Syntax: S Compare LOAD & MERGE. Also available as block version SAVEB. `SAVEB`SB` SAVEB (SB) Saves block. Syntax: SB `SPLIT`SPL` SPLIT (SPL) Splits large file. Maximum size of the smaller files may be specified. The files will have the same name with extensions 1, 2, 3,.. Syntax: SPLIT () `SPOOL`SPON` SPOOL (SPON) Echoes all command mode screen messages to file. Turn off with SPOOLOFF. Syntax: SPOOL Compare PRINTON. `SPOOLOFF`SPOFF` SPOOLOF (SPOFF) Turns off SPOOL. Turn on with SPOOL Syntax: SPOFF `SWAP`SW` SWAP (SW) Swaps between documents in memory. If used on its own, switches between the current and alternate document. If used with a number in range 1-36, switches to that document. If used with 0, switches to the first available empty document. Syntax: SW () `TYPE`T` TYPE (T) Types the file to screen. Syntax: TYPE Compare PRINTS `PRINT`P` PRINT (P) Sends text to printer, optionally from disk. The number of copies may be specified. Syntax: P () () Also as block version PRINTB. To printer : PRINTQ, PRINTP, PRINTPQ. To screen : PRINTS, PRINTPS. To file : PRINTF, SAVEA. `PRINTB`PB` PRINTB (PB) Prints defined text block. Syntax: PB `PRINTP`PP` PRINTP (PP) Prints pages selectively, optionally from disk. Syntax: PP () () Compare PRINTPQ and PRINTPS `PRINTPQ`PPQ` PRINTPQ (PPQ) Prints pages selectively in NLQ, optionally from disk. Syntax: PPQ () () `PRINTPS`PPS` PRINTPS (PPS) Prints pages to screen selectively, optionally from disk. Syntax: PPS () () `PRINTS`PS` PRINTS (PS) Prints to screen, optionally from disk. Pressing ESC causes printing to be stopped. Repeated pressing of ESC aborts printing, but any other key continues it. The Scroll Lock key is used to toggle a Scroll lock mode, so that printing automatically is stopped after each screen full. Syntax: PS () Also as block version PRINTSB Selected pages with PRINTPS `PRINTSB`PSB` PRINTSB (PSB) Prints block to screen. Syntax: PSB `PRINTQ`PQ` PRINTQ (PQ) Prints in Near Letter Quality, optionally from disk. Syntax: PQ () () Also as block version PRINTQB Selected Pages with PRINTPQ `PRINTQB`PQB` PRINTQB (PQB) Prints block in Near Letter Quality. Syntax: PQB `ABANDON`AB` ABANDON (AB) Abandon printing. Empties print buffer and causes certain printers to empty their own buffer. Syntax: AB Compare STOP `PARALLEL`PAR` PARALLEL (PAR) Selects parallel (Centronics) port and loads associated printer driver if any. Syntax: PAR Compare SERIAL and PRINTER. `PRINTER`PR` PRINTER (PR) Loads printer driver. The driver is loaded from current directory or, if not found, from the default search path. Syntax: PR Compare PARALLEL and SERIAL. `SERIAL`SER` SERIAL (SER) Selects the serial port and loads the associated printer driver. Syntax: SER Compare PARALLEL and PRINTER. `PRINTON`PRON` PRINTON (PRON) Echoes all command mode screen output to printer. Turn off with PRINTOFF. Syntax: PRON Compare SPOOL. `PRINTOFF`PROFF` PRINTOFF (PROFF) Turns off PRINTON. Syntax: PROFF `TYPEWRITER`TW` TYPEWRITER (TW) Typewriter mode. If a number is specified the text of each line is indented by that many spaces. Text is not printed until the Return key is pressed to indicate the end of the line. Syntax: TW (number) `A`` Select drive A. Syntax: A `B`` Select drive B. Syntax: B `C`` Select drive C. Syntax: C `D`` Select drive D. Syntax: D `E`` Select drive E. Syntax: E `CAT`DIR` CAT Catalogues files in (current) directory and reports free space on disk. The sizes of files are shown in K. Files protected with PROTECT are shown with asterisks. Syntax: CAT (pathname) Examples: CAT ; current directory on current drive. CAT B:\ ; root directory on drive B. CAT \PROTEXT\*.PPD ; all printer drivers in PROTEXT directory. DIR As CAT but with the following differences: The sizes of files are shown in bytes. The date and time when each file was last changed is shown. Syntax: DIR (pathname) `CHDIR`CD` CHDIR (CD) Changes current directory. Syntax: CD Examples: CD .. ; changes to parent directory above the current one. CD letter ; changes to directory 'LETTER' under the current one. CD \ok ; changes to directory 'OK' which is off the root directory CD \ ; changes to the root directory. `MKDIR`MD` MKDIR (MD) Creates new directory. Syntax: MD (pathname) Compare RMDIR. `RMDIR`RD` RMDIR (RD) Removes a directory if it not contains any files. Syntax: RD (pathname) Compare DEL and MKDIR. `ERASE`DEL` ERASE (DEL) Erases file(s) from (current) directory. Syntax: DEL Examples: DEL letter ; erases file 'letter' in current directory. DEL \test\*.*; erases all files in directory 'test', off root directory `ACCESS`ACC` ACCESS (ACC) Cancels delete/overwrite protection set with PROTECT. Syntax: ACC `PROTECT`PROT` PROTECT (PROT) Protects file(s) from being deleted or overwritten by setting their status to read-only. Use ACCESS to cancel the protection. Syntax: PROT Compare ACCESS `RENAME`REN` RENAME (REN) Renames a file on disk. Syntax: REN Compare NAME. `COPY`UPDATE` COPY. Copies file(s) regardless of date. UPDATE (UP). Copies only file(s) newer than any like named files in target. Syntax: COPY () UP () can be: \ ; destination file(s) will be named as originals omitted ; file(s) will be copied to the current directory Compare TOUCH. `UP`` UP is the abbreviated form of UPDATE. See 'HELP UPDATE'. `FIND`REPLACE` FIND (F) Searches for text. Syntax: FIND also available as block version FINDB. REPLACE (R) Searches for and replaces text. Syntax: R also available as block version REPLACEB. Options:A Automatic search. Then displays number found. G Global search. (Starts from beginning of text). B Backward search. C Case specific search. S Spaces ignored. Text found regardless of number of spaces in it. W Search for complete Words only. n Search for every nth occurrence (ignore first n-1). Escape sequences may be used to search for certain special characters. SEQUENCE FINDS SEQUENCE FINDS !. hard return (end of paragraph) !! ! !- soft hyphen !? ? !_ non-break hyphen !' ' ! non-break space !" " !~ footnote marker !a printer code 'a' !| indent tab !$a style code 'a' != spell ignore marker !10 ascii code 10 !* index word marker !5!144 soft space code !# index phrase marker `FINDB`FB` FINDB (FB) Searches for text in marked block only. Otherwise as FIND. Search option G (Global) only implies searching the whole block, not the whole text. `REPLACEB`RB` REPLACEB (RB) Searches and replaces text in marked block only. Otherwise as REPLACE. Search option G (Global) only implies searching and replacing in the whole block, not in the whole text. `F`R` F and R are abbreviated forms of FIND and REPLACE respectively. See 'FIND' or 'REPLACE' for more information. `FIX`FIXB` FIX Removes tabs, soft spaces and soft returns, converting to hard spaces and hard returns. Syntax: FIX FIXB As for FIX, but on marked block. Syntax: FIXB `FORMAT`FT` FORMAT (FT) Formats whole text according to rulers, stored commands and CONFIG settings. Syntax: FT Also available as block version FORMATB. `FORMATB`FTB` FORMATB (FTB) Formats block. Syntax: FTB Compare FORMAT. `NUMBER`NUM` NUMBER (NUM) Numbers text lines, or removes line numbers from text. A to add numbers, R to remove numbers from text. Syntax: NUM A|R Examples: NUM A 10 10 ; numbers from 10 and increase by 10 per line: 10, 20, 30... NUM R ; remove numbers Also available as block version NUMBERB. `NUMBERB`NUMB` NUMBERB (NUMB) Numbers text lines (or removes line numbers) within marked block only. Syntax: NUMB A|R Compare NUMBER. `TAB`` TAB Sets tab positions for PROG mode. Syntax: TAB ( *) Examples: TAB 9,15,40 ; tabs at columns 9,15,40 TAB *4 ; tabs at columns 5,9,13,... `ANAGRAM`AN` ANAGRAM (AN) Searches for all words that contains specified characters regardless of their order. Syntax: AN () If is not provided, the main (first) dictionary specified in the current configuration will be searched. Compare FINDW. `BUILD`BU` BUILD (BU) Spell checks text file and writes all words not recognized to a text file. This word file may later - after any editing that might be required - be added to a dictionary file - see INSWORDS (or be used to make a new dictionary - See MAKED). Syntax: BUILD Compare SPELL, MAKED and INSWORDS `COUNTD`COD` COUNTD (COD) Counts words in dictionary. Syntax: COUNTD () If is not provided, the user dictionary specified in the current configuration will be used. `DELWORDS`DW` DELWORDS (DW) Removes words in text file from dictionary. Syntax: DW () If is not provided, the user dictionary specified in the current configuration will be used. Compare INSWORDS. `FINDW`FW` FINDW (FW) Searches for all words with given characters, in given order. ? - stands for any one character. * - stands for any number of any characters. Syntax: FW () If is not provided, the main (first) dictionary specified in the current configuration will be searched. Compare ANAGRAM. `INSWORDS`IW` INSWORDS (IW) Adds the words in text file to dictionary file. Syntax: IW () If is not provided, the user dictionary specified in the current configuration will be used. Compare DELWORDS, MAKED. `LISTD`LD` LISTD (LD) Lists dictionary file, optionally to a file. Syntax: LD ( ()) If is not provided, the user dictionary specified in the current configuration will be used. If is omitted, output will be to the screen. Compare MAKED. `LOOKUP`LK` LOOKUP (LK) Searches for similarly spelled words. Syntax: LK () If is not provided, the main (first) dictionary specified in the current configuration will be searched. `MAKED`MKD` MAKED (MKD) Makes a dictionary file that contains all words in text file. Syntax: MKD () If is omitted, a dictionary will be created with the same name as , but with the LEX extension. `SPELL`SC` SPELL (SC) Two pass spell check of text, optionally of file on disk. For each word not recognized, SPELL will stop and await action: V - View the word in its context. C - View the word in its context and possibly change it. L - Look up word in dictionary and find similarly spelled words. I - Ignore the word (leave it without action). B - Back to previously ignored word. S - Store word in dictionary. Syntax: SPELL () If is not provided, the file currently being edited is checked. If the file is too large to be checked from memory, an instruction to save the file and check it from file, is issued. Also available in block version SPELLB. Spell checking can also be done from edit mode with CTRL-S, CTRL-Q and SHIFT-CTRL-S Try also HELP subjects LEX, QIC and BUILD `SPELLB`SCB` SPELLB (SCB) Spell check a marked block in the file currently being edited. This command may only be used to check a block in the file being edited. It may not be used to check a block in a document on file. Syntax: SCB `CODE`` CODE Displays the code numbers returned by the key pressed. Both the Protext token number and the key number are displayed. Syntax: CODE `EXEC`X` EXEC (X) Executes a file of commands. Just type the commands in edit mode (in a new and empty file) as you would in command mode, and press return every time you normally would have had to do so to make the program act. Then save the file (with SAVE). After this you can at any time and repeatedly execute the sequence of commands with EXEC. If you want the Exec file to be able to execute editing commands, you can use the special escape character '|'. (This is not necessary for command mode commands) Example: |765||744| - enters edit mode and erases a marked block. Syntax: EXEC Other HELP-subjects: CODE, PAUSE, ECHO, MACRO, EXECS. `EXECS`XS` EXECS (XS) Executes a string of commands given with EXECS. Other HELP-subjects: CODE, PAUSE, ECHO, MACRO, EXEC. `LMACROS`LM` LMACROS (LM) Lists defined macros. All the currently defined macros are displayed, together with the key to which each is assigned. Syntax: LM `MACRO`KEY` MACRO (KEY) Defines macro. (This can alternatively be done with CTRL-F1). Syntax: KEY A ; assign macro to ALT+letter or KEY SA ; assign macro to SHIFT+ALT+letter or KEY ; assign macro to function key or KEY S ; assign macro to SHIFT+function key or KEY A ; assign macro to ALT+function key or KEY C ; assign macro to CTRL+function key ^ is 'escape character' and is used around numbers to be interpreted as code and not characters to be printed. For instance ^13^ produces a carriage return. The KEY files that are saved with the command SAVEKEYS are actually lists of KEY commands, and can be edited as ordinary text files. Other HELP subjects: MACROS, CODE, LMACROS `CALC`CA` CALC (CA) Calculates the value of a simple numeric expression. + - * / and parentheses can be used. When the result has been displayed, it can be inserted into the text as an integer (by pressing the space bar) or with required number of decimal places (by pressing the appropriate number key). Syntax: CALC `COUNT`CT` COUNT (CT) Counts words in text. Syntax: COUNT Also available as block version COUNTB. `COUNTB`CTB` COUNTB (CTB) Counts words in marked block. Syntax: COUNTB `GOTO`` GOTO (G) Enters edit mode with cursor on given Page/Row/Column. Syntax: GOTO or GOTO P or GOTO C `HELP`H` HELP (H) Displays Help information. Syntax: HELP or HELP Help on editing keys is provided within the menus. `LOADCFG`LCFG` LOADCFG (LCFG) Loads configuration file (CFG file). Syntax: LCFG Compare STATUS, CONFIG. `PAUSE`` PAUSE Pauses and waits for a key press. For use in EXEC files. Syntax: PAUSE (message) `QUIT`Q` QUIT (Q) Quits Protext. Syntax: Q Compare SAVEALL `STATUS`STAT` STATUS (STAT) Lists important settings in currently loaded configuration file. Syntax: STAT Compare LOADCFG and CONFIG. `CONFIG`` CONFIG (CFG) Menu driven configuration program. When you call this, it will automatically load the same configuration file that currently determines the various working parameters of Protext. If you make changes and then save this file under the same name, you will be able to observe these changes as soon as you return to Protext. Syntax: CFG Note: This is an external command, so the program must be available on disk and sufficient memory available to execute it. Compare STATUS and LOADCFG `CONVERT`CV` CONVERT (CV) File conversion program. Syntax: CV (outfile) ; converts infile according to conv-type CV ? ; gives help info on conversion types. CV ; Calls CONVERT menu. (simplest method) Note: This is an external command, so the program must be available on disk and sufficient memory available to execute it. Compare SAVEA. `FSORT`SORTING` FSORT File sorting program. Syntax: FSORT (outfile) ; sorts infile FSORT ? ; gives help info on sorting options. Note: This is an external command, so the program must be available on disk and sufficient memory available to execute it. `CONT`CO` CONT Resumes background printing after STOP. Syntax: CO `STOP`ST` STOP Stops printer but leaves text in printer buffer. Resume printing with CONT. Syntax: ST Compare ABANDON. `CLEARKEYS`CLRK` CLEARKEYS (CLRK) Removes all user defined macros and resets the supplied default macros. (Use LDK without any parameters to reset your own macros, as they were when you last saved them). CLEARKEYS N (CLRK N) Removes all macros. Use KEY command to remove a single macro. `LOADKEYS`LDK` LOADKEYS (LDK) Loads macro definitions from file. Existing definitions are left untouched if not redefined in the file. Syntax: LDK ; loads given macro file LDK ; reloads last macro file (resets after a mistake). Compare SAVEKEYS, CLEARKEYS `SAVEKEYS`SVK` SAVEKEYS (SVK) Saves macro definitions in a file. Syntax: SVK () Compare KEY, LOADKEYS. `FF`` FF Sends a Form Feed character to printer. Syntax: FF `ECHO`` ECHO Turns on or off echoing to screen of commands in an exec file. Syntax: ECHO OFF ECHO ON `SYMBOL`SYM` SYMBOL (SYM) Changes the appearance on screen of a character. Syntax: SYM ... ; for 8x8 characters SYM ... ; for 16x8 characters Each determines a pixel row value, this is eight pixels numbered from 7 down to 0 (counting left to right), the value is calculated as the sum of certain values for each filled pixel in the row: Pixel column: 7 6 5 4 3 2 1 0 Term to add : 128 64 32 16 8 4 2 1 E.g. 129 produces one dot in the start and one in the end of the row (128 + 1 = 129) `INK`` INK is used to determine the shade of colour for each of the colour numbers that the computer can show. The use of these colours may then be set up with CONFIG. Colour Syntax: INK no,&rgb ; sets given colour number (0-3) to a colour shade determined from the three numbers (0-7) 'r' 'g' and 'b'. Example: INK 2,&070 ; makes colour no 2 light green. INK 3 ; displays the current value of ink 3 Mono Syntax: INK 0,0 ; sets black on white on a monochrome monitor. INK 0,1 ; sets white on black on a monochrome monitor. As an alternative for mono monitors the colours can be set with CONFIG, which leaves the colours of the desktop unchanged. Alternatively CONTROL.ACC can be used, but the INK command (and CONFIG) has the advantage that all colour settings will be automatically restored upon exit from Protext. `TOUCH`` TOUCH 'Touches' a file so that it is set to current time and date. Syntax: TOUCH `LINK`` LINK Turns on or off linking of files in split screen mode. Syntax: LINK ON LINK OFF `WINDOW`WIN` WINDOW (WIN) Splits and unsplits screen and sets file window size. With no number this splits the screen equally or unsplits it. A number sets the size of the lower window, in lines. Syntax: WINDOW () see also : LINK. `SHOW`SH` SHOW (SH) Lists all files currently open showing file size and whether changed. `INDEX`IX` INDEX (IX) Generates index and table of contents without printing the file. Syntax: INDEX () `KEYDEF`` KEYDEF Redefines a key. The tokens set the following: the key unshifted, with SHIFT, with CTRL, with ALT, with NUM LOCK on, with CAPS LOCK on, with SHIFT and ALT, with SHIFT and CTRL. If less than 8 tokens are given only those shift states given are changed. Keys can also be defined using CONFIG. A question mark (?) can be used to leave any entries in the list of tokens unchanged. Syntax: KEYDEF Example: KEYDEF 25 ? ? 671 ? ? ? ? ? ; disable CTRL-P `DESKTOP`ACC` The auxiliary programs of the Desktop (The ACC files) can be accessed simply by pressing the left mouse button while the pointer is on the top status line. Draw a line SHIFT-CTRL  `STYLES`` Protext styles are provided to enable the use of different fonts in a document. Up to 26 styles (A to Z) may be defined. A style is a font name and point size (or characters per inch value for fixed pitch fonts). This may be modified by one or more control code letters, such as bold or underline. A style has a name (or description) which is displayed on the status line when the cursor is on a part of the document where that style is active. Styles may be defined and changed using the 'Create/edit style' option in the Style menu. `TOKENS`` Each key press and (from version 6) menu selection generates a token, which is a number between 0 and 2000. This tokens are shown in the macro or glossary editor when commands are used in a macro or glossary. Tokens are displayed as numbers contained within ^ symbols, for example ^521^ is the token which inserts a line. To understand the meaning of macros containing tokens you should consult the numerical list of tokens. This list was previously printed in the manual but is now supplied as the disk file TOKENS. `GRAPHICS`` Protext has the capability to read graphic files in various commonly used formats and to print the graphics in black and white at any point in a document. Graphics are not displayed on screen while editing a document. PCX, GIF, Amiga IFF and GEM IMG are supported. To import a graphic use the 'Import graphic' option in the Tools menu. This lets you select an image file and various options. A stored command line will be inserted into the text which will print the image and will also inform Protext of the size of the image when editing so page breaks will appear correctly. `INDEXING`` To index a document use the two types of index marker: Press ALT-W for an index word marker. Put this immediately before or after the word to be indexed. Press ALT-P for an index phrase marker. Put one before and another after the group of words to be indexed. The stored command '>GI' must be included. To create a table of contents use style codes or control codes to identify the headings. Up to three levels may be used. The stored command '>GC' must be included. The index and contents will be created when printing, or by using 'Generate index/contents' in the Tools menu. Further information and options available for index and contents generation are described in the User Manual. `PRINTERS`PRINTER` Notes about specific printers: Laser printers (general) For printers with two paper trays an option is provided to select the lower tray (the upper tray is selected by default). This makes use of the NLQ control code and so it may be convenient to keep headed paper for the final copy in the lower tray and draft paper in the upper tray. Canon BJ bubble jets On the BJ10e, DIP switch 10 should be set to ON for shading and inverse to work. On both BJ10e and BJ130e, the graphics image density DIP switch should be set to ON. Deskjet DJ500C This printer is capable of printing graphics in colour but not text, so colour selection is not possible in Protext. The DJ550C has full colour capability. Epson GQ lasers The printer should be set to 'page printer' emulation as this is assumed by the printer driver. Kyocera F series lasers Firmware version 6.37 or later may be needed to print the full range of characters and accents. The version number may be checked by printing a status report on the printer. Panasonic KXP1124 The Panasonic KXP1124 is not fully compatible with the Epson standard and so a special driver is provided. Some characters may not be printed in italics on this printer. The font and pitch settings on the front panel should be set to PGM, otherwise font changes within the text will have no effect. `UPGRADING`` A few keyboard commands have been changed since v5.5: Old New Indent tab ALT-TAB SHIFT-TAB Split screen SHIFT-CTRL-X SHIFT-CTRL-Z New page none CTRL-RETURN Line drawing ALT + arrows SHIFT-CTRL + arrows (ALT + arrows now moves the mouse pointer in the GEM fashion) Otherwise compatibility has been retained. Unsaved file warnings Various messages about unsaved files have been changed. When quitting Protext the message now given is "Save unsaved file (y/n)?". If Y is pressed the file will be saved and Protext will quit. This means that pressing Y now has the opposite effect to previous version. We apologise for any confusion this may cause initially, but believe that the new form is more useful and more consistent. Similar messages are used when loading a file, clearing a file or files and when quitting from Config. Upgrading from an earlier version: Please refer to the following pages in the manual (issue 8) for coverage of new features (U = User manual, R = Reference manual): ASCII save U70-71 Colour printing U123 Copy line at cursor R8 Document settings U82-88 Exclusion dictionary U140 Extended memory (XMS) U19,111,154 Glossary U151 Graphics import U152-154,R75-76 Headers and footers U86-88 Inches and cm U62,89,91-92,158 Landscape printing U83 Macro editor U149 Page break key U83 Printer installation U25 Proper quotes R82 Scalable fonts U126-128 Styles U126-130 User dictionary editor U140 Variable line spacing U127 `README`LATEST` Protext v6.0 latest information. Extra information not contained in the manual: SHIFT-CTRL-P This will change the units used on the status line and elsewhere, cycling through inches, cm and lines/columns. Document Settings: Loading The 'Load' button will load the previously saved document settings from the PROTEXT.SET file. To copy the document settings from one file to another, edit the first file and save the settings, then edit the second file and use 'Load'. Tabs The tabs are set in units of a tenth of an inch (unlike on the picture in the manual). Numbers may be followed by the tab type: . for decimal tab C for centre tab Example: 5 12C 20. 30. This sets a normal tab 0.5" from the left margin, a centre tab 1.2" in and decimal tabs at 2" and 3". Style files The 'save' button in the style editor saves a style file which is associated with the active printer driver (it has the same name with the '.STY' extension). Other style files may be created with any name and loaded and saved using the commands described here. Four commands are provided to control the use of styles: SAVESTYLES (SVS) - saves the currently defined styles (as shown in the style menu) in the file of the specified name (with extension '.STY'). LOADSTYLES (LDS) - loads styles from the specified style file, replacing those in the style menu and the current document. This completely replaces all styles, any not defined in the style file will be erased. RESTYLE (RES) - updates the styles in a document from those in the style file. The style file will be merged with existing document styles, replacing any with the same letters and leaving others alone. If no filename is given the active printer driver style file is used. STYLE - defines a style. Note that style definitions are stored in the style file in the form of STYLE commands. This command will not normally be needed as it is easier to defines styles with the style editor. Footnote style The style for footnotes can be set with the stored command >NS. This works in the same way as >US, which sets the style for the main text and is described in the reference manual, page 86. Contents generation A further option has been added to the >GC stored command. If two numbers are given the second number sets the position of the page number tab in the contents file ruler. Marking a word or line with the mouse CTRL-left button will mark the current line as a block. SHIFT-left button will mark the current word. In each case the cursor will be positioned at the end of the marked block so that a style or control code can be used to apply to the block. Printing & and ! It is now possible to print text containing & or ! symbols without giving an 'Unknown variable' error. A Config option ('Other options' menu) must be used to disable the error messages. If the name contained between & or ! symbols is not a defined variable it will be printed as is, including the &'s or !'s. Graphics import An extra option has been added to the dialogue, 'Use printer resolution'. If selected, the image will not be scaled - the size will be determined by the chosen resolution. A image scanned at 300 dpi and printed on a laser printer at 300 dpi will print the same size as the original. Choosing 150 dpi will double the size of the image without losing data. Atari only Line drawing Use SHIFT-CTRL + arrows for line drawing, not ALT 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 36 36 36 42 36 36 30 42 42 42 30 30 42 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 -----------------------------------------------------------------------------.#a000000 #b000000 #c7770007000600070055200505552220770557075055507703111103 #d #E DB 02 #W 00 00 0A 01 21 17 08 A:\*.*@ #W 00 00 0D 08 2A 0B 00 @ #W 00 00 0E 09 2A 0B 00 @ #W 00 00 0F 0A 2A 0B 00 @ #M 00 00 00 FF A FLOPPY DISK@ @ #M 00 01 00 FF B FLOPPY DISK@ @ #T 00 03 02 FF TRASH@ @ #F FF 04 @ *.*@ #D FF 01 @ *.*@ #G 03 FF *.APP@ @ #G 03 FF *.PRG@ @ #F 03 04 *.TOS@ @ #P 03 04 *.TTP@ @  REM HP DeskJet 550C REM ORIGIN=D:\APED\DJ.GPD 15-09-93 10:07 rem Mostly uses internal PC-8 character set rem Landscape only available for Courier and Letter Gothic rem Control Code definitions cc '@'="",+ 27,"E", 27,"&k5w0G", 27,"&l26a0l6d1e68F", 27,"(10U", 27,"(s1Q"+ 27,"*r-4U", 27,"*v1S",+ 27,"(s0p10h12v3T" cc 'b'=27,"(s3B" ; 27,"(s0B" cc 'm'=27,"&k0W" ; 27,"&k1W" ;; Mono directional cc 'i'=27,"(s1S" ; 27,"(s0S" cc 'q'=27,"(s2Q" ; 27,"(s1Q" cc 's'=27,"&a+0.25R" ; 27,"&a-0.25R" ;; subscript cc 't'=27,"&a-0.25R" ; 27,"&a+0.25R" ;; superscript IF VER6 ELSE cc 'u'=27,"&d0D" ; 27,"&d@" ENDIF rem Character redefinitions using PC-8 Symbol set rc ''=27,"&p1X",2 rc ''=27,"&p1X",3 rc ''=27,"&p1X",4 rc ''=27,"&p1X",5 rc ''=27,"&p1X",6 rc ' '=27,"&p1X",11 rc 12=13,12 ;; form feed rc ''=27,"&p1X",14 rc ''=27,"&p1X",15 rc ''=27,"&p1X",16 rc ''=27,"&p1X",17 rc ''=27,"&p1X",18 rc ''=27,"&p1X",19 rc ''=27,"&p1X",20 rc ''=27,"&p1X",21 rc ''=27,"&p1X",22 rc ''=27,"&p1X",23 rc ''=27,"&p1X",24 rc ''=27,"&p1X",25 rc ''=27,"&p1X",26 rc ''=27,"&p1X",27 rc ''=27,"&p1X",28 rc ''=27,"&p1X",29 rc ''=27,"&p1X",30 rc ''=27,"&p1X",31 rc '''=27,"(8U",39,27,"(10U" rc '`'=27,"(8U",96,27,"(10U" rem accented chars defined so as not to be split into letter and accent rc ''=128 rc ''=129 rc ''=130 rc ''=131 rc ''=132 rc ''=133 rc ''=134 rc ''=135 rc ''=136 rc ''=137 rc ''=138 rc ''=139 rc ''=140 rc ''=141 rc ''=142 rc ''=143 rc ''=144 rc ''=145 rc ''=146 rc ''=147 rc ''=148 rc ''=149 rc ''=150 rc ''=151 rc ''=152 rc ''=153 rc ''=154 rc ''=27,"(8U",214,27,"(10U" ;; o slash rc ''=156 rc ''=27,"(8U",210,27,"(10U" ;; O slash IF PC rc ''=158 ENDIF IF ST rc 158=27,"(8U",222,27,"(10U" ;; double s ENDIF rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 rc ''=27,"(8U",222,27,"(10U" rc ''=27,"(10U",175 rem Use some accented chars to give some symbols in ECMA Latin 1 etc rc ''=27,"(8U",245,27,"(10U" ;; 3/4 rc '_'=27,"(0N",169,27,"(10U" ;; copyright rc '_'=27,"(0N",174,27,"(10U" ;; registered IF VER5 rc ''=27,"(8U",227,27,"(10U" rc ''=27,"(8U",228,27,"(10U" rc ''=27,"(8U",240,27,"(10U" rc ''=27,"(8U",241,27,"(10U" rc ''=27,"(11U",158,27,"(10U" rc ''=27,"(11U",159,27,"(10U" ENDIF IF VER5 rem Char defs for extended letter+accent characters rc 'A'=27,"(8U",161,27,"(10U" rc 'A'=27,"(8U",162,27,"(10U" rc 'E'=27,"(8U",163,27,"(10U" rc 'E'=27,"(8U",165,27,"(10U" rc 'I'=27,"(8U",166,27,"(10U" rc 'I'=27,"(8U",167,27,"(10U" rc 'U'=27,"(8U",173,27,"(10U" rc 'U'=27,"(8U",174,27,"(10U" rc 'Y'=27,"(8U",177,27,"(10U" rc 'y'=27,"(8U",178,27,"(10U" rc 'O'=27,"(8U",223,27,"(10U" rc 'A'=27,"(8U",224,27,"(10U" rc 'A'=27,"(8U",225,27,"(10U" rc 'a'=27,"(8U",226,27,"(10U" rc 'I'=27,"(8U",229,27,"(10U" rc 'I'=27,"(8U",230,27,"(10U" rc 'O'=27,"(8U",231,27,"(10U" rc 'O'=27,"(8U",232,27,"(10U" rc 'O'=27,"(8U",233,27,"(10U" rc 'o'=27,"(8U",234,27,"(10U" rc 'S'=27,"(8U",235,27,"(10U" rc 's'=27,"(8U",236,27,"(10U" rc 'Y'=27,"(8U",238,27,"(10U" ENDIF IF VER5 acute ; 27,"(8U",8,168,27,"(10U" grave ; 27,"(8U",8,169,27,"(10U" circumflex ; 27,"(8U",8,170,27,"(10U" umlaut ; 27,"(8U",8,171,27,"(10U" tilde ; 27,"(8U",8,172,27,"(10U" macron ; 27,"(8U",8,176,27,"(10U" ring ; 27,"(8U",8,179,27,"(10U" cedilla ; 27,"(0N",8,184,27,"(10U" ascend 27,"*p-10Y" ; 27,"*p+10Y" ENDIF hl 27,"=" landscape 27,"&l1o1e47F" ; 27,"&l0o1E" style N "Courier 10cpi" "Courier" 12 10 style P "Courier 20cpi" "Courier" 12 20 style Q "CG Times 12" "CG Times" 12 PS style S "CG Times 6" "CG Times" 6 PS style X "Gothic 12cpi" "Letter Gothic" 12 12 style T "Univers 12" "Univers" 12 PS style U "Univers 10" "Univers" 10 PS style V "Univers 8" "Univers" 8 PS style R "CG Times 10" "CG Times" 10 PS style S "CG Times 8" "CG Times" 8 PS style W "Univers 14B" "Univers" 14 PS b vms 27,"*p+" ; "Y" vres 300 hres 300 scriptsize 50 ; need to resend enter code with diff point size omit peln as on mm 2 mf 1 pp on pq on ms on ff on double ;; no auto doubling regular mibuclqstuv end 27,"E" menu "Mono directional:^XM" M menuend red 27,"*v12S" green 27,"*v10S" blue 27,"*v6S" cyan 27,"*v2S" magenta 27,"*v4S" yellow 27,"*v8S" black 27,"*v1S" white 27,"*v0S" font 0 enter 27,"(s0p10h" ; "v3T" rules l="Cour 5cpi",c="Cour 17cpi" cw 30 point 12 6 pitch 10 font "Cour 10cpi" menufont "Courier" rules l="Cour 5cpi",c="Cour 17cpi" enter 27,"(s0p10h" ; "v3T" cw 30 point 12 6 pitch 10 font "Cour 5cpi" enter 27,"(s0p5h" ; "v3T" cw 60 point 12 6 pitch 5 font "Cour 17cpi" enter 27,"(s0p16.67h" ; "v3T" cw 18 point 12 6 pitch 16.67 font "Cour 20cpi" enter 27,"(s0p20h" ; "v3T" cw 15 point 12 6 pitch 20 font "LetGot 12cpi" menufont "Letter Gothic" rules l="LetGot 6cpi",c="LetGot 24cpi" enter 27,"(s0p12h" ; "v6T" cw 25 point 12 6 pitch 12 font "LetGot 6cpi" enter 27,"(s0p6h" ; "v6T" cw 50 point 12 6 pitch 6 font "LetGot 24cpi" enter 27,"(s0p24h" ; "v6T" cw 12 point 12 6 pitch 24 font "CGT Md" menufont "CG Times" rules ib="CGT BdIt",i="CGT It",b="CGT Bd" enter 27,"(s1p" ; "v0s0b4101T" point 12 5 6 7 8 10 12 14 rem scalable on formula "CP*0.000004724212891803778*SW +0.5",0 widths 2602 !2927 "4066 #4391 $4391 %7806 &6830 '2927 (2927 )2927 *4391 +7806 ,2927 -2927 .2927 /2927 04391 14391 24391 34391 44391 54391 64391 74391 84391 94391 :2927 ;2927 <8782 =7806 >8782 ?3903 @7806 A6343 B5529 C6017 D6505 E5529 F5204 G6343 H6505 I2927 J3415 K6180 L5529 M7969 N6505 O6343 P5042 Q6343 R5855 S4716 T5529 U6505 V6343 W8294 X6343 Y6343 Z5692 [2927 \2927 ]2927 ^4391 _4391 `2927 a3903 b4391 c3903 d4391 e3903 f2927 g4391 h4391 i2439 j2439 k4391 l2439 m6830 n4391 o4391 p4391 q4391 r3253 s3415 t2439 u4391 v4391 w6343 x4391 y4391 z3903 {3903 |4391 }3903 ~4391 6017 4391 3903 3903 3903 3903 3903 3903 3903 3903 3903 2439 2439 2439 6343 6343 5529 5855 7806 4391 4391 4391 4391 4391 4391 6343 6505 4391 4391 4391 7708 4391 3903 2439 4391 4391 4391 6505 4391 4391 3903 7806 7806 7806 7806 2927 3578 3578 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 5367 4391 5367 5367 5367 4391 4879 3903 5855 6343 5367 3903 8782 5367 3415 8782 8782 7806 8782 8782 6343 6343 7806 8782 4391 2927 0 6343 4391 3090 4391 8782 8782 8782 8782 8782 8782 6343 6343 8782 6343 6343 6343 4567 4391 4391 8782 6343 6343 6343 6343 6343 7806 6343 6343 6343 4391 6343 6505 4391 5529 2439 5529 2439 2439 4391 5042 4391 font "CGT Bd" enter 27,"(s1p" ; "v0s3b4101T" point 12 5 6 7 8 10 12 14 formula "CP*0.000004724212891803778*SW +0.5",0 copywidths "CGT Md" djbold font "CGT It" enter 27,"(s1p" ; "v1s0b4101T" point 12 5 6 7 8 10 12 14 rem scalable on ;; part scalable rem formula "CP*300/7231/8782*SW +0.5",0 formula "CP*0.000004724212891803778*SW +0.5",0 widths 2602 !2927 "4228 #4391 $4391 %7806 &6830 '2927 (2927 )2927 *4391 +7806 ,2927 -2927 .2927 /2927 04391 14391 24391 34391 44391 54391 64391 74391 84391 94391 :2927 ;2927 <8782 =7806 >8782 ?4391 @7806 A5367 B5367 C5855 D6343 E5367 F5042 G6343 H6343 I2927 J3903 K5855 L4879 M7318 N5855 O6343 P5367 Q6343 R5367 S4391 T4879 U6343 V5367 W7318 X5367 Y4879 Z4879 [2927 \2927 ]2927 ^4391 _4391 `2927 a4391 b4391 c3903 d4391 e3903 f2439 g4391 h4391 i2439 j2439 k3903 l2439 m6343 n4391 o4391 p4391 q4391 r3415 s3415 t2439 u4391 v3903 w5855 x3903 y3903 z3415 {3903 |4391 }3903 ~4391 5855 4391 3903 4391 4391 4391 4391 3903 3903 3903 3903 2439 2439 2439 5367 5367 5367 5855 7806 4391 4391 4391 4391 4391 3903 6343 6343 4391 4391 4391 7645 4391 4391 2439 4391 4391 4391 5855 4391 4391 4391 7806 7806 7806 7806 2927 4066 4066 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 5367 4391 5367 5367 5367 4391 4879 3903 5855 6343 5367 3903 8782 5367 3415 8782 8782 7806 8782 8782 6343 6343 7806 8782 4391 2927 0 6343 4391 3090 4391 8782 8782 8782 8782 8782 8782 6343 6343 8782 6343 6343 6343 4375 4391 4391 8782 6343 6343 6343 6343 6343 7806 6343 6343 6343 4391 6343 6343 4391 4879 2439 4879 2439 2439 4391 5367 4391 font "CGT BdIt" enter 27,"(s1p" ; "v1s3b4101T" point 12 5 6 7 8 10 12 14 formula "CP*0.000004724212891803778*SW +0.5",0 copywidths "CGT It" djbold font "Univers Md" menufont "Univers" rules b="Univers Bd",i="Univers It",ib="Univers BdIt" enter 27,"(s1p" ; "v0s0b52T" point 5 6 7 8 10 12 14 rem scalable on ; partial formula "CP*0.000004724212891803778*SW +0.5",0 widths 2927 !2927 "4391 #5529 $5529 %8782 &6668 '2927 (2927 )2927 *5529 +8782 ,2927 -2927 .2927 /2927 05529 15529 25529 35529 45529 55529 65529 75529 85529 95529 :2927 ;2927 <8782 =8782 >8782 ?4554 @8784 A6505 B5529 C6180 D6343 E5042 F4879 G6505 H6343 I2439 J4879 K5855 L4716 M7969 N6343 O6668 P5204 Q6830 R5692 S5692 T5529 U6343 V6343 W8782 X6343 Y6017 Z5367 [2927 \2927 ]2927 ^4391 _4391 `2927 a4716 b5042 c4716 d5042 e4716 f3253 g5042 h5042 i2114 j2114 k4716 l2114 m7644 n5042 o5042 p5042 q5042 r3090 s4391 t3253 u5042 v4879 w7644 x4879 y4879 z4228 {3904 |4391 }3904 ~8782 6180 5042 4716 4716 4716 4716 4716 4716 4716 4716 4716 2114 2114 2114 6505 6505 5042 7481 8619 5042 5042 5042 5042 5042 4879 6668 6343 5529 5529 5529 8457 5529 4716 2114 5042 5042 5042 6343 3578 3578 4554 8782 8782 8782 8782 2927 4879 4879 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 5042 5367 4879 5367 5367 5692 5204 4066 8132 6668 7156 5042 8782 6343 4391 8782 8782 8782 8782 8782 6343 6343 8782 8782 5529 2927 1076 6343 3415 3415 4391 8782 8782 8782 8782 8782 8782 6343 6343 8782 6343 6343 6343 4639 5529 5529 8782 6343 6343 6343 6343 6343 8782 6343 6343 6343 5042 6668 6343 5042 4716 2114 4716 3190 2114 5367 5204 5042 font "Univers Bd" enter 27,"(s1p" ; "v0s3b52T" point 6 7 8 10 12 14 formula "CP*0.000004724212891803778*SW +0.5",0 copywidths "Univers Md" djbold font "Univers It" enter 27,"(s1p" ; "v1s0b52T" point 5 6 10 12 formula "CP*0.000004724212891803778*SW +0.5",0 widths 2927 !2927 "4391 #5529 $5529 %8782 &6668 '2927 (2927 )2927 *5529 +8782 ,2927 -2927 .2927 /2927 05529 15529 25529 35529 45529 55529 65529 75529 85529 95529 :2927 ;2927 <8782 =8782 >8782 ?4554 @8783 A6505 B5529 C6180 D6343 E5042 F4879 G6505 H6343 I2439 J4879 K5855 L4716 M7969 N6343 O6668 P5204 Q6830 R5692 S5692 T5529 U6343 V6343 W8782 X6343 Y6017 Z5367 [2927 \2927 ]2927 ^4391 _4391 `2927 a4716 b5042 c4716 d5042 e4716 f3253 g5042 h5042 i2114 j2114 k4716 l2114 m7644 n5042 o5042 p5042 q5042 r3090 s4391 t3253 u5042 v4879 w7644 x4879 y4879 z4228 {3903 |4391 }3903 ~8782 6180 5042 4716 4716 4716 4716 4716 4716 4716 4716 4716 2114 2114 2114 6505 6505 5042 7481 8619 5042 5042 5042 5042 5042 4879 6668 6343 5529 5529 5529 8457 5529 4716 2114 5042 5042 5042 6343 3578 3578 4554 8782 8782 8782 8782 2927 4879 4879 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 5042 5367 4879 5367 5367 5692 5204 4066 8132 6668 7156 5042 8782 6343 4391 8782 8782 8782 8782 8782 6343 6343 8782 8782 5529 2927 651 6343 3416 3415 4391 8782 8782 8782 8782 8782 8782 6343 6343 8782 6343 6343 6343 4813 5530 5529 8782 6343 6343 6343 6343 6343 8782 6343 6343 6343 5042 6668 6343 5042 4716 2114 4716 2765 2114 5367 5204 5042 font "Univers BdIt" enter 27,"(s1p" ; "v1s3b52T" point 6 10 12 formula "CP*0.000004724212891803778*SW +0.5",0 copywidths "Univers It" djbold font "L Cour 10cpi" menufont "Landscape Courier" rules c="L Cour 17cpi" enter 27,"(s0p10h" ; "v3T" cw 30 point 12 6 24 pitch 10 font "L Cour 17cpi" enter 27,"(s0p16.67h" ; "v3T" cw 18 point 12 6 24 pitch 16.67 font "L Cour 20cpi" enter 27,"(s0p20h" ; "v3T" cw 15 point 12 6 24 pitch 20 font "L LetGot 12cpi" menufont "Landscape Gothic" rules c="L LetGot 17cpi" enter 27,"(s0p12h" ; "v6T" cw 25 point 12 6 24 pitch 12 font "L LetGot 17cpi" enter 27,"(s0p16.67h" ; "v6T" cw 18 point 12 6 24 pitch 16.67 font "L LetGot 24cpi" enter 27,"(s0p24h" ; "v6T" cw 12 point 12 6 24 pitch 24 REM 24 pin Epson compatible colour (new) REM ORIGIN=D:\PROTEXT\PPD\MATRIX.GPD 21-09-93 10:39 REM Control Codes cc '@'=""+ 27,"@",+ 27,"R",0,+ 27,"t",1,+ 27,"x",0,27,"p",0,27,"P",18,+ "" cc 'b'=27,"E",27,"G";27,"F",27,"H" ;; Bold cc 'i'=27,"4" ;27,"5" ;; Italics cc 'l'=27,"W",1 ;27,"W",0 ;; enLarged cc 'm'=27,"U",1 ;27,"U",0 ;; Mono directional cc 'o'=27,"q",1 ; 27,"q",0 ;; Outline cc 'w'=27,"q",3 ; 27,"q",0 ;; outline and shadoW cc 'q'=27,"x",1 ;27,"x",0 ;; nlQuality cc 's'=27,"S",1 ;27,"T" ;; Subscript cc 't'=27,"S",0 ;27,"T" ;; superscripT cc 'u'=27,"-",1 ;27,"-",0 ;; Underline REM Redefined Characters rc ''=27,"L",12,0, 64,0,240,0,254,0,128,126,128,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,64,0,0,192,0,1,192,0,7,192,0,31,192,0,63,255,192,31,192,0,7,192,0,1,192,0,0,192,0,0,64,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,48,0,0,56,0,0,62,0,0,63,128,63,255,192,0,63,128,0,62,0,0,56,0,0,48,0,0,32,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,7,255,0,3,254,0,1,252,0,0,248,0,0,248,0,0,112,0,0,112,0,0,32,0,0,32,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,32,0,0,112,0,0,112,0,0,248,0,0,248,0,1,252,0,3,254,0,7,255,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,0,0 rc ''=27,"6",128 rc ''=27,"6",129 rc ''=27,"6",130 rc ''=27,"6",131 rc ''=27,"6",132 rc ''=27,"6",133 rc ''=27,"6",134 rc ''=27,"6",135 rc ''=27,"6",136 rc ''=27,"6",137 rc ''=27,"6",138 rc ''=27,"6",139 rc ''=27,"6",140 rc ''=27,"6",141 rc ''=27,"6",142 rc ''=27,"6",143 rc ''=27,"6",144 rc ''=27,"6",145 rc ''=27,"6",146 rc ''=27,"6",147 rc ''=27,"6",148 rc ''=27,"6",149 rc ''=27,"6",150 rc ''=27,"6",151 rc ''=27,"6",152 rc ''=27,"6",153 rc ''=27,"6",154 rc ''=27,"6",156 rc ''=27,"6",159 IF PC rc ''=27,"6","" ENDIF rc ''=27,"t",0,27,"R",2,"~",27,"R",0,27,"t",1 IF ST rc 158=27,"t",0,27,"R",2,"~",27,"R",0,27,"t",1 ENDIF rc ''=27,"t",0,27,"R",4,"|",27,"R",0,27,"t",1 ;; o slash rc ''=27,"t",0,27,"R",4,"\",27,"R",0,27,"t",1 ;; O slash rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 rc ''=27,"t",1,175 IF VER5 rem Eth, eth, L slash, l slash, L dot, l dot, Thorn, thorn rc ''="D",27,"\",238,255, 27,"*",39,18,0, 0,0,0,0,96,0,0,96,0,0,96,0,0,96,0,0,96,0,0,96,0,0,96,0,0,96,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,31,128,66,63,192,102,112,224,118,96,96,60,96,96,28,96,96,62,96,96,103,96,96,99,224,96,65,240,224,0,255,192,0,127,128,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,3,0,48,3,0,48,3,0,48,3,255,240,3,255,240,0,0,48,0,0,48,0,0,48,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,48,0,96,48,0,96,63,255,224,63,255,224,6,6,96,6,6,96,6,6,0,6,6,0,6,6,0,6,6,0,7,14,0,3,252,0,1,248,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,192,0,3,192,0,3,255,255,255,255,255,255,3,3,3,6,1,131,6,1,128,6,1,128,6,1,128,6,1,128,7,3,128,3,255,0,1,254,0,0,0,0,0,0,0,0,0,0 rc ''="L",27,"\",238,255, 27,"*",39,18,0, 0,0,0,0,8,0,0,24,0,0,24,0,0,48,0,0,96,0,0,224,0,0,192,0,1,128,0,3,0,0,3,0,0,2,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''="l",27,"\",238,255, 27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,0,0,24,0,0,24,0,0,48,0,0,96,0,0,96,0,0,192,0,1,128,0,1,128,0,1,0,0,0,0,0,0,0,0,0,0,0 rc ''="L",27,"\",238,255, 27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,224,0,0,224,0,0,224,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''="l",27,"\",238,255, 27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,112,0,0,112,0,0,112,0,0,0,0,0,0,0,0,0,0 ENDIF IF VER5 acute ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 32,0,0, 96,0,0, 192,0,0, 128,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 breve ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 192,0,0, 224,0,0, 32,0,0, 32,0,0, 32,0,0, 32,0,0, 224,0,0, 192,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 caron ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 128,0,0, 192,0,0, 96,0,0, 32,0,0, 96,0,0, 192,0,0, 128,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 cedilla ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 0,0,4, 0,0,6, 0,0,2, 0,0,50, 0,0,50, 0,0,18, 0,0,30, 0,0,12, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 circumflex; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 32,0,0, 96,0,0, 192,0,0, 128,0,0, 192,0,0, 96,0,0, 32,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 dacute ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 32,0,0, 96,0,0, 192,0,0, 128,0,0, 0,0,0, 0,0,0, 0,0,0, 32,0,0, 96,0,0, 192,0,0, 128,0,0, 0,0,0, 0,0,0 dgrave ; 27,"\",241,255, 27,"*",39,15,0, 128,0,0, 192,0,0, 96,0,0, 32,0,0, 0,0,0, 0,0,0, 0,0,0, 128,0,0, 192,0,0, 96,0,0, 32,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 diaeresis ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 224,0,0, 224,0,0, 224,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 224,0,0, 224,0,0, 224,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 grave ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 0,0,0, 128,0,0, 192,0,0, 96,0,0, 32,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 macron ; 27,"\",241,255, 27,"*",39,15,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 0,0,0, 0,0,0 ogonek ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,12, 0,0,30, 0,0,54, 0,0,38, 0,0,6, 0,0,4, 0,0,0, 0,0,0 overdot ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 224,0,0, 224,0,0, 224,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 ring ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 0,0,0, 96,0,0, 240,0,0, 144,0,0, 144,0,0, 240,0,0, 96,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 tilde ; 27,"\",241,255, 27,"*",39,15,0, 32,0,0, 96,0,0, 192,0,0, 128,0,0, 128,0,0, 192,0,0, 64,0,0, 96,0,0, 32,0,0, 32,0,0, 96,0,0, 192,0,0, 0,0,0, 0,0,0, 0,0,0 ENDIF hl 27,"J",15 pscode 27,"9"; 27,"8" IF VER5 pp on mm 4 mf 2 cw 36 double L regular abcefilmopqstuw omit n ENDIF IF VER6 gfxtype 4 offatcr u vres 180 hres 360 vms 27,"J" ;; ENDIF menu "Outline:^XO" O "Shadow:^XW" W "Fifteen pitch:^XF" F "Mono directional:^XM" M menuend IF VER6 red 27,"r",5 green 27,"r",6 blue 27,"r",3 cyan 27,"r",2 magenta 27,"r",1 yellow 27,"r",4 black 27,"r",0 ENDIF rem all widths are in units of 1/360" (24pin) or 1/240" (9pin) style N "Roman" "Roman" 10 10 q style O "Sans serif" "Sans serif" 10 10 q style P "Courier" "Courier" 10 10 q style Q "Prestige" "Prestige" 10 10 q rules p="roman ps",+ ps="ps script",pt="ps script",pc="ps cond",+ cps="ps condscr",cpt="ps condscr"+ c="gen 17",e="gen 12",ec="gen 20",f="gen 15" enter 27,"k",0,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 font "gen 12" enter 27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "gen 15" enter 27,"p",0,27,"g" point 10 pitch 15 cw 24 font "gen 17" enter 27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "gen 20" enter 27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "roman 10" menufont "Roman" enter 27,"k",0,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="roman ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="roman 17",e="roman 12",ec="roman 20",f="roman 15" font "roman 12" enter 27,"k",0,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "roman 15" enter 27,"k",0,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "roman 17" enter 27,"k",0,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "roman 20" enter 27,"k",0,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "roman ps" enter 27,"k",0,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" widths 30 !18 "30 #30 $30 %36 &36 '18 (24 )24 *30 +30 ,18 -30 .18 /30 030 130 230 330 430 530 630 730 830 930 :18 ;18 <30 =30 >30 ?30 @36 A36 B36 C36 D36 E36 F36 G36 H36 I24 J30 K36 L36 M42 N36 O36 P36 Q36 R36 S36 T36 U42 V36 W42 X36 Y36 Z30 [24 \30 ]24 ^30 _30 `18 a30 b36 c30 d36 e30 f24 g36 h36 i18 j24 k36 l18 m42 n36 o30 p36 q36 r30 s30 t24 u36 v36 w42 x30 y36 z30 {24 |18 }24 ~30 36 36 30 30 30 30 30 30 30 30 30 18 18 18 36 36 36 42 42 30 30 30 36 36 36 36 42 30 30 36 42 30 30 18 30 36 36 36 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 36 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 36 36 36 36 36 36 font "ps cond" enter 27,"p",1,15 point 10 widths 15 !9 "15 #15 $15 %18 &18 '9 (12 )12 *15 +15 ,9 -15 .9 /15 015 115 215 315 415 515 615 715 815 915 :9 ;9 <15 =15 >15 ?15 @18 A18 B18 C18 D18 E18 F18 G18 H18 I12 J15 K18 L18 M21 N18 O18 P18 Q18 R18 S18 T18 U21 V18 W21 X18 Y18 Z15 [12 \15 ]12 ^15 _15 `9 a15 b18 c15 d18 e15 f12 g18 h18 i9 j12 k18 l9 m21 n18 o15 p18 q18 r15 s15 t12 u18 v18 w21 x15 y18 z15 {12 |9 }12 ~15 18 18 15 15 15 15 15 15 15 15 15 9 9 9 18 18 18 21 21 15 15 15 18 18 18 18 21 15 15 18 21 15 15 9 15 18 18 18 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 font "ps script" enter 27,"p",1,18 point 10 widths 20 !12 "20 #20 $20 %24 &24 '12 (16 )16 *20 +20 ,12 -20 .12 /20 020 120 220 320 420 520 620 720 820 920 :12 ;12 <20 =20 >20 ?20 @24 A24 B24 C24 D24 E24 F24 G24 H24 I16 J20 K24 L24 M28 N24 O24 P24 Q24 R24 S24 T24 U28 V24 W28 X24 Y24 Z20 [16 \20 ]16 ^20 _20 `12 a20 b24 c20 d24 e20 f16 g24 h24 i12 j16 k24 l12 m28 n24 o20 p24 q24 r20 s20 t16 u24 v24 w28 x20 y24 z20 {16 |12 }16 ~20 24 24 20 20 20 20 20 20 20 20 20 12 12 12 24 24 24 28 28 20 20 20 24 24 24 24 28 20 20 24 28 20 20 12 20 24 24 24 20 20 20 20 20 20 20 20 20 20 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 20 24 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 36 36 36 36 36 36 font "ps condscr" enter 27,"p",1,15 point 10 widths 15 !9 "15 #15 $15 %18 &18 '9 (12 )12 *15 +15 ,9 -15 .9 /15 015 115 215 315 415 515 615 715 815 915 :9 ;9 <15 =15 >15 ?15 @18 A18 B18 C18 D18 E18 F18 G18 H18 I12 J15 K18 L18 M21 N18 O18 P18 Q18 R18 S18 T18 U21 V18 W21 X18 Y18 Z15 [12 \15 ]12 ^15 _15 `9 a15 b18 c15 d18 e15 f12 g18 h18 i9 j12 k18 l9 m21 n18 o15 p18 q18 r15 s15 t12 u18 v18 w21 x15 y18 z15 {12 |9 }12 ~15 18 18 15 15 15 15 15 15 15 15 15 9 9 9 18 18 18 21 21 15 15 15 18 18 18 18 21 15 15 18 21 15 15 9 15 18 18 18 15 15 15 15 15 15 15 15 15 15 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 15 18 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 font "sanserif 10" menufont "Sans serif" enter 27,"k",1,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="sanserif ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="sanserif 17",e="sanserif 12",ec="sanserif 20",f="sanserif 15" font "sanserif 12" enter 27,"k",1,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "sanserif 15" enter 27,"k",1,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "sanserif 17" enter 27,"k",1,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "sanserif 20" enter 27,"k",1,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "sanserif ps" enter 27,"k",1,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" copywidths "roman ps" font "courier 10" menufont "Courier" enter 27,"k",2,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="courier ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="courier 17",e="courier 12",ec="courier 20",f="courier 15" font "courier 12" enter 27,"k",2,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "courier 15" enter 27,"k",2,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "courier 17" enter 27,"k",2,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "courier 20" enter 27,"k",2,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "courier ps" enter 27,"k",2,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" copywidths "roman ps" font "prestige 10" menufont "Prestige" enter 27,"k",3,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="prestige ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="prestige 17",e="prestige 12",ec="prestige 20",f="prestige 15" font "prestige 12" enter 27,"k",3,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "prestige 15" enter 27,"k",3,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "prestige 17" enter 27,"k",3,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "prestige 20" enter 27,"k",3,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "prestige ps" enter 27,"k",3,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" copywidths "roman ps" font "script 10" menufont "Script" enter 27,"k",4,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="script ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="script 17",e="script 12",ec="script 20",f="script 15" font "script 12" enter 27,"k",4,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "script 15" enter 27,"k",4,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "script 17" enter 27,"k",4,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "script 20" enter 27,"k",4,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "script ps" enter 27,"k",4,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" copywidths "roman ps" font "ocrb 10" menufont "OCR-B" enter 27,"k",5,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="ocrb ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="ocrb 17",e="ocrb 12",ec="ocrb 20",f="ocrb 15" font "ocrb 12" enter 27,"k",5,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "ocrb 15" enter 27,"k",5,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "ocrb 17" enter 27,"k",5,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "ocrb 20" enter 27,"k",5,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "ocrb ps" enter 27,"k",5,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" copywidths "roman ps" font "ocra 10" menufont "OCR-A" enter 27,"k",6,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="ocra ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="ocra 17",e="ocra 12",ec="ocra 20",f="ocra 15" font "ocra 12" enter 27,"k",6,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "ocra 15" enter 27,"k",6,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "ocra 17" enter 27,"k",6,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "ocra 20" enter 27,"k",6,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "ocra ps" enter 27,"k",6,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" copywidths "roman ps" font "orator 10" menufont "Orator" enter 27,"k",7,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="orator ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="orator 17",e="orator 12",ec="orator 20",f="orator 15" font "orator 12" enter 27,"k",7,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "orator 15" enter 27,"k",7,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "orator 17" enter 27,"k",7,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "orator 20" enter 27,"k",7,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "orator ps" enter 27,"k",7,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" copywidths "roman ps" font "orats 10" menufont "Orator-S" enter 27,"k",8,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="orats ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="orats 17",e="orats 12",ec="orats 20",f="orats 15" font "orats 12" enter 27,"k",8,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "orats 15" enter 27,"k",8,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "orats 17" enter 27,"k",8,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "orats 20" enter 27,"k",8,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "orats ps" enter 27,"k",8,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" copywidths "roman ps" T$&"""cr" copywidths "roman ps" ! REM 9 pin Epson compatible REM ORIGIN=D:\PROTEXT\PPD\MATRIX.GPD 21-09-93 10:39 REM Control Codes cc '@'=""+ 27,"@",+ 27,"R",0,+ 27,"x",0,27,"p",0,27,"P",18,+ "" cc 'b'=27,"E",27,"G";27,"F",27,"H" ;; Bold cc 'i'=27,"4" ;27,"5" ;; Italics cc 'l'=27,"W",1 ;27,"W",0 ;; enLarged cc 'm'=27,"U",1 ;27,"U",0 ;; Mono directional cc 'q'=27,"x",1 ;27,"x",0 ;; nlQuality cc 's'=27,"S",1 ;27,"T" ;; Subscript cc 't'=27,"S",0 ;27,"T" ;; superscripT cc 'u'=27,"-",1 ;27,"-",0 ;; Underline REM Redefined Characters rc ''=27,"R",1,"]" rc ''=27,"L",12,0, 64,0,240,0,254,0,128,126,128,0,0,0 rc ''=27,"K",6,0, 32,64,254,64,32,0 rc ''=27,"K",6,0, 8,4,254,4,8,0 rc ''=27,"L",12,0, 16,16,16,16,16,16,84,56,16,0,0,0 rc ''=27,"L",12,0, 16,56,84,16,16,16,16,16,16,0,0,0 rc '#'=27,"R",0,"#" rc '$'=27,"R",0,"$" rc '@'=27,"R",0,"@" rc '['=27,"R",0,"[" rc '\'=27,"R",0,"\" rc ']'=27,"R",0,"]" rc '^'=27,"R",0,"^" rc '`'=27,"R",0,"`" rc '{'=27,"R",0,"{" rc '|'=27,"R",0,"|" rc '}'=27,"R",0,"}" rc '~'=27,"R",0,"~" rc ''=27,"R",1,"@" rc ''=27,"R",1,"[" rc ''=27,"R",1,"\" rc ''=27,"R",1,"{" rc ''=27,"R",1,"|" rc ''=27,"R",1,"}" rc ''=27,"R",2,"[" rc ''=27,"R",2,"\" rc ''=27,"R",2,"]" rc ''=27,"R",2,"{" rc ''=27,"R",2,"|" rc ''=27,"R",2,"}" rc ''=27,"R",2,"~" IF ST rc 158=27,"R",2,"~" ENDIF rc ''=27,"R",3,"#" rc ''=27,"R",4,"[" rc ''=27,"R",4,"]" rc ''=27,"R",4,"{" rc ''=27,"R",4,"}" rc ''=27,"R",5,"@" rc ''=27,"R",6,"|" rc ''=27,"R",6,"~" rc ''=27,"R",7,"[" rc ''=27,"R",7,"\" rc ''=27,"R",7,"]" rc ''=27,"R",7,"|" IF PC rc ''=27,"R",7,"#" ENDIF rc ''=27,"R",4,"\" rc ''=27,"R",4,"|" rc ''=27,"L",12,0, 18,40,130,40,130,40,130,112,10,0,0,0 rc ''=27,"L",12,0, 2,112,138,0,138,0,138,112,2,0,0,0 rc ''=27,"L",12,0, 64,0,248,0,9,18,1,20,9,0,0,0 rc ''=27,"L",12,0, 64,0,250,4,10,0,31,0,2,0,0,0 rc ''=27,"K",6,0, 16,40,84,40,68,0 rc ''=27,"K",6,0, 68,40,84,40,16,0 rc ''=27,"L",12,0, 0,20,2,16,2,124,128,16,128,16,0,0 rc ''=">",8,"_" rc ''="<",8,"_" rc ''="+",8,"_" rc ''="C",8,"," rc ''="a",8,27,"R",0,"^" rc ''="e",8,27,"R",0,"^" rc ''="i",8,27,"R",0,"^" rc ''="o",8,27,"R",0,"^" rc ''="u",8,27,"R",0,"^" rc ''="e",8,27,"R",1,"~" rc ''="i",8,27,"R",1,"~" rc ''="y",8,27,"R",1,"~" rc ''="a",8,27,"K",6,0,0,0,64,128,0,0 rc ''="i",8,27,"K",6,0,0,0,64,128,0,0 rc ''="o",8,27,"K",6,0,0,0,64,128,0,0 rc ''="u",8,27,"K",6,0,0,0,64,128,0,0 rc ''=27,"K",6,0, 0,0,15,8,8,8 rc ''=27,"K",6,0, 8,8,15,0,0,0 rc ''=27,"K",6,0, 0,0,248,8,8,8 rc ''=27,"K",6,0, 8,8,248,0,0,0 rc ''=27,"K",6,0, 8,8,8,8,8,8 rc ''=27,"K",6,0, 0,0,255,0,0,0 rc ''=27,"K",6,0, 8,8,15,8,8,8 rc ''=27,"K",6,0, 8,8,248,8,8,8 rc ''=27,"K",6,0, 8,8,255,8,8,8 rc ''=27,"K",6,0, 0,0,255,8,8,8 rc ''=27,"K",6,0, 8,8,255,0,0,0 hl 27,"J",18 pscode 27,"9"; 27,"8" pp on ms off mm 1 mf 4 cw 24 double L regular abcefilmopqstuw omit n IF VER6 gfxtype 3 offatcr u vres 216 hres 240 vms 27,"J" ;; ENDIF menu "Mono directional:^XM" M menuend rem all widths are in units of 1/360" (24pin) or 1/240" (9pin) style N "Roman" "Roman" 10 10 q style O "Sans serif" "Sans serif" 10 10 q rules p="roman ps",+ c="gen 17",e="gen 12",ec="gen 20",f="gen 15" enter 27,"k",0,27,"p",0,27,"P",18 point 10 pitch 10 cw 24 font "gen 12" enter 27,"p",0,27,"M",18 point 10 pitch 12 cw 20 font "gen 15" enter 27,"p",0,27,"g" point 10 pitch 15 cw 16 font "gen 17" enter 27,"p",0,27,"P",15 point 10 pitch 17.14 cw 14 font "gen 20" enter 27,"p",0,27,"M",15 point 10 pitch 20 cw 12 font "roman 10" menufont "Roman" enter 27,"k",0,27,"p",0,27,"P",18 point 10 pitch 10 cw 24 rules p="roman ps",+ c="roman 17",e="roman 12",ec="roman 20",f="roman 15" font "roman 12" enter 27,"k",0,27,"p",0,27,"M",18 point 10 pitch 12 cw 20 font "roman 15" enter 27,"k",0,27,"p",0,27,"g" point 10 pitch 15 cw 16 font "roman 17" enter 27,"k",0,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 14 font "roman 20" enter 27,"k",0,27,"p",0,27,"M",15 point 10 pitch 20 cw 12 font "roman ps" enter 27,"k",0,27,"p",1,18 point 10 widths 24 !10 "16 #24 $24 %24 &24 '10 (12 )12 *24 +24 ,14 -24 .12 /20 024 116 224 324 424 524 624 724 824 924 :12 ;12 <20 =24 >20 ?24 @24 A24 B24 C24 D24 E24 F24 G24 H24 I16 J22 K24 L24 M24 N24 O24 P24 Q24 R24 S24 T24 U24 V24 W24 X20 Y24 Z20 [16 \20 ]16 ^24 _24 `10 a24 b22 c22 d22 e24 f20 g22 h22 i16 j18 k20 l16 m24 n22 o24 p22 q22 r22 s24 t22 u24 v24 w24 x20 y24 z20 {18 |10 }18 ~24 24 22 24 24 24 24 24 22 24 24 24 16 20 16 24 24 24 24 24 20 20 20 22 22 24 24 24 22 24 24 24 22 24 16 20 22 22 24 24 24 24 24 24 24 24 10 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 24 22 20 24 20 22 22 24 20 24 24 24 24 24 20 24 24 24 20 20 24 24 24 24 16 12 12 24 16 16 16 24 24 24 24 24 font "sanserif 10" menufont "Sans serif" enter 27,"k",1,27,"p",0,27,"P",18 point 10 pitch 10 cw 24 rules p="sanserif ps",+ c="sanserif 17",e="sanserif 12",ec="sanserif 20",f="sanserif 15" font "sanserif 12" enter 27,"k",1,27,"p",0,27,"M",18 point 10 pitch 12 cw 20 font "sanserif 15" enter 27,"k",1,27,"p",0,27,"g" point 10 pitch 15 cw 18 font "sanserif 17" enter 27,"k",1,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 14 font "sanserif 20" enter 27,"k",1,27,"p",0,27,"M",15 point 10 pitch 20 cw 12 font "sanserif ps" enter 27,"k",1,27,"p",1,18 point 10 copywidths "roman ps" tb!NWINA20 386 ( $COPY u7fTEMP "7MOUSE {!XTGOLD  b"" BATS c"YPROTEXT c"ZAUTOEXECBAK 5O&ZIP $UNZIP i"REM 24 pin Epson ESCP/2 colour REM ORIGIN=D:\PROTEXT\PPD\MATRIX.GPD 21-09-93 10:39 REM Control Codes cc '@'=""+ 27,"@",+ 27,"(t",3,0,0,0,0, 27,"(t",3,0,1,1,0, 27,"(t",3,0,3,3,0,+ 27,"(U",1,0,10,+ 27,"R",0,+ 27,"t",1,+ 27,"x",0,27,"p",0,27,"P",18,+ "" cc 'b'=27,"E",27,"G";27,"F",27,"H" ;; Bold cc 'i'=27,"4" ;27,"5" ;; Italics cc 'l'=27,"W",1 ;27,"W",0 ;; enLarged cc 'm'=27,"U",1 ;27,"U",0 ;; Mono directional cc 'o'=27,"q",1 ; 27,"q",0 ;; Outline cc 'w'=27,"q",3 ; 27,"q",0 ;; outline and shadoW cc 'q'=27,"x",1 ;27,"x",0 ;; nlQuality cc 's'=27,"S",1 ;27,"T" ;; Subscript cc 't'=27,"S",0 ;27,"T" ;; superscripT cc 'u'=27,"(-",3,0,1,1,1 ;27,"(-",3,0,1,1,0 ;; Underline REM Redefined Characters rc ''=27,"(^",1,0,1 rc ''=27,"(^",1,0,2 rc ''=27,"(^",1,0,3 rc ''=27,"(^",1,0,4 rc ''=27,"(^",1,0,5 rc ''=27,"(^",1,0,6 rc ' '=27,"(^",1,0,11 rc ''=27,"(^",1,0,14 rc ''=27,"(^",1,0,15 rc ''=27,"(^",1,0,16 rc ''=27,"(^",1,0,17 rc ''=27,"(^",1,0,18 rc ''=27,"(^",1,0,19 rc ''=27,"(^",1,0,20 rc ''=27,"(^",1,0,21 rc ''=27,"(^",1,0,22 rc ''=27,"(^",1,0,23 rc ''=27,"(^",1,0,24 rc ''=27,"(^",1,0,25 rc ''=27,"(^",1,0,26 rc ''=27,"(^",1,0,27 rc ''=27,"(^",1,0,28 rc ''=27,"(^",1,0,29 rc ''=27,"(^",1,0,30 rc ''=27,"(^",1,0,31 rc ''=27,"6",128 rc ''=27,"6",129 rc ''=27,"6",130 rc ''=27,"6",131 rc ''=27,"6",132 rc ''=27,"6",133 rc ''=27,"6",134 rc ''=27,"6",135 rc ''=27,"6",136 rc ''=27,"6",137 rc ''=27,"6",138 rc ''=27,"6",139 rc ''=27,"6",140 rc ''=27,"6",141 rc ''=27,"6",142 rc ''=27,"6",143 rc ''=27,"6",144 rc ''=27,"6",145 rc ''=27,"6",146 rc ''=27,"6",147 rc ''=27,"6",148 rc ''=27,"6",149 rc ''=27,"6",150 rc ''=27,"6",151 rc ''=27,"6",152 rc ''=27,"6",153 rc ''=27,"6",154 rc ''=27,"6",156 rc ''=27,"6",159 IF PC rc ''=27,"6","" ENDIF rc ''=27,"t",0,27,"R",2,"~",27,"R",0,27,"t",1 IF ST rc 158=27,"t",0,27,"R",2,"~",27,"R",0,27,"t",1 ENDIF rc ''=27,"t",0,27,"R",4,"|",27,"R",0,27,"t",1 ;; o slash rc ''=27,"t",0,27,"R",4,"\",27,"R",0,27,"t",1 ;; O slash rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 rc ''=27,"t",1,175 rc ''=27,"t",3,208,27,"t",1 ; eth rc ''=27,"t",3,209,27,"t",1 ; ETH rc ''=27,"t",3,213,27,"t",1 ; dotless i rc ''=27,"t",3,231,27,"t",1 ; thorn rc ''=27,"t",3,232,27,"t",1 ; THORN rc ''="L",27,"\",238,255, 27,"*",39,18,0, 0,0,0,0,8,0,0,24,0,0,24,0,0,48,0,0,96,0,0,224,0,0,192,0,1,128,0,3,0,0,3,0,0,2,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''="l",27,"\",238,255, 27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,0,0,24,0,0,24,0,0,48,0,0,96,0,0,96,0,0,192,0,1,128,0,1,128,0,1,0,0,0,0,0,0,0,0,0,0,0 rc ''="L",27,"\",238,255, 27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,224,0,0,224,0,0,224,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''="l",27,"\",238,255, 27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,112,0,0,112,0,0,112,0,0,0,0,0,0,0,0,0,0 rc 'A'=27,"t",3,181,27,"t",1 rc 'A'=27,"t",3,182,27,"t",1 rc 'A'=27,"t",3,183,27,"t",1 rc 'a'=27,"t",3,198,27,"t",1 rc 'A'=27,"t",3,199,27,"t",1 rc 'E'=27,"t",3,210,27,"t",1 rc 'E'=27,"t",3,211,27,"t",1 rc 'E'=27,"t",3,212,27,"t",1 rc 'I'=27,"t",3,214,27,"t",1 rc 'I'=27,"t",3,215,27,"t",1 rc 'I'=27,"t",3,216,27,"t",1 rc 'I'=27,"t",3,222,27,"t",1 rc 'O'=27,"t",3,224,27,"t",1 rc 'O'=27,"t",3,226,27,"t",1 rc 'O'=27,"t",3,227,27,"t",1 rc 'o'=27,"t",3,228,27,"t",1 rc 'O'=27,"t",3,229,27,"t",1 rc 'U'=27,"t",3,233,27,"t",1 rc 'U'=27,"t",3,234,27,"t",1 rc 'U'=27,"t",3,235,27,"t",1 rc 'y'=27,"t",3,236,27,"t",1 rc 'Y'=27,"t",3,237,27,"t",1 acute ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 32,0,0, 96,0,0, 192,0,0, 128,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 breve ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 192,0,0, 224,0,0, 32,0,0, 32,0,0, 32,0,0, 32,0,0, 224,0,0, 192,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 caron ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 128,0,0, 192,0,0, 96,0,0, 32,0,0, 96,0,0, 192,0,0, 128,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 cedilla ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 0,0,4, 0,0,6, 0,0,2, 0,0,50, 0,0,50, 0,0,18, 0,0,30, 0,0,12, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 circumflex; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 32,0,0, 96,0,0, 192,0,0, 128,0,0, 192,0,0, 96,0,0, 32,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 dacute ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 32,0,0, 96,0,0, 192,0,0, 128,0,0, 0,0,0, 0,0,0, 0,0,0, 32,0,0, 96,0,0, 192,0,0, 128,0,0, 0,0,0, 0,0,0 dgrave ; 27,"\",241,255, 27,"*",39,15,0, 128,0,0, 192,0,0, 96,0,0, 32,0,0, 0,0,0, 0,0,0, 0,0,0, 128,0,0, 192,0,0, 96,0,0, 32,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 diaeresis ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 224,0,0, 224,0,0, 224,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 224,0,0, 224,0,0, 224,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 grave ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 0,0,0, 128,0,0, 192,0,0, 96,0,0, 32,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 macron ; 27,"\",241,255, 27,"*",39,15,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 192,0,0, 0,0,0, 0,0,0 ogonek ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,12, 0,0,30, 0,0,54, 0,0,38, 0,0,6, 0,0,4, 0,0,0, 0,0,0 overdot ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 224,0,0, 224,0,0, 224,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 ring ; 27,"\",241,255, 27,"*",39,15,0, 0,0,0, 0,0,0, 0,0,0, 96,0,0, 240,0,0, 144,0,0, 144,0,0, 240,0,0, 96,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0, 0,0,0 tilde ; 27,"\",241,255, 27,"*",39,15,0, 32,0,0, 96,0,0, 192,0,0, 128,0,0, 128,0,0, 192,0,0, 64,0,0, 96,0,0, 32,0,0, 32,0,0, 96,0,0, 192,0,0, 0,0,0, 0,0,0, 0,0,0 hl 27,"J",15 pscode 27,"9"; 27,"8" pp on mm 4 ; ESC"(U",1,0,10 in reset code sets unit to 1/360" mf 1 cw 36 double L regular abcefilmopqstuw omit n IF VER6 gfxtype 4 offatcr u as on vres 360 hres 360 scriptsize 67 pointprec 2.00 vms 27,"(v",2,0 ;; ENDIF menu "Outline:^XO" O "Shadow:^XW" W "Fifteen pitch:^XF" F "Mono directional:^XM" M menuend red 27,"r",5 green 27,"r",6 blue 27,"r",3 cyan 27,"r",2 magenta 27,"r",1 yellow 27,"r",4 black 27,"r",0 rem all widths are in units of 1/360" (24pin) or 1/240" (9pin) style N "Roman" "Roman" 10 10 q style O "Sans serif" "Sans serif" 10 10 q style P "Courier" "Courier" 10 10 q style Q "Prestige" "Prestige" 10 10 q style R "Script C" "Script C" 10 10 q rules p="roman ps",+ ps="ps script",pt="ps script",pc="ps cond",+ cps="ps condscr",cpt="ps condscr"+ c="gen 17",e="gen 12",ec="gen 20",f="gen 15" enter 27,"k",0,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 font "gen 12" enter 27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "gen 15" enter 27,"p",0,27,"g" point 10 pitch 15 cw 24 font "gen 17" enter 27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "gen 20" enter 27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "roman 10" menufont "Roman" enter 27,"k",0,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="roman ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="roman 17",e="roman 12",ec="roman 20",f="roman 15" font "roman 12" enter 27,"k",0,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "roman 15" enter 27,"k",0,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "roman 17" enter 27,"k",0,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "roman 20" enter 27,"k",0,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "roman ps" enter 27,"k",0,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" widths 30 !18 "30 #30 $30 %36 &36 '18 (24 )24 *30 +30 ,18 -30 .18 /30 030 130 230 330 430 530 630 730 830 930 :18 ;18 <30 =30 >30 ?30 @36 A36 B36 C36 D36 E36 F36 G36 H36 I24 J30 K36 L36 M42 N36 O36 P36 Q36 R36 S36 T36 U42 V36 W42 X36 Y36 Z30 [24 \30 ]24 ^30 _30 `18 a30 b36 c30 d36 e30 f24 g36 h36 i18 j24 k36 l18 m42 n36 o30 p36 q36 r30 s30 t24 u36 v36 w42 x30 y36 z30 {24 |18 }24 ~30 36 36 30 30 30 30 30 30 30 30 30 18 18 18 36 36 36 42 42 30 30 30 36 36 36 36 42 30 30 36 42 30 30 18 30 36 36 36 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 36 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 36 36 36 36 36 36 30 42 36 18 30 30 font "ps cond" enter 27,"p",1,15 point 10 widths 15 !9 "15 #15 $15 %18 &18 '9 (12 )12 *15 +15 ,9 -15 .9 /15 015 115 215 315 415 515 615 715 815 915 :9 ;9 <15 =15 >15 ?15 @18 A18 B18 C18 D18 E18 F18 G18 H18 I12 J15 K18 L18 M21 N18 O18 P18 Q18 R18 S18 T18 U21 V18 W21 X18 Y18 Z15 [12 \15 ]12 ^15 _15 `9 a15 b18 c15 d18 e15 f12 g18 h18 i9 j12 k18 l9 m21 n18 o15 p18 q18 r15 s15 t12 u18 v18 w21 x15 y18 z15 {12 |9 }12 ~15 18 18 15 15 15 15 15 15 15 15 15 9 9 9 18 18 18 21 21 15 15 15 18 18 18 18 21 15 15 18 21 15 15 9 15 18 18 18 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 42 36 18 30 30 font "ps script" enter 27,"p",1,18 point 10 widths 20 !12 "20 #20 $20 %24 &24 '12 (16 )16 *20 +20 ,12 -20 .12 /20 020 120 220 320 420 520 620 720 820 920 :12 ;12 <20 =20 >20 ?20 @24 A24 B24 C24 D24 E24 F24 G24 H24 I16 J20 K24 L24 M28 N24 O24 P24 Q24 R24 S24 T24 U28 V24 W28 X24 Y24 Z20 [16 \20 ]16 ^20 _20 `12 a20 b24 c20 d24 e20 f16 g24 h24 i12 j16 k24 l12 m28 n24 o20 p24 q24 r20 s20 t16 u24 v24 w28 x20 y24 z20 {16 |12 }16 ~20 24 24 20 20 20 20 20 20 20 20 20 12 12 12 24 24 24 28 28 20 20 20 24 24 24 24 28 20 20 24 28 20 20 12 20 24 24 24 20 20 20 20 20 20 20 20 20 20 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 20 24 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 36 36 36 36 36 36 20 42 36 18 30 30 font "ps condscr" enter 27,"p",1,15 point 10 widths 15 !9 "15 #15 $15 %18 &18 '9 (12 )12 *15 +15 ,9 -15 .9 /15 015 115 215 315 415 515 615 715 815 915 :9 ;9 <15 =15 >15 ?15 @18 A18 B18 C18 D18 E18 F18 G18 H18 I12 J15 K18 L18 M21 N18 O18 P18 Q18 R18 S18 T18 U21 V18 W21 X18 Y18 Z15 [12 \15 ]12 ^15 _15 `9 a15 b18 c15 d18 e15 f12 g18 h18 i9 j12 k18 l9 m21 n18 o15 p18 q18 r15 s15 t12 u18 v18 w21 x15 y18 z15 {12 |9 }12 ~15 18 18 15 15 15 15 15 15 15 15 15 9 9 9 18 18 18 21 21 15 15 15 18 18 18 18 21 15 15 18 21 15 15 9 15 18 18 18 15 15 15 15 15 15 15 15 15 15 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 15 18 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 21 18 9 15 15 font "roman ps scal" enter 27,"k",0,27,"X",1 ;; point 8 12 14 16 18 20 22 24 26 28 30 32 formula "CP*SW/1050+0.5",0 copywidths "roman ps" font "sanserif 10" menufont "Sans serif" enter 27,"k",1,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="sanserif ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="sanserif 17",e="sanserif 12",ec="sanserif 20",f="sanserif 15" font "sanserif 12" enter 27,"k",1,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "sanserif 15" enter 27,"k",1,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "sanserif 17" enter 27,"k",1,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "sanserif 20" enter 27,"k",1,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "sanserif ps" enter 27,"k",1,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" copywidths "roman ps" font "sanserif ps scal" enter 27,"k",1,27,"X",1 ;; point 8 12 14 16 18 20 22 24 26 28 30 32 formula "CP*SW/1050+0.5",0 copywidths "roman ps" font "courier 10" menufont "Courier" enter 27,"k",2,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="courier ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="courier 17",e="courier 12",ec="courier 20",f="courier 15" font "courier 12" enter 27,"k",2,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "courier 15" enter 27,"k",2,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "courier 17" enter 27,"k",2,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "courier 20" enter 27,"k",2,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "courier ps" enter 27,"k",2,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" copywidths "roman ps" font "prestige 10" menufont "Prestige" enter 27,"k",3,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="prestige ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="prestige 17",e="prestige 12",ec="prestige 20",f="prestige 15" font "prestige 12" enter 27,"k",3,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "prestige 15" enter 27,"k",3,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "prestige 17" enter 27,"k",3,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "prestige 20" enter 27,"k",3,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "prestige ps" enter 27,"k",3,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" copywidths "roman ps" font "script 10" menufont "Script" enter 27,"k",4,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="script ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="script 17",e="script 12",ec="script 20",f="script 15" font "script 12" enter 27,"k",4,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "script 15" enter 27,"k",4,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "script 17" enter 27,"k",4,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "script 20" enter 27,"k",4,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "script ps" enter 27,"k",4,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" copywidths "roman ps" font "ocrb 10" menufont "OCR-B" enter 27,"k",5,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="ocrb ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="ocrb 17",e="ocrb 12",ec="ocrb 20",f="ocrb 15" font "ocrb 12" enter 27,"k",5,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "ocrb 15" enter 27,"k",5,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "ocrb 17" enter 27,"k",5,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "ocrb 20" enter 27,"k",5,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "ocrb ps" enter 27,"k",5,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" copywidths "roman ps" font "ocra 10" menufont "OCR-A" enter 27,"k",6,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="ocra ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="ocra 17",e="ocra 12",ec="ocra 20",f="ocra 15" font "ocra 12" enter 27,"k",6,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "ocra 15" enter 27,"k",6,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "ocra 17" enter 27,"k",6,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "ocra 20" enter 27,"k",6,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "ocra ps" enter 27,"k",6,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" copywidths "roman ps" font "orator 10" menufont "Orator" enter 27,"k",7,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="orator ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="orator 17",e="orator 12",ec="orator 20",f="orator 15" font "orator 12" enter 27,"k",7,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "orator 15" enter 27,"k",7,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "orator 17" enter 27,"k",7,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "orator 20" enter 27,"k",7,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "orator ps" enter 27,"k",7,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" copywidths "roman ps" font "orats 10" menufont "Orator-S" enter 27,"k",8,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="orats ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="orats 17",e="orats 12",ec="orats 20",f="orats 15" font "orats 12" enter 27,"k",8,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "orats 15" enter 27,"k",8,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "orats 17" enter 27,"k",8,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "orats 20" enter 27,"k",8,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "orats ps" enter 27,"k",8,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" copywidths "roman ps" font "scriptc 10" menufont "Script C" enter 27,"k",9,27,"p",0,27,"P",18 point 10 pitch 10 cw 36 rules p="scriptc ps",+ ps="ps script",pt="ps script",pc="ps cond"+ cps="ps condscr",pct="ps condscr"+ c="scriptc 17",e="scriptc 12",ec="scriptc 20",f="scriptc 15" font "scriptc 12" enter 27,"k",9,27,"p",0,27,"M",18 point 10 pitch 12 cw 30 font "scriptc 15" enter 27,"k",9,27,"p",0,27,"g" point 10 pitch 15 cw 24 font "scriptc 17" enter 27,"k",9,27,"p",0,27,"P",15 point 10 pitch 17.14 cw 21 font "scriptc 20" enter 27,"k",9,27,"p",0,27,"M",15 point 10 pitch 20 cw 18 font "scriptc ps" enter 27,"k",9,27,"p",1,18 point 10 rules s="ps script",t="ps script",c="ps cond",cs="ps condscr",ct="ps condscr" copywidths "roman ps" REM 24 pin IBM compatible REM ORIGIN=D:\PROTEXT\PPD\MATRIX.GPD 21-09-93 10:39 REM Control Codes cc '@'=""+ 27,"F",27,"H",27,"W",0,27,"-",0,27,"T" cc 'b'=27,"E",27,"G";27,"F",27,"H" ;; Bold cc 'l'=27,"W",1 ;27,"W",0 ;; enLarged cc 'm'=27,"U",1 ;27,"U",0 ;; Mono directional cc 's'=27,"S",1 ;27,"T" ;; Subscript cc 't'=27,"S",0 ;27,"T" ;; superscripT cc 'u'=27,"-",1 ;27,"-",0 ;; Underline REM Redefined Characters rc ''=27,"^",2 rc ''=27,"^",3 rc ''=27,"^",4 rc ''=27,"^",5 rc ''=27,"^",6 rc ' '=27,"^",11 rc ''=27,"^",14 rc ''=27,"^",15 rc ''=27,"^",16 rc ''=27,"^",17 rc ''=27,"^",18 rc ''=27,"^",19 rc ''=27,"^",20 rc ''=27,"^",21 rc ''=27,"^",22 rc ''=27,"^",23 rc ''=27,"^",24 rc ''=27,"^",25 rc ''=27,"^",26 rc ''=27,"^",27 rc ''=27,"^",28 rc ''=27,"^",29 rc ''=27,"^",30 rc ''=27,"^",31 rc ''=27,"6",128 rc ''=27,"6",129 rc ''=27,"6",130 rc ''=27,"6",131 rc ''=27,"6",132 rc ''=27,"6",133 rc ''=27,"6",134 rc ''=27,"6",135 rc ''=27,"6",136 rc ''=27,"6",137 rc ''=27,"6",138 rc ''=27,"6",139 rc ''=27,"6",140 rc ''=27,"6",141 rc ''=27,"6",142 rc ''=27,"6",143 rc ''=27,"6",144 rc ''=27,"6",145 rc ''=27,"6",146 rc ''=27,"6",147 rc ''=27,"6",148 rc ''=27,"6",149 rc ''=27,"6",150 rc ''=27,"6",151 rc ''=27,"6",152 rc ''=27,"6",153 rc ''=27,"6",154 rc ''=27,"6",156 rc ''=27,"6",159 IF PC rc ''=27,"6","" ENDIF rc ''=225 IF ST rc 158=225 ENDIF rc ''='o',8,'/' rc ''='O',8,'/' rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 rc ''=175 hl 27,"J",15 pscode 27,"9"; 27,"8" IF VER5 pp on ms off mm 1 mf 6 cw 36 double L regular abcefilmopqstuw omit n omit in ENDIF IF VER6 gfxtype 3 offatcr u vres 216 hres 240 vms 27,"J" ;; ENDIF menu "Mono directional:^XM" M menuend rules p=6,qc=5,c=4,qe=3,e=2,q=1,n=0 font 0 ; draft pica enter 27,"I",0 cw 36 point 10 pitch 10 font 1 ; LQ pica enter 27,"I",2 cw 36 point 10 pitch 10 font 2 ; draft elite enter 27,"I",8 cw 30 point 10 pitch 12 font 3 ; LQ elite enter 27,"I",10 cw 30 point 10 pitch 12 font 4 ; draft condensed pica enter 27,"I",16 cw 21 point 10 pitch 17.14 font 5 ; LQ condensed pica enter 27,"I",18 cw 21 point 10 pitch 17.14 font 6 ; proportional enter 27,"I",3 point 10 widths 30 !30 "30 #30 $30 %30 &36 '18 (30 )30 *30 +30 ,30 -30 .30 /30 030 130 230 330 430 530 630 730 830 930 :30 ;30 <30 =30 >30 ?30 @30 A42 B42 C42 D42 E36 F36 G42 H42 I24 J30 K42 L36 M42 N42 O42 P36 Q42 R42 S36 T42 U42 V42 W42 X42 Y42 Z36 [30 \30 ]30 ^30 _30 `30 a30 b36 c30 d36 e30 f24 g36 h36 i18 j18 k36 l18 m42 n36 o30 p36 q36 r30 s30 t24 u36 v36 w42 x36 y36 z30 {30 |30 }30 ~30 42 36 30 30 30 30 30 30 30 30 30 18 18 18 42 42 36 42 42 30 30 30 36 36 36 42 42 30 30 36 42 30 30 18 30 36 36 42 30 30 30 30 30 30 30 30 42 42 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 36 36 36 42 36 36 30 42 42 42 30 30 42 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 NU FCH 4L/IWSCR BAK iY!`LSYS C r#g{/LCVT C 9N EDIT BAK U|REM Canon LBP-4 REM ORIGIN=D:\APED\CANONLJ.GPD 24-08-93 07:10 cc '@'="",+ 27,";",+ 27,"<",27,"('$2",27,")' 1"+ 27,"[2 I",27,"[11h",27,"[?32h",27,"[?6h" cc 'b'=27,"[1m" ; 27,"[2m" ;; bold cc 'i'=27,"[3m" ; 27,"[23m" ;; italic cc 's'=27,"[30e" ; 27,"[30k" ;; subscript cc 't'=27,"[30k" ; 27,"[30e" ;; superscript IF VER6 ELSE cc 'u'=27,"[4m" ; 27,"[24m" ;; underline ENDIF cc 'l'=27,"[;200 B" ; 27,"[;100 B" ;; enlarged (double width) cc 'q'=27,"[2q" ; 27,"[3q" ;; quality tray (lower) cc 'o'=27,"[?7m" ; 27,"[?27m" ;; outline cc 'w'=27,"[?6m" ; 27,"[?26m" ;; shadoW cc 'v'=27,"[7m" ; 27,"[27m" ;; reVerse rc ''=27,"[1.v",1 rc ''=27,"[1.v",2 rc ''=27,"[1.v",3 rc ''=27,"[1.v",4 rc ''=27,"[1.v",5 rc ''=27,"[1.v",6 rc ' '=27,"[1.v",11 rc ''=27,"[1.v",14 rc ''=27,"[1.v",15 rc ''=27,"[1.v",16 rc ''=27,"[1.v",17 rc ''=27,"[1.v",18 rc ''=27,"[1.v",19 rc ''=27,"[1.v",20 rc ''=27,"[1.v",21 rc ''=27,"[1.v",22 rc ''=27,"[1.v",23 rc ''=27,"[1.v",24 rc ''=27,"[1.v",25 rc ''=27,"[1.v",26 rc ''=27,"[1.v",27 rc ''=27,"[1.v",28 rc ''=27,"[1.v",29 rc ''=27,"[1.v",30 rc ''=27,"[1.v",31 rc ''=128 rc ''=129 rc ''=130 rc ''=131 rc ''=132 rc ''=133 rc ''=134 rc ''=135 rc ''=136 rc ''=137 rc ''=138 rc ''=139 rc ''=140 rc ''=141 rc ''=142 rc ''=143 rc ''=144 rc ''=145 rc ''=146 rc ''=147 rc ''=148 rc ''=149 rc ''=150 rc ''=151 rc ''=152 rc ''=153 rc ''=154 rc ''=27,"[0%y",27,")' 2",155,27,"[0%z" rc ''=156 rc ''=27,"[0%y",27,")' 2",157,27,"[0%z" rc ''=159 rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 rc ''=27,"[0%y",27,"(K",126,27,"[0%z" ; es zet IF PC rc ''=158 ENDIF IF ST rc 158=27,"[0%y",27,"(K",126,27,"[0%z" ; es zet ENDIF IF VER5 rc ''=27,"[0%y",27,")' 2",158,27,"[0%z" ; L dot rc ''=27,"[0%y",27,")' 2",159,27,"[0%z" ; l dot rc ''=27,"[0%y",27,')"! 1',232,27,"[0%z" ; L slash rc ''=27,"[0%y",27,')"! 1',248,27,"[0%z" ; l slash rc 'A'=27,"[0%y",27,")' 3",181,27,"[0%z" rc 'A'=27,"[0%y",27,")' 3",182,27,"[0%z" rc 'A'=27,"[0%y",27,")' 3",183,27,"[0%z" rc 'a'=27,"[0%y",27,")' 3",198,27,"[0%z" rc 'A'=27,"[0%y",27,")' 3",199,27,"[0%z" rc ''=27,"[0%y",27,")' 3",208,27,"[0%z" ; eth rc ''=27,"[0%y",27,")' 3",209,27,"[0%z" ; ETH rc 'E'=27,"[0%y",27,")' 3",210,27,"[0%z" rc 'E'=27,"[0%y",27,")' 3",211,27,"[0%z" rc 'E'=27,"[0%y",27,")' 3",212,27,"[0%z" rc ''=27,"[0%y",27,")' 3",213,27,"[0%z" ; dotless i rc 'I'=27,"[0%y",27,")' 3",214,27,"[0%z" rc 'I'=27,"[0%y",27,")' 3",215,27,"[0%z" rc 'I'=27,"[0%y",27,")' 3",216,27,"[0%z" rc 'I'=27,"[0%y",27,")' 3",222,27,"[0%z" rc 'O'=27,"[0%y",27,")' 3",224,27,"[0%z" rc 'O'=27,"[0%y",27,")' 3",226,27,"[0%z" rc 'O'=27,"[0%y",27,")' 3",227,27,"[0%z" rc 'o'=27,"[0%y",27,")' 3",228,27,"[0%z" rc 'O'=27,"[0%y",27,")' 3",229,27,"[0%z" rc ''=27,"[0%y",27,")' 3",231,27,"[0%z" ; thorn rc ''=27,"[0%y",27,")' 3",232,27,"[0%z" ; THORN rc 'U'=27,"[0%y",27,")' 3",233,27,"[0%z" rc 'U'=27,"[0%y",27,")' 3",234,27,"[0%z" rc 'U'=27,"[0%y",27,")' 3",235,27,"[0%z" rc 'y'=27,"[0%y",27,")' 3",236,27,"[0%z" rc 'Y'=27,"[0%y",27,")' 3",237,27,"[0%z" ENDIF ascend 27,"[22k" ; 27,"[22e" ring 27,"[0%y",27,"(R" ; 8,&5b,27,"[0%z" ;; use ISO_FRC diaeresis 27,"[0%y",27,"(R" ; 8,&7e,27,"[0%z" ;; use ISO_FRC macron 27,"[0%y",27,"(A" ; 8,&7e,27,"[0%z" ;; use ISO_UK acute 27,"[0%y",27,'("$3';8,&27,27,"[0%z" ;; use 92_SWD circumflex ; 8,&5e tilde ; 8,&7e grave ; 8,&60 overdot ; 8, 27,"[66k",&2e,27,"[66e" macron ; 8, 27,"[90k",&5f,27,"[90e" breve ; 27,"[0;5;6%y",27,")",34,"! 1" 27,"[50j",198,27,"[0;5;6%z" cedilla ; 27,"[0;5;6%y",27,")",34,"! 1" 27,"[50j",203,27,"[0;5;6%z" dacute ; 27,"[0;5;6%y",27,")",34,"! 1" 27,"[50j",205,27,"[0;5;6%z" ogonek ; 27,"[0;5;6%y",27,")",34,"! 1" 27,"[50j",206,27,"[0;5;6%z" caron ; 27,"[0;5;6%y",27,")",34,"! 1" 27,"[50j",207,27,"[0;5;6%z" hl 27,"K" IF VER5 IF VER6 vms 27,"[" ; "e" vres 720 hres 3600 scriptsize 70 pointprec 0.1 offatcr uvw landscape 27,"[1p" ; 27,"[0p" ENDIF mm 6 mc 27,"["; "a" mf 5 as on pp on ms on ff on double L regular stibluyzvow end 27,"<" copies 27,"[" ; "v" mp on omit pqnec style N "Courier 10cpi" "Courier" 12 10 style O "Courier 12cpi" "Courier" 10 12 style P "Courier 17cpi" "Courier" 8.16 16.66 style Q "Dutch 12" "Dutch" 12 PS style R "Dutch 10" "Dutch" 10 PS style S "Dutch 8" "Dutch" 8 PS style T "Swiss 12" "Swiss" 12 PS style U "Swiss 10" "Swiss" 10 PS style V "Swiss 8" "Swiss" 8 PS style W "Swiss 15B" "Swiss" 15 PS b menu "Outline:^XO" O "Shadow:^XW" W "Reverse:^XV" V "Quality tray:^XQ" Q menuend ELSE mm 0 mc 27,"[1a" mf 1 cw 30 pw 30 ff on pp on ms on ENDIF font 0 ; Courier 12 pt, 10 cpi rules c=2 menufont "Courier" enter 27,"[0 K" cw 360 point 12 pitch 10 font 1 ; 12 cpi enter 27,"[1 K" cw 300 point 10 pitch 12 font 2 ; 15 cpi enter 27,"[2 K" cw 240 point 8.16 pitch 15 font 3 ; 16.66 cpi enter 27,"[?1667 K" cw 216 point 8.16 pitch 16.66 rem Exact widths in 1/72000" which we convert to 1/3600" by dividing by 20 font "Dutch" menufont "Dutch" rules b="Dutch-Bold",i="Dutch-Italic",bi="Dutch-BoldItalic" scalable on enter 27,"PzDutch-Roman.IBML",27,"\",27,"[" ; " C" formula "sw*cp/2000+0.5",0 ;; in 1/3600" widths 250 !333 "408 #500 $500 %833 &778 '180 (333 )333 *500 +564 ,250 -564 .250 /278 0500 1500 2500 3500 4500 5500 6500 7500 8500 9500 :278 ;278 <564 =564 >564 ?444 @921 A722 B667 C667 D722 E611 F556 G722 H722 I333 J389 K722 L611 M889 N722 O722 P556 Q722 R667 S556 T611 U722 V722 W944 X722 Y722 Z611 [333 \278 ]333 ^333 _500 `333 a444 b500 c444 d500 e444 f333 g500 h500 i278 j278 k500 l278 m778 n500 o500 p500 q500 r333 s389 t278 u500 v500 w722 x500 y500 z444 {480 |200 }480 ~333 667 500 444 444 444 444 444 444 444 444 444 278 278 278 722 722 611 667 889 500 500 500 500 500 500 722 722 500 500 500 681 500 444 278 500 500 500 722 276 310 444 725 564 750 750 333 500 500 1000100010001000100010001000100010001000100010001000100010001000 1000100010001000100010001000100010001000100010001000100010001000 1000100010001000100010001000100010001000100010001000100010001000 596 517 593 611 642 526 500 424 788 493 796 528 742 604 799 786 725 564 724 724 560 560 564 799 400 329 250 572 353 300 500 790 790 753 753 753 753 617 718 857 694 694 603 563 453 500 875 603 603 603 987 987 725 1042694 694 500 722 500 722 500 611 278 611 347 278 556 500 font "Dutch-Bold" scalable on enter 27,"PzDutch-Bold.IBML",27,"\",27,"[" ; " C" formula "sw*cp/2000+0.5",0 ;; in 1/3600" widths 250 !333 "555 #500 $500 %1000&833 '278 (333 )333 *500 +570 ,250 -570 .250 /278 0500 1500 2500 3500 4500 5500 6500 7500 8500 9500 :333 ;333 <570 =570 >570 ?500 @930 A722 B667 C722 D722 E667 F611 G778 H778 I389 J500 K778 L667 M944 N722 O778 P611 Q778 R722 S556 T667 U722 V722 W1000X722 Y722 Z667 [333 \278 ]333 ^333 _500 `333 a500 b556 c444 d556 e444 f333 g500 h556 i278 j333 k556 l278 m833 n556 o500 p556 q556 r444 s389 t333 u556 v500 w722 x500 y500 z444 {394 |220 }394 ~333 722 556 444 500 500 500 500 444 444 444 444 278 278 278 722 722 667 722 1000500 500 500 556 556 500 778 722 500 500 500 722 500 500 278 500 556 556 722 300 330 500 725 570 750 750 333 500 500 1000100010001000100010001000100010001000100010001000100010001000 1000100010001000100010001000100010001000100010001000100010001000 1000100010001000100010001000100010001000100010001000100010001000 536 490 601 576 661 524 556 442 768 476 753 483 754 610 799 786 799 570 722 722 560 560 570 799 400 329 250 549 392 300 500 790 790 753 753 753 753 617 718 857 694 694 603 611 540 500 875 603 603 603 987 987 725 1042694 694 500 778 556 722 500 667 278 667 419 278 611 556 font "Dutch-Italic" scalable on enter 27,"PzDutch-Italic.IBML",27,"\",27,"[" ; " C" formula "sw*cp/2000+0.5",0 ;; in 1/3600" widths 250 !333 "420 #500 $500 %833 &778 '214 (333 )333 *500 +675 ,250 -675 .250 /278 0500 1500 2500 3500 4500 5500 6500 7500 8500 9500 :333 ;333 <675 =675 >675 ?500 @920 A611 B611 C667 D722 E611 F611 G722 H722 I333 J444 K667 L556 M833 N667 O722 P611 Q722 R611 S500 T556 U722 V611 W833 X611 Y556 Z556 [389 \278 ]389 ^333 _500 `333 a500 b500 c444 d500 e444 f278 g500 h500 i278 j278 k444 l278 m722 n500 o500 p500 q500 r389 s389 t278 u500 v444 w667 x444 y444 z389 {400 |275 }400 ~333 667 500 444 500 500 500 500 444 444 444 444 278 278 278 611 611 611 667 889 500 500 500 500 500 444 722 722 500 500 500 764 500 500 278 500 500 500 667 276 310 500 725 675 750 750 389 500 500 1000100010001000100010001000100010001000100010001000100010001000 1000100010001000100010001000100010001000100010001000100010001000 1000100010001000100010001000100010001000100010001000100010001000 596 517 593 611 642 526 500 424 788 493 796 528 742 604 799 786 725 675 724 724 560 560 675 799 400 329 250 572 353 300 500 790 790 753 753 753 753 617 718 857 694 694 603 549 523 500 875 603 603 603 987 987 725 1042694 694 500 722 500 722 500 556 278 556 338 278 611 500 font "Dutch-BoldItalic" scalable on enter 27,"PzDutch-BoldItalic.IBML",27,"\",27,"[" ; " C" formula "sw*cp/2000+0.5",0 ;; in 1/3600" widths 250 !389 "555 #500 $500 %833 &778 '278 (333 )333 *500 +570 ,250 -606 .250 /278 0500 1500 2500 3500 4500 5500 6500 7500 8500 9500 :333 ;333 <570 =570 >570 ?500 @832 A667 B667 C667 D722 E667 F667 G722 H778 I389 J500 K667 L611 M889 N722 O722 P611 Q722 R667 S556 T611 U722 V667 W889 X667 Y611 Z611 [333 \278 ]333 ^333 _500 `333 a500 b500 c444 d500 e444 f333 g500 h556 i278 j278 k500 l278 m778 n556 o500 p500 q500 r389 s389 t278 u556 v444 w667 x500 y444 z389 {348 |220 }348 ~333 667 556 444 500 500 500 500 444 444 444 444 278 278 278 667 667 667 722 944 500 500 500 556 556 444 722 722 500 500 500 819 500 500 278 500 556 556 722 266 300 500 725 606 750 750 389 500 500 1000100010001000100010001000100010001000100010001000100010001000 1000100010001000100010001000100010001000100010001000100010001000 1000100010001000100010001000100010001000100010001000100010001000 536 490 601 576 661 524 576 442 768 476 753 483 754 610 799 786 799 570 722 722 560 560 570 799 400 329 250 549 392 300 500 790 790 753 753 753 753 617 718 857 694 694 603 611 500 500 875 603 603 603 987 987 725 1042694 694 500 722 500 722 500 611 278 611 417 278 611 500 font "Swiss" menufont "Swiss" rules b="Swiss-Bold",i="Swiss-Oblique",ib="Swiss-BoldOblique" scalable on enter 27,"PzSwiss.IBML",27,"\",27,"[" ; " C" formula "sw*cp/2000+0.5",0 ;; in 1/3600" widths 278 !278 "355 #556 $556 %889 &667 '191 (333 )333 *389 +584 ,278 -584 .278 /278 0556 1556 2556 3556 4556 5556 6556 7556 8556 9556 :278 ;278 <584 =584 >584 ?556 @1015A667 B667 C722 D722 E667 F611 G778 H722 I278 J500 K667 L556 M833 N722 O778 P667 Q778 R722 S667 T611 U722 V667 W944 X667 Y667 Z611 [278 \278 ]278 ^333 _556 `333 a556 b556 c500 d556 e556 f278 g556 h556 i222 j222 k500 l222 m833 n556 o556 p556 q556 r333 s500 t278 u556 v500 w722 x500 y500 z500 {334 |260 }334 ~333 722 556 556 556 556 556 556 500 556 556 556 278 278 278 667 667 667 889 1000556 556 556 556 556 500 778 722 556 556 556 708 556 556 278 556 556 556 722 370 365 611 725 584 834 834 333 556 556 1000100010001000100010001000100010001000100010001000100010001000 1000100010001000100010001000100010001000100010001000100010001000 1000100010001000100010001000100010001000100010001000100010001000 607 568 572 589 592 611 556 439 713 556 764 567 742 697 799 786 725 584 724 724 560 560 584 799 400 329 278 572 392 333 500 790 790 753 753 753 753 617 718 857 694 694 603 431 537 556 875 603 603 603 987 987 725 1042694 694 611 778 611 722 556 556 222 556 322 278 667 556 font "Swiss-Bold" scalable on enter 27,"PzSwiss-Bold.IBML",27,"\",27,"[" ; " C" formula "sw*cp/2000+0.5",0 ;; in 1/3600" widths 278 !333 "474 #556 $556 %889 &722 '238 (333 )333 *389 +584 ,278 -584 .278 /278 0556 1556 2556 3556 4556 5556 6556 7556 8556 9556 :333 ;333 <584 =584 >584 ?611 @975 A722 B722 C722 D722 E667 F611 G778 H722 I278 J556 K722 L611 M833 N722 O778 P667 Q778 R722 S667 T611 U722 V667 W944 X667 Y667 Z611 [333 \278 ]333 ^333 _556 `333 a556 b611 c556 d611 e556 f333 g611 h611 i278 j278 k556 l278 m889 n611 o611 p611 q611 r389 s556 t333 u611 v556 w778 x556 y556 z500 {389 |280 }389 ~333 722 611 556 556 556 556 556 556 556 556 556 278 278 278 722 722 667 889 1000611 611 611 611 611 556 778 722 556 556 556 743 556 556 278 611 611 611 722 370 365 611 725 584 834 834 333 556 556 1000100010001000100010001000100010001000100010001000100010001000 1000100010001000100010001000100010001000100010001000100010001000 1000100010001000100010001000100010001000100010001000100010001000 608 608 586 643 586 647 611 451 743 593 768 594 754 704 799 786 799 584 722 722 560 560 584 799 400 329 278 549 431 333 500 790 790 753 753 753 753 617 718 857 694 694 603 572 556 556 875 603 603 603 987 987 725 1042694 694 611 778 611 722 611 611 278 611 442 278 667 611 font "Swiss-Oblique" scalable on enter 27,"PzSwiss-Oblique.IBML",27,"\",27,"[" ; " C" formula "sw*cp/2000+0.5",0 ;; in 1/3600" widths 278 !278 "355 #556 $556 %889 &667 '191 (333 )333 *389 +584 ,278 -584 .278 /278 0556 1556 2556 3556 4556 5556 6556 7556 8556 9556 :278 ;278 <584 =584 >584 ?556 @1015A667 B667 C722 D722 E667 F611 G778 H722 I278 J500 K667 L556 M833 N722 O778 P667 Q778 R722 S667 T611 U722 V667 W944 X667 Y667 Z611 [278 \278 ]278 ^333 _556 `333 a556 b556 c500 d556 e556 f278 g556 h556 i222 j222 k500 l222 m833 n556 o556 p556 q556 r333 s500 t278 u556 v500 w722 x500 y500 z500 {334 |260 }334 ~333 722 556 556 556 556 556 556 500 556 556 556 278 278 278 667 667 667 889 1000556 556 556 556 556 500 778 722 556 556 556 708 556 556 278 556 556 556 722 370 365 611 725 584 834 834 333 556 556 1000100010001000100010001000100010001000100010001000100010001000 1000100010001000100010001000100010001000100010001000100010001000 1000100010001000100010001000100010001000100010001000100010001000 607 568 572 589 592 611 556 439 713 556 764 567 742 697 799 786 725 584 724 724 560 560 584 799 400 329 278 572 392 333 500 790 790 753 753 753 753 617 718 857 694 694 603 431 537 556 875 603 603 603 987 987 725 1042694 694 611 778 611 722 556 556 222 556 322 278 667 556 font "Swiss-BoldOblique" scalable on enter 27,"PzSwiss-BoldOblique.IBML",27,"\",27,"[" ; " C" formula "sw*cp/2000+0.5",0 ;; in 1/3600" widths 278 !333 "474 #556 $556 %889 &722 '238 (333 )333 *389 +584 ,278 -584 .278 /278 0556 1556 2556 3556 4556 5556 6556 7556 8556 9556 :333 ;333 <584 =584 >584 ?611 @975 A722 B722 C722 D722 E667 F611 G778 H722 I278 J556 K722 L611 M833 N722 O778 P667 Q778 R722 S667 T611 U722 V667 W944 X667 Y667 Z611 [333 \278 ]333 ^333 _556 `333 a556 b611 c556 d611 e556 f333 g611 h611 i278 j278 k556 l278 m889 n611 o611 p611 q611 r389 s556 t333 u611 v556 w778 x556 y556 z500 {389 |280 }389 ~333 722 611 556 556 556 556 556 556 556 556 556 278 278 278 722 722 667 889 1000611 611 611 611 611 556 778 722 556 556 556 743 556 556 278 611 611 611 722 370 365 611 725 584 834 834 333 556 556 1000100010001000100010001000100010001000100010001000100010001000 1000100010001000100010001000100010001000100010001000100010001000 1000100010001000100010001000100010001000100010001000100010001000 608 608 586 643 586 647 611 451 743 593 768 594 754 704 799 786 799 584 722 722 560 560 584 799 400 329 278 549 431 333 500 790 790 753 753 753 753 617 718 857 694 694 603 572 556 556 875 603 603 603 987 987 725 1042694 694 611 778 611 722 611 611 278 611 442 278 667 611 3 8782 6343 6343 6343 5042 6668 6343 5042 4716 2440 4716 3690 2114 5367 5204 5042 2 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 87REM HP LaserJet 3 REM ORIGIN=D:\APED\LJ.GPD 10-09-93 14:54 rem Control Code definitions cc '@'=""+ 27,"E",27,"&k0G",27,"&l1E",+ 27,"(10U",+ 27,"(s0p10h12v3T" cc 'b'=27,"(s3B" ; 27,"(s0B" ;; bold cc 'i'=27,"(s1S" ; 27,"(s0S" ;; italic IF VER6 ELSE cc 'u'=27,"&dD" ; 27,"&d@" ;; underline ENDIF cc 't'=27,"&a-0.25R" ; 27,"&a+0.25R" ;; superscript cc 's'=27,"&a+0.2R" ; 27,"&a-0.2R" ;; subscript cc 'q'=27,"&l4H" ; 27,"&l1H" ;; nlq (tray select) rem Inverse character: place between pair of ctrl-x V rem note that this assumes 12pt, 10cpi cc 'v'=27,"*p-40Y",27,"*c30a50b0P",27,"*p+40Y",27,"*v0n1o1T" ; 27,"*v0T" rem Character Redefinitions (mostly using PC-8) rc ''=27,"&p1X",2 rc ''=27,"&p1X",3 rc ''=27,"&p1X",4 rc ''=27,"&p1X",5 rc ''=27,"&p1X",6 rc ' '=27,"&p1X",11 rc 12=13,12 ;; form feed rc ''=27,"&p1X",14 rc ''=27,"&p1X",15 rc ''=27,"&p1X",16 rc ''=27,"&p1X",17 rc ''=27,"&p1X",18 rc ''=27,"&p1X",19 rc ''=27,"&p1X",20 rc ''=27,"&p1X",21 rc ''=27,"&p1X",22 rc ''=27,"&p1X",23 rc ''=27,"&p1X",24 rc ''=27,"&p1X",25 rc ''=27,"&p1X",26 rc ''=27,"&p1X",27 rc ''=27,"&p1X",28 rc ''=27,"&p1X",29 rc ''=27,"&p1X",30 rc ''=27,"&p1X",31 rc '''=27,"(8U","'",27,"(10U" ; else would be neutral quote rc '`'=27,"(8U","`",27,"(10U" ; else would be grave accent rc '^'=27,"(8U","^",27,"(10U" ; else would be (small) circumflex accent rc '~'=27,"(8U","~",27,"(10U" ; else would be (small) tilde accent rem accented chars defined so as not to be split into letter and accent rc ''=128 rc ''=129 rc ''=130 rc ''=131 rc ''=132 rc ''=133 rc ''=134 rc ''=135 rc ''=136 rc ''=137 rc ''=138 rc ''=139 rc ''=140 rc ''=141 rc ''=142 rc ''=143 rc ''=144 rc ''=145 rc ''=146 rc ''=147 rc ''=148 rc ''=149 rc ''=150 rc ''=151 rc ''=152 rc ''=153 rc ''=154 rc ''=27,"(8U",214,27,"(10U" ;; o slash rc ''=156 rc ''=27,"(8U",210,27,"(10U" ;; O slash IF PC rc ''=158 ENDIF IF ST rc 158=27,"(8U",222,27,"(10U" ;; double s ENDIF rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 rc ''=27,"(8U",222,27,"(10U" rc ''=27,"(10U",175 rem Use some accented chars to give some symbols in ECMA Latin 1 etc rc ''=157 ;; yen rc ''=155 ;; cent rc ''=27,"(8U",186,27,"(10U" ;; curr. sym. rc ''=27,"(8U",245,27,"(10U" ;; 3/4 rc '_'=27,"(0N",175,27,"(10U" ;; overline rc ''=27,"(0N",215,27,"(10U" ;; multiply rc '_'=27,"(0N",169,27,"(10U" ;; copyright (superior) rc '='=27,"(5M",211,27,"(10U" ;; copyright (full size) rc '='=27,"(5M",210,27,"(10U" ;; registered (full size) rc '_'=27,"(0N",174,27,"(10U" ;; registered rc ''=27,"(0N",185,27,"(10U" ;; super 1 rc ''=27,"(0N",178,27,"(10U" ;; super 2 rc ''=27,"(0N",179,27,"(10U" ;; super 3 IF VER5 rc ''=27,"(8U",227,27,"(10U" rc ''=27,"(8U",228,27,"(10U" rc ''=27,"(8U",240,27,"(10U" rc ''=27,"(8U",241,27,"(10U" rc ''=27,"(11U",158,27,"(10U" rc ''=27,"(11U",159,27,"(10U" rc ''=27,"(7J",233,27,"(10U" rc ''=27,"(7J",232,27,"(10U" rc ''=27,"(7J",254,27,"(10U" ENDIF IF VER5 rem Char defs for extended letter+accent characters rc 'A'=27,"(8U",161,27,"(10U" rc 'A'=27,"(8U",162,27,"(10U" rc 'E'=27,"(8U",163,27,"(10U" rc 'E'=27,"(8U",165,27,"(10U" rc 'I'=27,"(8U",166,27,"(10U" rc 'I'=27,"(8U",167,27,"(10U" rc 'U'=27,"(8U",173,27,"(10U" rc 'U'=27,"(8U",174,27,"(10U" rc 'Y'=27,"(8U",177,27,"(10U" rc 'y'=27,"(8U",178,27,"(10U" rc 'O'=27,"(8U",223,27,"(10U" rc 'A'=27,"(8U",224,27,"(10U" rc 'A'=27,"(8U",225,27,"(10U" rc 'a'=27,"(8U",226,27,"(10U" rc 'I'=27,"(8U",229,27,"(10U" rc 'I'=27,"(8U",230,27,"(10U" rc 'O'=27,"(8U",231,27,"(10U" rc 'O'=27,"(8U",232,27,"(10U" rc 'O'=27,"(8U",233,27,"(10U" rc 'o'=27,"(8U",234,27,"(10U" rc 'S'=27,"(8U",235,27,"(10U" rc 's'=27,"(8U",236,27,"(10U" rc 'Y'=27,"(8U",238,27,"(10U" rc 'd'=27,"*p-3X","d",27,"*p-3X",27,"&f0S","'",27,"&f1S",27,"*p+6X" rc 't'=27,"*p-3X","t",27,"*p-3X",27,"&f0S","'",27,"&f1S",27,"*p+6X" ENDIF IF VER5 acute ; 27,"(8U",8,168,27,"(10U" grave ; 27,"(8U",8,169,27,"(10U" circumflex ; 27,"(8U",8,170,27,"(10U" diaeresis ; 27,"(8U",8,171,27,"(10U" tilde ; 27,"(8U",8,172,27,"(10U" caron ; 27,"(7J",8,245,27,"(10U" breve ; 27,"(7J",8,246,27,"(10U" dacute ; 27,"(7J",8,247,27,"(10U" ring ; 27,"(7J",8,248,27,"(10U" overdot ; 27,"(7J",8,249,27,"(10U" macron ; 27,"(7J",8,250,27,"(10U" cedilla ; 27,"(7J",8,251,27,"(10U" ogonek ; 27,"(7J",8,252,27,"(10U" ascend 27,"*p-7Y" ; 27,"*p+7Y" ENDIF hl 27,"=" gfxtype 1 ; fd "Courier" 12 10 mm 2 vms 27,"*p+" ; "Y" vres 300 hres 300 scriptsize 70 pointprec 0.25 offatcr u landscape 27,"&l1o1e47F",27,"*r0F" ; 27,"&l0o1E" mf 1 as on pq on pp on ms on ff on double ;; no auto doubling regular cstibuq end 27,"&l1T",27,"E" copies 27,"&l" ; "X" mp on omit pqnlec menu "Quality Tray:^XQ" Q menuend style N "Courier 10cpi" "Courier" 12 10 style O "Courier 12cpi" "Courier" 10 12 style Q "CG Times 12" "CG Times" 12 ps style R "CG Times 10" "CG Times" 10 ps style S "CG Times 8" "CG Times" 8 ps style T "Univers 12" "Univers" 12 ps style U "Univers 10" "Univers" 10 ps style V "Univers 8" "Univers" 8 PS style W "Univers 15B" "Univers" 15 PS b font 0 enter 27,"(s0p10h12v3T" rules c="Line Printer",e="Courier 10",s="Line Printer",t="Line Printer" cw 30 point 12 pitch 10 font "Courier 12" ; 12 pt, 10 cpi menufont "Courier" rules c="Line Printer",e="Courier 10",s="Line Printer",t="Line Printer" enter 27,"(s0p10h12v3T" cw 30 point 12 pitch 10 font "Courier 10" ; 10 pt, 12 cpi (elite) enter 27,"(s0p12h10v3T" rules c="Line Printer",s="Line Printer",t="Line Printer" cw 25 point 10 pitch 12 font "Line Printer" menufont "Line Printer" enter 27,"(s0p16.67h8.5v0T" pitch 16.67 style P "Line Printer" "Line Printer" 8.5 16.67 cw 18 point 8.5 font "CG Times Md" menufont "CG Times" rules b="CG Times Bd",i="CG Times It",ib="CG Times BdIt" scalable on enter 27,"(s1p" ; "v0s0b4101T" rem ascend 27,"*p-1841Y" ; 27,"*p+1841Y" formula "int(CP*300/7231/8782*SW +0.5)",0 formula "CP*0.000004724212891803778*SW +0.5",0 widths 2602 !2927 "4066 #4391 $4391 %7806 &6830 '2927 (2927 )2927 *4391 +7806 ,2927 -2927 .2927 /2927 04391 14391 24391 34391 44391 54391 64391 74391 84391 94391 :2927 ;2927 <8782 =7806 >8782 ?3903 @7806 A6343 B5529 C6017 D6505 E5529 F5204 G6343 H6505 I2927 J3415 K6180 L5529 M7969 N6505 O6343 P5042 Q6343 R5855 S4716 T5529 U6505 V6343 W8294 X6343 Y6343 Z5692 [2927 \2927 ]2927 ^4391 _4391 `2927 a3903 b4391 c3903 d4391 e3903 f2927 g4391 h4391 i2439 j2439 k4391 l2439 m6830 n4391 o4391 p4391 q4391 r3253 s3415 t2439 u4391 v4391 w6343 x4391 y4391 z3903 {3903 |4391 }3903 ~8782 6017 4391 3903 3903 3903 3903 3903 3903 3903 3903 3903 2439 2439 2439 6343 6343 5529 5855 7806 4391 4391 4391 4391 4391 4391 6343 6505 4391 4391 4391 7708 4391 3903 2439 4391 4391 4391 6505 4391 4391 3903 7806 7806 7806 7806 2927 3578 3578 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 5367 4391 5367 5367 5367 4391 4879 3903 5855 6343 5367 3903 8782 5367 3415 8782 8782 7806 8782 8782 6343 6343 7806 8782 4391 2927 0 6343 4391 3090 4391 8782 8782 8782 8782 8782 8782 6343 6343 8782 6343 6343 6343 4567 4391 4391 8782 6343 6343 6343 6343 6343 7806 6343 6343 6343 4391 6343 6505 4391 5529 2439 5529 2439 2439 4391 5042 4391 font "CG Times Bd" scalable on enter 27,"(s1p" ; "v0s3b4101T" rem ascend 27,"*p-1930Y" ; 27,"*p+1930Y" formula "CP*300/7231/8782*SW +0.5",0 widths 2602 !2927 "4066 #4391 $4391 %7806 &7318 '2927 (2927 )2927 *4391 +7806 ,2927 -2927 .2927 /2927 04391 14391 24391 34391 44391 54391 64391 74391 84391 94391 :2927 ;2927 <8782 =7806 >8782 ?4391 @7806 A6343 B5855 C6343 D6343 E5855 F5367 G6830 H6830 I3415 J4228 K6830 L5855 M8294 N6343 O6830 P5367 Q6830 R6343 S4879 T5855 U6343 V6343 W8782 X6343 Y6343 Z5855 [2927 \2927 ]2927 ^4391 _4391 `2927 a4391 b4879 c3903 d4879 e3903 f3090 g4391 h4879 i2439 j2927 k4879 l2439 m7318 n4879 o4391 p4879 q4879 r3903 s3415 t2927 u4879 v4391 w6343 x4391 y4391 z3903 {4391 |4391 }4391 ~8782 6343 4879 3903 4391 4391 4391 4391 3903 3903 3903 3903 2439 2439 2439 6343 6343 5855 6343 9107 4391 4391 4391 4879 4879 4391 6830 6343 4391 4391 4391 8567 4391 4391 2439 4391 4879 4879 6343 4391 4391 4391 7806 7806 7806 7806 2927 3740 3740 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 5367 4879 5367 5367 5367 4391 4879 3903 5855 6343 5367 3903 8782 5367 3415 8782 8782 7806 8782 8782 6343 6343 7806 8782 4391 2927 975 6343 4391 3090 4391 8782 8782 8782 8782 8782 8782 6343 6343 8782 6343 6343 6343 5039 4391 4391 8782 6343 6343 6343 6343 6343 7806 6343 6343 6343 4391 6830 6343 4391 5855 2439 5855 3414 2439 4879 5367 4879 font "CG Times It" scalable on enter 27,"(s1p" ; "v1s0b4101T" rem ascend 27,"*p-1896Y" ; 27,"*p+1896Y" formula "CP*300/7231/8782*SW +0.5",0 widths 2602 !2927 "4228 #4391 $4391 %7806 &6830 '2927 (2927 )2927 *4391 +7806 ,2927 -2927 .2927 /2927 04391 14391 24391 34391 44391 54391 64391 74391 84391 94391 :2927 ;2927 <8782 =7806 >8782 ?4391 @7806 A5367 B5367 C5855 D6343 E5367 F5042 G6343 H6343 I2927 J3903 K5855 L4879 M7318 N5855 O6343 P5367 Q6343 R5367 S4391 T4879 U6343 V5367 W7318 X5367 Y4879 Z4879 [2927 \2927 ]2927 ^4391 _4391 `2927 a4391 b4391 c3903 d4391 e3903 f2439 g4391 h4391 i2439 j2439 k3903 l2439 m6343 n4391 o4391 p4391 q4391 r3415 s3415 t2439 u4391 v3903 w5855 x3903 y3903 z3415 {3903 |4391 }3903 ~8782 5855 4391 3903 4391 4391 4391 4391 3903 3903 3903 3903 2439 2439 2439 5367 5367 5367 5855 7806 4391 4391 4391 4391 4391 3903 6343 6343 4391 4391 4391 7645 4391 4391 2439 4391 4391 4391 5855 4391 4391 4391 7806 7806 7806 7806 2927 4066 4066 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 5367 4391 5367 5367 5367 4391 4879 3903 5855 6343 5367 3903 8782 5367 3415 8782 8782 7806 8782 8782 6343 6343 7806 8782 4391 2927 0 6343 4391 3090 4391 8782 8782 8782 8782 8782 8782 6343 6343 8782 6343 6343 6343 4375 4391 4391 8782 6343 6343 6343 6343 6343 7806 6343 6343 6343 4391 6343 6343 4391 4879 2439 4879 2439 2439 4391 5367 4391 font "CG Times BdIt" scalable on enter 27,"(s1p" ; "v1s3b4101T" rem ascend 27,"*p-1820Y" ; 27,"*p+1820Y" formula "CP*300/7231/8782*SW +0.5",0 widths 2602 !3415 "4554 #4391 $4391 %7806 &6830 '2927 (2927 )2927 *4391 +7806 ,2927 -2927 .2927 /2927 04391 14391 24391 34391 44391 54391 64391 74391 84391 94391 :2927 ;2927 <8782 =7806 >8782 ?4391 @7806 A5855 B5855 C5855 D6343 E5855 F5367 G6343 H6830 I3415 J4391 K5855 L5367 M7806 N6343 O6343 P5367 Q6180 R5855 S4879 T5367 U6343 V5855 W7806 X5855 Y5367 Z5367 [2927 \2927 ]2927 ^4391 _4391 `2927 a4391 b4391 c3903 d4391 e3903 f3090 g4391 h4879 i2439 j2439 k4391 l2439 m6830 n4879 o4391 p4391 q4391 r3415 s3415 t2439 u4879 v3903 w5855 x4391 y3903 z3415 {4391 |4391 }4391 ~8782 5855 4879 3903 4391 4391 4391 4391 3903 3903 3903 3903 2439 2439 2439 5855 5855 5855 6180 8132 4391 4391 4391 4879 4879 3903 6343 6343 4391 4391 4392 7806 4391 4391 2439 4391 4879 4879 6343 4391 4391 4391 7806 7806 7806 7806 3415 3903 3903 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 5367 4391 5367 5367 5367 4391 4879 3903 5855 6343 5367 3903 8782 5367 3415 8782 8782 7806 8782 8782 6343 6343 7806 8782 4391 2927 651 6343 4391 2927 4391 8782 8782 8782 8782 8782 8782 6343 6343 8782 6343 6343 6343 5531 4391 4391 8782 6343 6343 6343 6343 6343 7806 6343 6343 6343 4391 6343 6343 4391 5367 2439 5367 3090 2439 4391 5367 4391 font "Univers Md" menufont "Univers" rules b="Univers Bd",i="Univers It",ib="Univers BdIt" scalable on enter 27,"(s1p" ; "v0s0b4148T" formula "CP*300/7231/8782*SW +0.5",0 widths 2927 !2927 "4391 #5529 $5529 %8782 &6668 '2927 (2927 )2927 *5529 +8782 ,2927 -2927 .2927 /2927 05529 15529 25529 35529 45529 55529 65529 75529 85529 95529 :2927 ;2927 <8782 =8782 >8782 ?4554 @8784 A6505 B5529 C6180 D6343 E5042 F4879 G6505 H6343 I2439 J4879 K5855 L4716 M7969 N6343 O6668 P5204 Q6830 R5692 S5692 T5529 U6343 V6343 W8782 X6343 Y6017 Z5367 [2927 \2927 ]2927 ^4391 _4391 `2927 a4716 b5042 c4716 d5042 e4716 f3253 g5042 h5042 i2114 j2114 k4716 l2114 m7644 n5042 o5042 p5042 q5042 r3090 s4391 t3253 u5042 v4879 w7644 x4879 y4879 z4228 {3904 |4391 }3904 ~8782 6180 5042 4716 4716 4716 4716 4716 4716 4716 4716 4716 2114 2114 2114 6505 6505 5042 7481 8619 5042 5042 5042 5042 5042 4879 6668 6343 5529 5529 5529 8457 5529 4716 2114 5042 5042 5042 6343 3578 3578 4554 8782 8782 8782 8782 2927 4879 4879 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 5042 5367 4879 5367 5367 5692 5204 4066 8132 6668 7156 5042 8782 6343 4391 8782 8782 8782 8782 8782 6343 6343 8782 8782 5529 2927 1076 6343 3415 3415 4391 8782 8782 8782 8782 8782 8782 6343 6343 8782 6343 6343 6343 4639 5529 5529 8782 6343 6343 6343 6343 6343 8782 6343 6343 6343 5042 6668 6343 5042 4716 2114 4716 3190 2114 5367 5204 5042 font "Univers Bd" scalable on enter 27,"(s1p" ; "v0s3b4148T" formula "CP*300/7231/8782*SW +0.5",0 widths 2927 !2927 "4554 #5529 $5529 %8782 &6668 '2927 (2927 )2927 *5529 +8782 ,2927 -2927 .2927 /2927 05529 15529 25529 35529 45529 55529 65529 75529 85529 95529 :2927 ;2927 <8782 =8782 >8782 ?4554 @8782 A6505 B5529 C6180 D6343 E5042 F4879 G6505 H6343 I2439 J4879 K5855 L4716 M7969 N6343 O6668 P5204 Q6830 R5692 S5692 T5529 U6343 V6343 W8782 X6343 Y6017 Z5367 [2927 \2927 ]2927 ^4391 _4391 `2927 a4716 b5042 c4716 d5042 e4716 f3253 g5042 h5042 i2114 j2114 k4716 l2114 m7644 n5042 o5042 p5042 q5042 r3090 s4391 t3253 u5042 v4879 w7644 x4879 y4879 z4228 {4391 |4391 }4391 ~8782 6180 5042 4716 4716 4716 4716 4716 4716 4716 4716 4716 2114 2114 2114 6505 6505 5042 7481 8619 5042 5042 5042 5042 5042 4879 6668 6343 5529 5529 5529 8457 5529 4716 2114 5042 5042 5042 6343 3578 3578 4554 8782 8782 8782 8782 2927 4879 4879 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 5042 5367 4879 5367 5367 5692 5204 4066 8132 6668 7156 5042 8782 6343 4391 8782 8782 8782 8782 8782 6343 6343 8782 8782 5529 2927 1329 6343 3416 3415 4391 8782 8782 8782 8782 8782 8782 6343 6343 8782 6343 6343 6343 4879 5530 5529 8782 6343 6343 6343 6343 6343 8782 6343 6343 6343 5042 6668 6343 5042 4716 2440 4716 3443 2114 5367 5204 5042 font "Univers It" scalable on enter 27,"(s1p" ; "v1s0b4148T" formula "CP*300/7231/8782*SW +0.5",0 widths 2927 !2927 "4391 #5529 $5529 %8782 &6668 '2927 (2927 )2927 *5529 +8782 ,2927 -2927 .2927 /2927 05529 15529 25529 35529 45529 55529 65529 75529 85529 95529 :2927 ;2927 <8782 =8782 >8782 ?4554 @8783 A6505 B5529 C6180 D6343 E5042 F4879 G6505 H6343 I2439 J4879 K5855 L4716 M7969 N6343 O6668 P5204 Q6830 R5692 S5692 T5529 U6343 V6343 W8782 X6343 Y6017 Z5367 [2927 \2927 ]2927 ^4391 _4391 `2927 a4716 b5042 c4716 d5042 e4716 f3253 g5042 h5042 i2114 j2114 k4716 l2114 m7644 n5042 o5042 p5042 q5042 r3090 s4391 t3253 u5042 v4879 w7644 x4879 y4879 z4228 {3903 |4391 }3903 ~8782 6180 5042 4716 4716 4716 4716 4716 4716 4716 4716 4716 2114 2114 2114 6505 6505 5042 7481 8619 5042 5042 5042 5042 5042 4879 6668 6343 5529 5529 5529 8457 5529 4716 2114 5042 5042 5042 6343 3578 3578 4554 8782 8782 8782 8782 2927 4879 4879 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 5042 5367 4879 5367 5367 5692 5204 4066 8132 6668 7156 5042 8782 6343 4391 8782 8782 8782 8782 8782 6343 6343 8782 8782 5529 2927 651 6343 3416 3415 4391 8782 8782 8782 8782 8782 8782 6343 6343 8782 6343 6343 6343 4813 5530 5529 8782 6343 6343 6343 6343 6343 8782 6343 6343 6343 5042 6668 6343 5042 4716 2114 4716 2765 2114 5367 5204 5042 font "Univers BdIt" scalable on enter 27,"(s1p" ; "v1s3b4148T" formula "CP*300/7231/8782*SW +0.5",0 widths 2927 !2927 "4716 #5529 $5529 %8782 &6668 '2927 (2927 )2927 *5529 +8782 ,2927 -2927 .2927 /2927 05529 15529 25529 35529 45529 55529 65529 75529 85529 95529 :2927 ;2927 <8782 =8782 >8782 ?4554 @8782 A6505 B5529 C6180 D6343 E5042 F4879 G6505 H6343 I2439 J4879 K5855 L4716 M7969 N6343 O6668 P5204 Q6830 R5692 S5692 T5529 U6343 V6343 W8782 X6343 Y6017 Z5367 [2927 \2927 ]2927 ^4391 _4391 `2927 a4716 b5042 c4716 d5042 e4716 f3253 g5042 h5042 i2114 j2114 k4716 l2114 m7644 n5042 o5042 p5042 q5042 r3090 s4391 t3253 u5042 v4879 w7644 x4879 y4879 z4228 {4391 |4391 }4391 ~8782 6180 5042 4716 4716 4716 4716 4716 4716 4716 4716 4716 2114 2114 2114 6505 6505 5042 7481 8619 5042 5042 5042 5042 5042 4879 6668 6343 5529 5529 5529 8619 5529 4716 2114 5042 5042 5042 6343 3578 3578 4554 8782 8782 8782 8782 2927 4879 4879 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 8782 5042 5367 4879 5367 5367 5692 5204 4066 8132 6668 7156 5042 8782 6343 4391 8782 8782 8782 8782 8782 6343 6343 8782 8782 5529 2927 1576 6343 3416 3415 4391 8782 8782 8782 8782 8782 8782 6343 6343 8782 6343 6343 6343 5304 5530 5529 8782 6343 6343 6343 6343 6343 8782 6343 6343 6343 5042 6668 6343 5042 4716 2440 4716 3690 2114 5367 5204 5042 -----------------------------------------------.PROTEXT CONFIG FILE Ver D jB .@A:\A:\>----!----!----!----!----!----!--------------------------------------R*8EXFILE DOCTXTASMBASBATC CVTERRH KEYLSTMAKPASPPDPRNSRC2d,(dARNORUSA.LEXARNORUS2.LEXUSER.LEXUSER.LEXARNORUSA.QICARNORE1.LEXARNORE2.LEXUSER.LEXUSER.LEXARNORENG.QICARNORF.LEXUSERF.LEXUSERF.LEXARNORF.QICARNORD.LEXUSERD.LEXUSERD.LEXARNORD.QICARNORSVE.LEXARNORSV2.LEXUSERSVE.LEXUSERSVE.LEXARNORSVE.QICARNORNL.LEXUSERNL.LEXUSERNL.LEXARNORNL.QIC Protext v6.0 Demonstration Version Instructions Introduction This demonstration program remains the copyright of Arnor Ltd. but may be freely copied and distributed subject to these conditions: 1. The supplied files may not be modified in any way. 2. No charge may be made other than to cover costs. 3. All the accompanying files must be supplied with the program. This is a fully functional version of Protext. The only limitation is on the length of documents that may be edited (2K). To use the demonstration proceed as follows: PC: The program must be installed on a hard disk. Put the disk in any drive. Select that drive as the current disk. To install on drive C type: INSTALL C This will create a directory called PROTEXT6.DEM To run the Protext demo from the hard disk type: CD \PROTEXT6.DEM PROTEXT ST/Amiga: Click on the PROTEXT icon. Archimedes: Click on PROTEXT from the Desktop. Further instructions will appear on the screen. Protext Full Version The full version of PROTEXT v6.0 is available for: IBM PC XT/AT, PS/2 and all compatibles with 640K memory Atari ST with 1Mb memory Commodore Amiga with 1Mb memory Acorn Archimedes with 1Mb memory What extras you get The ability to edit files larger than 2K, limited only by disk size. The spell checking dictionary (over 119,000 words). The thesaurus. 182 page user manual including step by step tutorial. 159 page reference manual. The full complement of about 300 printer drivers. The configuration program allowing dozens of options to be set. A file conversion utility for importing and exporting various formats. Entitlement to technical support as a registered user. Notification of new products and special prices for updates. Where to get Protext Protext may be purchased directly from: Arnor Ltd. 611 Lincoln Road Peterborough PE1 3HA England tel: 0733 68909 fax: 0733 67299 Translated versions of Protext Protext is also available in German and Swedish. The German version is called Prowort and is distributed by: Prowort Service Postfach 1316 D-8045 ISMANING Germany Tel: +49 (0)89 966270 Fax: +49 (0)89 965001 The Swedish version is available from Arnor. Protext v6.0 feature summary Word Processing Add column or row of figures * simply move the cursor over numbers on screen to add them up Block operations * move, copy, delete, save, print, count words in block * define a block with keyboard or by dragging mouse * copy line Box manipulation * move, copy, or delete any box as well as blocks Cursor movement * by character, word, line, sentence, paragraph, screen, page, to start or end of text, start or end of line, to line or column or page number, to place marker, margin, previous position Deleting text * forwards or back by character, word, to start/end of line, to start/end of sentence, marked block Displays * makes full use of all available displays including 43 or 50 line displays where available, text and graphics displays Editing * switch between insert/overwrite as required * convert character or word to upper or lower case * swap adjacent characters File selector * large window 'point and shoot' file selection * Amiga and ST have option to use other file selectors Find & replace * very powerful and fast with many options. All or part of text, forwards/backwards, whole word or part, wildcards, ignore spaces, case specific or not, nth occurrence, find control codes, single key for next/previous find * position cursor on a word, find that word forwards or backwards Glossary * abbreviations for commonly used phrases, glossary editor Help * interactive help dialogue Hyphenation * automatic hyphenation * soft hyphens and non-break hyphens Macros * string any sequence of commands together on a single key * easy to use macro recording * load and save macro files * macro editor Markers * block markers, 10 place markers, multiple markers Menus * pull down menus, dialogue boxes and alert boxes, menus may be used with mouse or keyboard. Multi-file editing * up to 36 documents in memory, copy text between them Split screen * view two files simultaneously, variable size windows Status info * clear status line gives useful information including filename, page line and column, marker settings and options, current style Symbols * line drawing *     available with simple keystroke Time and date * enter into the text with a single keystroke Undelete * retrieve text deleted in error Languages Accents * acute, breve, caron (hcek), cedilla, circumflex, diaeresis (umlaut), double acute, grave, macron, ogonek, overdot, ring, tilde. Various special characters such as l-slash are provided. * Sample: a a a a a a a a Characters provided for these languages * Albanian, Basque, Catalan, Czech, Danish, Dutch, English, Esperanto, Estonian, Flemish, Finnish, French, German, Hungarian, Icelandic, Irish, Italian, Latin, Lithuanian, Norwegian, Polish, Portuguese, Rumanian, Serbo-Croatian, Slovak, Slovene, Spanish, Swedish, Turkish, Welsh. Dictionaries * French, German and Swedish dictionaries available. Keyboard layouts * USA, UK, France, Germany, Spain, Italy, Sweden, Denmark, Norway, Portugal, Iceland. Layout and Formatting Document settings dialogue * set margins in inches or cm * headers and footers * document formatting options Footnotes and endnotes * any number of lines, automatically formatted, endnotes may be printed at any point in the document. Formatted layout * any number of ruler lines to define document layout, unlimited line width. * widow and orphan elimination * blank line suppression Formatting * automatic reformatting, format paragraph or whole text, centre line, word wrap on/off, right justify on/off Headers and footers * up to 9 lines of text, different even and odd headers and footers possible, automatic page numbering Indent tabs * indent a paragraph without inserting a new ruler line Inter-paragraph space * you can leave 1 lines between paragraphs Line spacing * any multiple of 0.01 line Margins * all margin sizes variable, separate even and odd margins Paragraph numbering * any number of levels possible, Roman numeral option Preview * print to screen to check layout Spaces * soft spaces and non-break spaces Styles * set up a font name, point size, font spacing and control codes * style editor Tabs * any number of normal, decimal and centre tabs on ruler line Wysiwyg * on-screen bold, underlining, italics Printing Background printing * Simultaneously print and edit Fonts * Proportionally justifies any mixture of printer fonts * Scalable fonts * Variable line spacing * Font sensitive underlining Newspaper-style column printing * automatically formats text into separate columns (snaking) Printer drivers * wide range of dot matrix, inkjet and laser printers * PostScript driver included Printing options * single sheets/continuous, first and last page to print, number of copies, quality/draft, to screen printer or file, odd or even pages * proper quotes Printing styles * bold, italics, quality, subscript, superscript, underline, colours, others depending on printer Typewriter mode * direct printing for envelopes etc. Spelling checker and Thesaurus Dictionary * 110,000+ word Collins dictionary * includes legal and medical supplements * very fast phonetic word suggestion * anagrams and find word pattern. Spell checking * spell check as you type or check whole text or block * spell ignore marker * spell check on/off or change language at any point in text * repeated word and capital letter checks Thesaurus * 43,000 entry points and 827,000 responses * select synonym from list to insert into text * inflects words and gives parts of speech User dictionary * user dictionary - add words to the dictionary or create your own * user dictionary editor * exclusion dictionary - veto words in main dictionary General Features ASCII files * pure ASCII files may be saved for transferring elsewhere Automatic timed save * configurable time interval Calculator * built in floating point calculator Command line * alternative to menu for command entry, previous commands are stored and can be recalled with cursor keys, access to system or DOS commands and other programs Configuration * most features and settings can be configured to your preferences with the easy to use configuration menus Disc utilities * copy files, erase, rename, type, create directory, change directory, remove directory Exec files * store a sequence of commands in a file to enable automation of any process File conversion * flexible file conversion utility for other WP files File sorting utility * with special options for names and addresses Graphics import * PCX, GIF, GEM IMG and Amiga IFF * scaling, centring, inversion * pre-processing of image for rapid printing Index * automatically generated from marked text Number lines * add or remove line numbers Program mode * program editing mode suppresses formatting * auto indent mode ideal for source code and configurable tabs Table of contents * automatically generated from headings in text Word count * quick count at any time * document analysis including frequency of use and number of words used Special options Large character display: 40 column on PC, ST and Archimedes, 60 column on Amiga Sticky key option * Protext may be used with one-finger key presses WordStar keyboard option * for those familiar with the WordStar interface >-------!-------!-------!-------!-------!-------!-------!-------!----R Mail merge and Programming language The most comprehensive mail merge program available. Use it for labels, personalised 'standard letters', club membership lists, and much more: * read data from files from any database or spreadsheet program * ask for variables from keyboard * display message while printing * include file for printing * reformat whilst printing * conditional printing and repeat-until loop constructs * numeric calculations and string expressions including substrings * commands to record information to a separate file * full date and day calculations * operators +,-,*,/,<,>,<=,>=,=,<>,IN,NOTIN,AND,OR,NOT * functions ABS, DATENUM, DAYOFWEEK, EXISTS, FILELEN, FRAC, INT, ISDATE, ISNUM, LDATE, LEN, LWR, ROUND, SDATE, UPR * Roman numeral output - upper or lower case * self incrementing variables * special variables for time and date * mail merge directly from Prodata files Documentation * 180 page User Manual * 160 page Reference Manual >-------!-------!-------!-------!-------!-------!-------!-------!----R System Requirements *IBM PC XT,AT, PS/2 or compatible, MS-DOS or PC-DOS 3.0 or later 640K RAM, hard disk. Uses XMS or EMS memory if available. *Atari ST with at least 1Mb RAM, Atari TT *Commodore Amiga with at least 1Mb RAM *Acorn Archimedes with at least 2Mb RAM Upgrade Checklist What's new since v5.5? ASCII save - 3 options built in Calculate expression dialogue Colour printer support Copy line at cursor Document settings dialogue Exclusion dictionary Extended memory (XMS) support Faster editing of large files Font sensitive underlining Font spacing Glossary Graphics import Headers and footers dialogue Interactive help dialogue Landscape printing support Macro editor Page break key Page layout in inches or cm PostScript Pre-defined standard pages Printer drivers - many new Proper single and double quotes Row and column in inches or cm Save document settings Save options dialogue Save styles with printer driver Scalable font support Styles - editor and menu User dictionary editor Variable line spacing What's new since v5.0? All of those, plus: Automatic hyphenation Blank line suppression Continuous footnote numbering Document analysis EMS support File selector bulk copy and erase File selector sorting options Improved date calculations Improved line drawing Include file search path Mail merge from Prodata files Mail merge nested repeat loops Menu operation by keyboard Page length summary Printer driver path RTF file conversion Spelling checker path Spelling capital letter check Spelling repeated words check Thesaurus Widow and orphan elimination Word frequency list Arnor, August 1993. w 12 point 12 6 24 pitch 24 ``$q$$oI$)JhB?< NA)x| x h9h2(I9AB/@> NA"j)I`A W*j,Jf J-gRMJg"R AfR&MRM Rf Gf Vf =fp#@JgN&IMaJf"JfB` _fj Pfd Bf^ PfX =fRYIJfLrpg:鉰<0e<<9dҀ`<Ae(<zd"<Fc<ae Ҁ`²$W`.Jfg&BN&IAp<}bB0,Ha(N|"@$ p lep@)@)I"`BQ)I`BQ ,o2V@l$)IcB"Y"XI#I2B"2)Ixx" XA"AJfF" leT)A ,|0BAHAR@&,|HCBCHCFC׬|.I/ S// / ?<?<JNAO NNN>`\O ,dg/?<?<NMPO?<LNAJ =f8RNrtB0m| nҁ&ҁҁ҃҂`.g f Jg)Ax NNu ,",\e ЀЀNuN NN$NJ,-NWDHH@-NN"NuH,X,-N,WKlX,W@J,Wf J,-Nfp`p@~J,Wf J,-Ngp`p@A4Nj g"mXm-NJ-g GXF-NEWN"L NuH./ J,XWDHH@XB,WJ,Xg4  f,A쪵NjNNj,p mpFoB,X` @WN!LNuH*H.Jo MN6 @` MN6 @*Hpfp-NjJgp-NJfL NuNVH/.NB,yApNxJgN @N`z NJgNn @N`x N^*@ Hcp MaZ@`| p MaF@J,Wg,W`f rgSgSgSg`.p-@`p-@J,-Ngp.axr"t‚-@Jg r@p.aPr"t‚-@Jg r@pa*gpag`p-@`p-@J,-Ngpar$"t‚-@Jg r @par!"t‚-@Jg r @p.agp.a~g `B ."Ar/ Np MNB,yNXO rgSg SgSf ,HSNF`N` N`NL N^NuH.p fp`@|pl6zpl* Sg SgUgYg AžfЅ` R`R`pLNuNLN.NfNYNNN"NNĊpa/ *op/" MAa^XO*_Nu%s %s .../ *op/r MAa8XO*_Nu/ *op/r Ma XO*_Nu/ *oBp" MaXO*_NuNVH*H.,. G@ @gNp@@B@A@mJ,Ogt-|TaJ,@gp`p n!@fJ,@g <E`p !@AޓNf, g,aJo"J,@g aJk nh.|D`nJg>BV Ma ,VJn a|JoJ,@g@J,Af:aJkaJj(`aPJoJ,@g aJkaJkB,DaJ,@g$ FcA좥N ,FJcA좸NJ,fpG-@-@AVdLSp.NJgp.NRJfR`p.N>JgRp fTK` KN0&@`GAZdLSp.NzJgp.NJfR`p.NJgRp fTK` KN0&@`Jg Jgp`p@k`B,kJ,f ,VAaB,j(,VG SJg>[p.f SJg*[p.NdJgp.N6r,jAj`N|BJ,OfAaNnJaL(N^NuNV/-HpPACNdD.JojpAa&)lf^)@Vo:J,@g4pPACNd.JopAa)lfb)@Z` p)@F)@ZJk|A nCfa.N^NuJ,OgABCf`A좇NmpPANb:Jjp`J,fp`pAa~)lf^)@VNuJ,OgACf`A좖NmFpPANaJjp`pAa:)lfb)@ZNuHlHlHzNchpANaO Nup)@p@@@@@@Nu/ KaJgpNarAgSgSg Yg$r g&Yg*`0|`b|`Z|`R|`J|`B|`:pAq0g*/ NXO)@fp)@pAq0gpRM`RM`f*_NuH/N*@pA@J0frAq0g MN.0&@p -g"pA@J0frAq0g*K`ap@rAABV@m@BA@ MN pA@J0g&A ,VpN`A",VRV`A ,VB0Jga`a :L(NuNVH|J,BgaBn(,H*,tB,lN`"J,g ar`a r.JfNafJ,lg lpCf`NdJ,gr`A쪣"HJfS" A8"HJfS" r |'-@ACfA"HJfS .c CHfHl8HnN`NPOJ,fNf!Je N NAa J,grRJ,g ar`ar.JfN`J,lg lpCf` J,@gAy`An//HnNiO !Je N NAa N`6J,jgp,jFr2,€9AN*ln lnVdp g MN+H*@` MN:N| lnN.J,Nf|QL N^NuH~J,gJ,g HxNXO`N\B,|mJnfN)@np ln(fNJg lpN)@n`(N+@)@nJ,gp lnfp(rtFgp,N_0*p,N]( lng g,Jf,aJg$J,gaJgRfJ,@gap`bp ln([@g*Q@fFNTJgFN]Jg|l`6 lpN)@n`J,gp ln(rtFgUn`hSn``pLNuNVH*H~*,VA-HJ,gp`pN]( nfZJf ,PR`pfC)Irp`"pf(-(f(pfC)Irp`TTMU`RRMS`pJ@g [@g Y@gY@g@g@zg`$-@J,grpFЀfp`p.rHҁg2r N)2Jf$p.rGҁgr_gr fJ,gĺVgTM`-r@pEЀf VgTMJf ,PR MN R*@`p.rMҁfrdc ,PRN &@ " n*K`J,gHVgBRM`t ,PR`hp -f(dc ,PRN d @G " n*K`8 nJfp gJ,g"pC@J1fpCq1fp`^pfp`p, Fc* Cv# ЀCrf CRpf)Mrp` RS`pL(N^NuNVLH74J,fTJ,jgp,jFr2,€9AN d*ln lnVdp g MN' *@` MN N @ lnN N $ lrdcN @C IN , ,PRr`"ldfN @C IN J,f, ,rn-@NwN j @)Hn)HrdePC IN 6 @C IN N J,Dg8N[ . lnN N r op`p)@ ANZ8-@NYv`VADN 4NZN NYl-@p,K".Ⰱg(p,Lg g gpXg fNY"N z .g_g rgV` .NZ`Hp,L".ⲀfJ,Cg <` <NZX`J,f"~ ,rn,*ln SJg r f~ Fcz-EB .Zddr@ҁb\AJ0fJgp nNXW-HN KCRIaJgPp.WN Jgp nRNW` p nRNX nR-HRAN"lraJg nNXW-HN` ,rn//,nNzPOJg4/./,nN)@n . K"ln`Sd . lnC$NXPOJ,f ,bJnJgN N)@n`NJ,f .Ѭn ,bJo lnNJB,mJ,f&p,K".ⲀfJ,Cg <` <NX8L,N^NuH*H&I Ud,pC@J1g pAep`p fT`N#(*`pL(NuNVH/~,@JgJ,gN`NB,Jnf8J.gN @`N @)HnJ,grfr(ttFfTnJ,mg(p lnfN Jg lp)Hn`N")@n`|mp,NW*p,NU( lng g,Jf,azJg$J,gazJgRfJ,@gap`Vp[@g$Q@f@NJg@NU Jg|l`0)lpn`J,gp ln(rFҁgTn`tRn`lpLN^NuH*lrpfp-NVjJgTM`pA@J0gpAdpAq0fpfp-NTJfl*lnp-fp-NVJgUM`p -gB MN! @pA@J0gpAd(pAq0fpfp-NTpJfp`pL Nu/ *HJ,CgJ,WDHH@B,C MNn*_Nu|CJ,WDHH@aJ,WDHH@B,CNuNVH*H.A-HxB MCfBfJf ACf n-HJgCcAHNp?fR|p!f n-HpJ@gT@ gW@g"S@gFS@g[@gW@gS@g@gS@g@@ gS@g@gU@g` n-HJgp$fz`prAq0Jg2prr`ҁЁ*` n-HJgpNRrBg,Sg,Yg YgUg$[g[g$Ug`z0`Zz1`Vz2`Rz3`Nz4`Jz5`Fz6`Bz7`> DR   DR  Rf`z`z`z`z`z=` z#`z*`z DR  DR `hAUN` DR"n-I"`D n-Hp@-g6@5g>Y@gU@g`S@gXU@gU@gVS@gU@g|W@gS@gW@gnS@g` n-Hp@eg@fz`Hz`Bz `< n-HpAq0g *P`pmfz` DR  Rf DR `jz` DR  `TpAq0gBACNJg0 DR ."p fRfp nCq1gR` n-Hp@ngF[@gHS@g`z_`PpAq0gB nSH/NXO DR"-@r fRfp nCq1gR`prAq0Jfp@f. DR  DRp/HNPrPҁЁ"/`8 DR `*pf DR  DR ` Jg .)@F`)nJ L N^NuH*H.|lp5hfR`p5hNOhR`L NuNVHJ,fBJ,g-!-----------------------------------------------L----------------------------R %s %u %s , %u . %uidxtoc.-----R TOC$$$tmpBp,5gANQB|)|NuNe>JTg,5gA쪍NQta8JPgZAa"|A& lpa lPC,N0 lpa,5g( ,rfA`A쪅//HllHzNGnONuNdJ,fANPa,5gNNu lPNPBP lpaJ,g AIN`AINPNuNVH*H g: Ua mNE-m Jg n-PNE-n`&m MNE*K`L(N^NuNVH4*H| g4 UaHx/-NE$PO&@ gRKp gp a Kap a`: m,&gA&a mP&ap a mN @Jfp a~-m Jg n\H-Ha n:(H a n-PJgn n8(HC R-I⸀b$nfJfg$Jg aP~Aa2 na* a8`Jfp-a~,-n* n-P`Jg a ADa*m`L,N^Nua& lbBp,ND@rIf,rjf|JAaA)HbB,\NuH*Hp g MNJg MNl*@`Hx,/ NCPO&@ g$B < Ma>Jg. dma , MaJf dmaaZL(NuNVH.-HKpB&U gZp n"ka n,JjR*K`JoK`p n"ka HJf`r n"kfJfl K`A*H`pND&@Jgܑ'H&'H nJfS RNC'@f KNB` n"kfR* gp(AtC쀝a 4A -H n-PJg* n0(HfC/ HlNlPOJgB-n`A쀝"HJfS PNC` n -@Jg @B"1ACA쀝fp`pL(N^Nu/ ,~",̲gj)@,5g^JfANAJ,fANLANA|A"HJfSA$HJfS " ЁN_/,HzN_PO$_NuaA"l^fA$Cf`&Bp,NAX@rIf,rjf|JAaXA)H^B,[NuH!*HpA@J0gpAd\pAq0fLp-gFpfa~pl( ,(S-@ .SJgp-a`p!aR` ,("-A .SJgp-a`AaL(N^NuNVH*I.-H| nJglp-@r&gr!fz&HR@pAa..N^NuNV/ *H fp` Ua/@ ma"/ҀR *_N^Nu lpa)@pNuNVH*H g^ Ua* ma+@ Ua. ma, ro&U* Ma'@ `& o-m n+P Ma n ` L(N^NuNjN6N+XN[NN(N6N3NUNFN!N+NnN.\N N N$\NmN%4ldK<%s> %7ld %02d-%02d-%02d %02d:%02d%s.%s*%s %s %s :\ %6luK %6u %sN3 NLNuNPNLNuNVH'4*H.zp-lP@T@UN1pf a MC`fA`N1b,Jgp:g pN1Jg>HzHn`N2POJf |U`p:fp.`N1rAN3$@U`A`NOH&@p.f"+g*A/H MNO( @"of.ar:f&p.`N18rAN2@UgA`N2f@U` A`N2X@UJg/,Hn`N1HzDHn`N1ON2~Jf A`CNNRAC`fN2\Jf,.`frAgrBfN0A`NNr&@p:+gSKBHn`HlmHzN1p l+`()@pAaO Vg SgSg~`(B.THlHzN1PO`B.THlHzN1PO`|TJ.TfBLN1Jf8p-@H .HrnrSfpF`pAN0R-@DJDg nD(g p.(f`pHgCE(f nDh5-h6=h<=h:B.>JLgpfN:l` .L",NN*N/:N/Jf A(aRL .LmBLR nD (ѬN/-@DJDgDp nD(Jf`2RH`pgJf:BL .LlfN9N.Jf .Lav/@  oaRL`pf4p-@4-@8-@DN/U-@,W-l<-@0J-@2JgHpOANJHzNI0XOJf&a-@.Jfp`A칭"n.f n.| HnNHXO n2C7f n2CPf Jff|`|JfJfp`p* MCfANHA"@fpFAN+$&@N,JJgp`$ gB.-+g0Bp.+gFJfAHn7/a'&POJfr`rA-`"JfAHn7/a'POJfr`rA-J.-gZ+fRJ,f+fDaf-@.Jfp`A"n.f n.k +!@1k1k +ѬN)&@`4Jfp`J ,N*)@fp`6-l.BV .Vl l!. n.-h.RV`a pL(N^NuJgJg ,r lCNyNuNVH74*n&n -M-K"n Q( n$P* prHҁfp`pfp`| ,rf"$ &.Jjv`v `Xgf6p`Dgp`8 ,rf$"Q").Jf`Jjr`r ` pfHzHnN)&"n Q./N)Hx.HnN(LO-@Jg @B"HJfS-H E`SdHzHnN("n Q./N(Hx.HnN'O-@Jg @B"HJfS-H E`SdHnHnN'`Lpf0"n QC$n RE I"JN'H.Jf` Jjp`p`"n Q$n"R/ /a L,N^NuNVH/*n&n @JfJfr`r `J.fp`pN'Tr./@ N'D"/*p.fr`rtA@0"..r.fr`rpA@0",gJgJf ` `JfbJg\ L(N^NuNVH?*H.m JjDz`z MC칭fJfWDHH,J-gNDj MCfHx.HnN&RPO&@ gBHnHzNDPOJg.A칭"HJfS rc"HJfS r N&`2Jgp `p.r NDn gA/Hz~NDDPO`AhN& pg.gp*`p r ND2pf>.gHlHz@NDPO` <Э"<NCJ/Hz"NCPO`pgp0-"t‚t4văv6pPր -ArdNCp0-&x8p?Ȁ-A-B-C-D.gHlHzNCfPO`/-HzNCVPOJg pN%``N$Jg$SgSg6`L/././.HzzNC O`2/././.Hz`NCO`/././.HzFNBOpf/./.Hz>NBO `.gpR`p-r NB.gpH`p-r NB.gpS`p-r NB.gpV`p-r NB.gp,`p-r NBf.gpA`p-r NBNJ-gNBhL(N^NuNVH*n|,|N>VaN#.p//prNB8POJg lNA‘NA)@N#NsTHxHxprNBpNraDa$N#)@N$8Ns&POJf<|J,gK`.J,g$JfHlHzHzHnN-OK`Kn/ a&@aaXOJf ACfJ,NJg lNA~ lNAB`Nr/N@XOJ,NgN#E L(N^NuNVH.z ,",NA^(a|aJN#f|lF a ,Іl&a/@  oa 輀lpN"R` ,UN"R`|a ,A쾘/0HlrHnN,O J,gA"HJfS Hl/N,POJ+`g l+`J(f>A"HJfS /HN#"<N?b/Hl//N,`O ANrNqaP LN^NuNV/. ",N?$",N@6/@ ",N? /N?.N^NuH*H.N!Lp Ma,N"pfp` a axL NuNVH?*n ,a MN> @CfAa N"Jgp` p-@P)@ ,Aa~.-nPBB,N"bJgp` xB ,JoN ,ЮPaF&@)K KC칭-HHfJfWDHH@G .PaN!$ ,D KaN!8N * N `* ,Jn g g/HlN POJga r2 AN z:,rKf f*<  f*< JgSgSglSgNSgFSgSgSgaPJg *a4 ,aJf .>)@an` ,ad ,ro0 .P",N<",䰁m ,N="Ѭ ,",N=PpgNn ,Aa.` |R`N * g p` + gB0J.Gg"HlHn5NHzX-@0aNO @A`/.HaJ>gJNvJfB n>J(g,Hn/HznHnN%Xp.FB/HnaOJg n>-h>`aj`ab`ACfJfgAC"Aa aNja ,Aa.`ACfpaVp ACN,JktNiJf,J,gHlHzHzHlN$O`A*C"`AN7 @CfAazahNivaB ,AaB.BP` az`NcAa@a.NiaJ`paHzabXOJg"aNha ,Aa.a`a`aJgp,LANVr2p,Kff-l>a J>g n>J(g B/aPO n>-h>`anNh|a ,AaL. ,ЮPl` p)@-@P`J.Gfa j nHCfHnHlHnTN# p,LATNO r2p,K-A>ga`+ g nHNX`HxHnaPOaNga ,Aa. ,ЮPm^ .P",$ԀgNSPlFJo ,葬 ,a.| ,S-@P` .P",N5 .>l l p( f|R>` ,a.` .>l( l p( fJ(WDHH@R>` ,a.`+ gNf`J+WDHH@ .P",$Ԁ&,(SgRP .PmЁl ,Ѭ ,al.| ,S",N4-@P`| .P",N3PB .P",N3-AP ,a".`J .P",N3j ,萁SѮP ,",N4l",Ёl ,Ѭ` ,ܐS-@P ,a.` ,",N4.",Ёl ,Ѭ` .P",N2 ,S-AP",N3ѮP .P",Ҁ$,So ,葮P` ,a\.`N2Hn*Hn.A6C2NeJPOJgpf <Nf`N .6",$,2&..-A>-B:mN .PЬ谇lp-@P` .>JjN ,".PoP` .:Jk:",谁l2 .>",N2",N3Ю:",Ҁ-@&l-@P`NR` .P",N1R",N2",Ё$,ܰl ,ѮP&.Pց(SoS-BP$S&.PoXѬ ,a . ,葮P|`: .P",$Ԁ&,贃m&Pl Jo ,a. ,ѮP|a:J,f .B".PgaN< ,ЮBa/@ , o a`tL(N^NuNVH*HpOAN1ANr@r:gr NNJf/,HlNPO/ HlNANG K"HJfS *TNNp.HxrAN1FN1*O (.JjRKSR`JjR ,Sm p2FN0`/ HzDN0POSm p2FN0`L(N^NuN p//rAN0PONuN HxHxprN0N PONuaNNaNuNV$H4*H&I-H(-H, MCfHzRHnNxpFAC4NPO-@0J0g n0(gp.(ga-@$JgJ(f-@( n0"@f n$!K&Jf'HJ,g "n,#H"!I-H,"ME`f n0/Hn`N~.Hn`N~A`"n$aO n$ (ѫ (ѫ`(f(f R (ѫNJgHxHlN8POA4Nj-@0`L,N^Nu/ ,r*N/ l*HR ȁe A5Np`"+H+H+H"+H&p+@+@R *_NuNVH'p)@N`>J,fJf < N)@JfpdЀr*Nz)@JgJf ANx`(p)@)@aF*@A"MfN-rAЁNACN|THlN$XOJf l"Ma`N.`p)@ MaN.|N"<N-P-@N_j~|a:/.HlHnN/a :N^XO` ІgSlS|p"N, RraN ra`fN,*HnHnACN^PO ,",-@HްlJjNp` .Jkl"Ҁ-@ʲd,`ND .rg f`"Jo ,Ul~ a |` ",Ё$,b Uހ ЁSe. a Ї",e,S|`z І",$SgjR ,輀m`$ԇdXRSSrAN+ ІSraN & Іra`.~| ad|` ,",.,S aF|Jf .漀grAN+H ЮraP`Bp`BpL N^NuH.|l Іdp"N+ Іra R`LNuNVH.,  l*p*-N tN*(p N*xl:&M-D .찅l &k&R`J"gpLFN*p N*`A,N nR`Jo"J"gpnNNNN :NNNKNN"8NnHN>N$NNNNEN> JlgAlN J,zgN NB,zNupfdpfxpfpDatabase does not existData file corrupted. Please re-copy from original or rebuild originalError %u occurred opening fileIncorrect password.PFPError reading PFP fileOld data file. Use Prodata v1.10 or later. ErrorEnter password: NVpH'*n.z MCN MCN-@gH @N MCN MCN-@g( @N MCN MCN-@g @NzJfp`p MNL MCN(Jlf <NT)@l9|paJ&@ f&|pЀl" ЀrA@0hJjVAf1R`|0p9n Ѐ"t4҂Af1R`Blf9|b9|dAf)H\PHxHx Hx N,O J@f>|zHlLNXOJ@gH0,Zr AfG`rAg rAgrAfG`l0,ZH/HzHnqNfO Gq`NJ,eg9|.a l.lG f,p-,(fr+f.`f.Gx|r)l8tB| g KNXap`pL(N^NuNVH/ACfACNACN )@*fp`a*pAerKbgaaa@eaar2)A$aaar29AX)A4aaaaazalavaran~JGk* ABpr"l*Nh ABB0SG`~p@la2a.a*RG`~p @l HЀ/@aA0"/1RG`~p @l /@aA4"/1 /@aA4"/1 /@aA4"/1 /@aA4"/1 /@aA4"/1 /@afA4"/1 apalRG`P <`r l*N,a8a4aJ, u1fa @(a2(ar2-A Nf <r l*N~ H4l* "HҁA040ADC4# RG`ar2)A8 r l*N <r l*N~p(@lR /@aAD"/1 /@afAD"/1 /@aLAD"/1RG` l*(f` K`K l*N L N^Nu l*NNuaNu/a~arp0Ё.Nu/a~>ar2HABA Ё.NuHJlZgp`J,rgB,r ,$H/,l/NPO` ,$H/,l/NtPOJlZgp`p0,p//,lHxNO 0,Z @fHHxN`XO, @,FAlN*p0N)@l r2//,lHx9@pNHO JlZgp`2,xr?g llgp`p.Jg0Bt llVH)H|pLNuHaJfp`@p l|rFg*H MJfS .R߬|`KtRt ,t8mB| L NuNVH#NpALNB,pANl,Nl|Jjp`h9|.~plL 爐ABJ0f.Jf0 9@.`(Aa<"牒ABr"@Vf 9@.R`2,.JAZDHHLN^NuH*H|prA<Q MC<f.plpA<0xR"N,R` ,~pl" R"N\rA<0xA<xR`A< L NuJtg )l8tB|Nu ,t8lp`ahNuNK|NdNvN{NN84N7.NmN9NlNNN8N4PNNq"NcN|NbpapNu*.* %s pNuNVH>. , GWDHH@J,fJ,f0<`p'(f0<`NJ,1gNB,qp@@a0@N&,NDNNErN ,",HHJ.g )@)A`B|Op0av*B,O/NXOB,J.gBaXODJ,qgN EVDHH@QA"llf `p0 g Ef <`p0LN^NuNVH. GWDHH@paXN)@f Np`\N|zz*llJg ;@p MaBڀ S;@` S)@Nܗ-llxJf Gf=|Y`NCpr2=@ Nv>,=@0.@g$S@gBW@gbS@gdW@gZS@g\S@g@fX|`JgL n0(HSHl8)l`0Jg* n0(HRHoB` B`)lp0. g BB,p`Ba Jg|pJf$*ll-H-HJg<0-H",m0-Hn-Mp0.NuNr2-f-M``Jg-n`Jg n-H ng* gN\p KaJgN~p na&n|Jgn0.r Ag* @g$r2 Ntr n2(g J,pfJ,g:B,p nar na,NBva$JFfJ,fJ,pf p naFJFgx Gfx`Na (B,z L(N^NuNVH*H.<-zNH(&Up-@0-HN(p N4@Jg .rN sJfS-H-gR .κo"`"*R`ZTp-n2-H҅S-@-A .మmS` ."R/./-A ".N:NPO-@g`NNBp"aNO XOB .rN>Jg8 .RrAN .rN Kp r/ ra2XOR` .R/p"aXO&H-HJfBJ,pf< f m&Hp2-HR)@)A`R Ka Jf JfBN?>. Gfpr|)@AAp` G f J.g|`j Gf" m&Hp)@ KaJfVR` Gf4 f m&Hp)@`R KarJfJfp)@` Gf m&Hp)@` GflB l f&0-HR m&Hr)A)@Jg R` g( mf p)@`S KaJg`R` Gf.p2-HR)@)A$,o)@rvApC`X Gg Gfp",tv)@)ABpC`. Gf*p2-HS)@)Al)lrtApB` Gg GfpB,p|)@)@`-mp @gd G g^ nJgFp0Np*r n2(tF‚/@ Np"/f"n iNJg&n`pѮ`aJgp|p`h gdp0/ KCaXOr2-A+g<+g,`,N NKp r/ r Ka4NKXO|q`,`Jf$0-H",m0-HnJ.g|` ,ol .",om`pN m&H" WDHH@ KaJfJg,g&N 4NJp r/ r natNKXO g6g0 ,rAN NJp r/ r Ka:NJXO-K`N VAa, L(N^NuHxHxp"N PONuNVH'.HK,U"n Qp-fJg\-Sf`P n&PJ. g(g| p(N~Jg"p n(",/A°gV|`Np n(N&Jgp n(,/f&p@`p n0( rr,/fp@`BJg8 hNJg. n(g hNJf n(g` p `p S SJgLp:f@ KJfS Sg Sf MRMp>fpPF`pJg`|`S`Sg Sf BNpN@pLFN:d"n iNJfNv` J.gN$B.p n0("tF‚t4p A"<NK-@JgbpNlXr.fFJ.f@"n iNJg2JgJ-fN|pN9NV`pN9S`pN9`NJpLFN9N9 J.gNH L(N^NuNVH.,*.K(U MRMJgpmЀ`p`Ѐ SJg` MRMJgp@F`p&FBp"NtNpN:K@Jg pN9RM`N8|J.gNGL N^Nu/ *HJg UN UNB*_NuJg lNz lNBNuNVH4*H&I.Jm g<- `|-gJgNeNJgj-gb-m KaN8N n"n1i"n QJfS$n0*H"ЁS3@r AVDHH@pfB Ia`F-f-f Kaa*p l˶(NTJgN|-gNxB,A -g-mp-rF/ nNXO`\-g-mp-/ nNXO,`:-g /-NhXO`&-g /-NvXO`-mHz nNXON$N-f-gaJ,Nf-gNjB,RNE`J,Nf J,g|RNN7@ `( KaaA"llf `p0N7 << L,N^Nu/ *H gJg Up-g mNJgr`r *_NuHNP.,,, ,f ,g ")@)@)A)Ap`pLNuHxaXONuHxaXONu/./pfA)HlpfA)Hl|B,.Nu/,B, .NuNVH*H&I~J,Of,pO M"nN*rl. KNpO nN.Jjp`Jf nB"n a`pL(N^NuNVPH*H&IJ,̖gJfG KCN$,zgNCNCNBB-@TNpNR.NCNNNDHn^/ HnNr,NxN\NNC| nTNp l˶(NQNCOJgNCJTf N3V|xJfp`0.^fp` J.gD.r:fp.Ng(rANC2AN @C`fA`N @BHn`N"XOAN M"@fA"Mfp` KCfp,/HnNJPO-@Rg`L(NuJ,A f ANNNuN2N`NN#NZNNN"NNVN>DN^NeTN!NeNN"N3NNN~NN~FN3hNٞN!\NNhNVN"jNrNgHNNN,pNK8NNNNNNNNNNNNNNN(N~`N!NNN"NNN, Nu:^Y%s:s^X%c -w%-0.2f -h%-0.2f -c -r -x%-0.2f -r%c -o -i>IB %s>IG ib*.*%2u %s %s%c:\ A: N:(NET) N:(SUB) %c:J, WDHHNuJ, WDHHNupNu,WDHHNupNu,WDHHNu,wNuJ,wWDHHNu,Nu,#LNu,{NuJ,{WDHHNuJ,{g J,Ygp`pNuJ,{g J,Yfp`pNu ,LN0Nu ,$N0NuJ, f aJgr`r Nu lCۏ J1g N/Jgr`r Nu lCۏ J1gЀAۀJpgr`r Nu,˭Nu,#Nu,$Nu,"Nu,#Nu,!Nu,ˬNu,%Nu,XNu,-NNu0,WDHH Nu,Nu,Nu,Nu,NuJ,$WDHHNupNu *,TDHHNu lCۏ 1Nu lCۏ J1WDHHCۏNuNVTHzxB,t~p$n AXp R`~p$nZ"A*&p" gJ"n AX"H"p@f$J+8fx "AXC$lfr`r o*R`p$lJfR AXp x|~npn rNA.*H`|t rNA *H AX"H"JjDJfC=*C+Ipf UCufHzHluNK*POAu*podx``  A*&pJ+gA`A5*C$lfCufHz8HluNJPOAu*J+g Al+H`Ar+HAZ+HA-+H;| ;| @RR`J,tg^~Jo( rNALC. 0S`A솶CL"""""""2)H, rNtC #` rNbA.BL(N^NuNVH74zpB,1|A-@-@pZb0 r N,d&@ gJgR KJfS \ѮR` l0"N_B0"Jg .N_)@0"J0"gL)n0&B|ApZb@ r N+&@ g$Jg l0"// Hz/NORѮR`p-@p,-@p d. rNvAp(",ɜA°fRR`B&l( gJg KRKJf KRKJfR`zN+ Jg& rNRA"HE"""""""2p-@JgTJgRJgR .ЅЮЮ".ΰe6 rNRA"HE쏎"""""""2 .rN)Hp,&l(-l0"-@-@-@ .κdB. rNZAC#rA1A1 ".SfABp.-@`, .ڰdJf |`Sf( rNA"HE"""""""2` rNA! nRJf rNr n($A1r n($văBAA1 r n(ƒ`A1 R`^ .ְdJf |` rN0A! KRKJf*KprAq0JgJ+fr N\|rPҁЁ`p. KRKJf rNAJg"A1 rt‚@A1 ` rNA!A1@R` .ҰdJf|p.-@`x rNfA"H/@ Jg^"Hr)tpԂt&H$,ɜC̘ı8AJf, rNC / """""""2RR`R`J.g" rNAC 0R`Z rNABL,N^Nu/ *oBN <N)XO*_Nu/ *op'(gN7>|OHzN'XO*_NuNVH*n&n n"Sf U X nJfS RѓL(N^NuJ,f HxN&XO`,AN&Jf HxN&XO`HlN&XORfp`pNuNVaJfp`pN^NuNVH*n&m k -H gJg PNZ> nNZ6B L(N^NuNVH*n&m-HHn-HN&XO-@Jg'@ B .'@ .S",b '@0,2,Jg p@@^J,g Hn/ a(POp0,'@p0,'@p0,'@l'^l%nl&lNp`pL(N^Nu/ *y_p0,+@p0,+@*_Nup9@9@NuH7*o/#/'zJ,Mglp0,N%>$<@YvN%H4:p0,N%"N%H4BJg prH4:JgB4BB4F/,4V/,4R/,4N/,4JHl4BHl4:N&O`|L/ N%XO*B,LJf^Jg*L4B$XO|JfJg4pr/// aO *JfJg/ aXOJg/ aXO L NuNV/ *npaй^P/HznHnN Hn/ N@p*nN^NuNVH*n&n -m~A"Kf/ a4XO.J,gHz"/ N@Hl/ N@~O/ a.axXOJ,'g Hz/ N@\PO L(N^NuH*o|  lpSH MJfS. T//,pN#>&@  M"K`Sd x xN!N!POL(NuH*o HlHz~/ N.an..aO L NuNV/ *nHn/ aPOJf HnN"p`p*nN^NuNV/ *nAC"BHn/ aPOJf Hnap`p*nN^NuH*o &oaBJf ACfAN!ACN܎A( L(NuNVH*n&n / af"HzNXO-@g @Jg Cfap f / aXO@p0,'@ap,''@hl%nl&J.g J,g/ aXO@` / aXO@J.gVHy_aXO'F'E'nn^'nn^nnpN-HnNN-BN+2L(tN^Nu/pa2.J,Ng GgN0 rB/NNPO`p0.NuNVH.p|BnB.-@-@NpZ/HxJprN벑N)@VN"/(Ҁ T-A$.Դn T$-B.'VDHH.'VDHHЃvƮ$VDHHЄЄHvo&S/@$ "/$NfN"/$-@N|Ĕ-B` p-@-@rWDHHZ"T-@-AJfN*JjR-@NU".貀oN".АU-@J.#fp`p.#fp`p)@p)@".X)A".Ү)A" g Jg)M` " gJg)KBమf4 KJfS ".$R n!B!nR p!@` r n!Apr®$-@JgF.'g!@!@".!A`r !A"(Ӯ".SJ^DHH".ԁծ`r !A.'g:!@".!A$.!B"(Ӯ".SJ^DHH".ց׮`r !A.'g:!@f".!An$.!Br"(vӮ".SJ^DHH".҃Ӯ`r !Af.'g!@!n".!A`r !A"( Ӯ!@>!nB!nF!nJp!@P!n \!@X!GT|NJ,g!n,L!n0H!| &9|` p !@&9|A얊N-@J(g n(0 f.'f f.'f fp-@` n (P-@ .L(N^NuNVH., R-HrAN\ R" n/0/HzHNTNBLN^NuNVH..,. *.(.*n// "NfNp,L/Hlv/N`O r2p,Kf nN|aAT `pL(N^NuH*o &opN=Hl&NdaNuXOAT L(NuH*o &opN=Hl&NNuXOpL(NuNVH*n&n m"hl-H-I (dJo2 (` q"HJfS-H rc <NX nNpL(N^NuH*o &oBNXOJg a&AT `pL(NuH*o &oHl&NXOpL(NuNV/ K0 aaA1+H@p,:;@DAC*p,H;@p,H;@4A+H\p+@Tp+@Fp@AN+H`r,X;Adr,X;AA+H+|@A+HA+HAF+HA+HLAN+H|Av+HA+H A+HAY#2|^A2ړN8 mlNC**_N^NuNVH4*n&n m-H (dJo^ hl"n )`-H n p$i\f"n iB )` n/0Nt n.BC? /1NAH `pL,N^NuNVH'z-|0 n*hl g< (`/5NXO,z n (dJo UNBV"n ilNBJ n!Mlp.-@ .r@ҁlA? JgRR`Jo NB(*@Jf N]2p` ЇNB&@Jf MNAN]p`p-K-@-@ .r@ҁlA? Jgr/./.N PO n-H-H nJgr g "n-IR`p n".$ n+(RZJg".⼁n n!n`*R`n n!Ml!Gdp!@`!@hJg!@`pL(N^NuNVH*n&n m"h\JfS\-H rc /(\N"n iNLa2AT `pL(N^NuNVH*n&n m"hl-H-I (dJor (` qJfS rcVp,L n"(`/1Hl/N[O r2p,Kf& n (` n/0N N aAT `pL(N^NuH*o &opN8Hl&N \aZNpXOAT L(NuH*o &opN8Hl&N NpXOpL(NuH*o &oHl&N daXOAT L(NuH*o &oHl&N XOpL(NuNVHG0 aaA;'H@p,B7@DAI&p,M7@p,M7@4A'H\p'@Tp'@Fp@AN'H`r,X7Adr,X7AA'H'|@A'HA'HAD'HA'HLA'H|A'Hp '@A'HA'Hp,7@Ai#2|^A2ړN *kl g UN>n MN>hL(N^Nu/ K0 +|Ep+@f <+@+@V+@+@A+Hp,;@B-^+Hlp+@`+@h+H0p+@F+H*_NuHK, ,LN $Jf0,"A9A,VDHHA,VDHHAN,VDHHA~,VDHHA0,WDHHA0,WDHHA0,WDHHA>0,WDHHAn0,WDHHA0,WDHH@A/N .p fN ,mmNm~mJ-fp`pJ-fr`rJ->fr`rJ-nfr`rJ-fr`rJ-fr `r9@ N 6N~L NuNVH*n&n m-H nJgpf gp`p@p0Ѯ`A\ L(N^NuNVH*n&n m"l˶)>-HJfp?`p.G ,LN:Jf n|"l˶ihN"l˶i<~"l˶i=WDHH@WDHH@WDHH@>WDHH@nWDHH@WDHH@A\ L(N^NuHK4apJgJdfNp+@6+@f+@+@&+@Vp+@p +@| r0Nl|Jg r0NlnXR`p)@dX8fa,@Na*@~a(@a,@>a*@n`XJdgJp +@6+@f+@+@&+@V+@p+@| r0NlJg r0NkYR`Y8fBda@NJgp+@va@`p +@vaמ@a׮@a@aJWDHHA.a@^A8VN".p fa*JgRa<-NgNa2-~gNa(-gNa$->gNkta-ngN`a-gNbNJga6-gN|a-޲gNFa-βgN a*-ga.a-^gN#pO"n i\NӪ"n i\pN8&"tA҂g/Hz n/(\N|O N$Ah L(N^NuNVH!*n&n -m n (rNi6C(.1Nd NJg>pO"n i\N "n i\pN7"tA҂g/Hzӊ n/(\NO NAh L(N^Nu/ *o/ aNN&N-LN4>NN|NG6NNNZ4NNN(xNNƸNVN6NvNrN$NNNHPNN~N0NN:xNQN NNmNN N* N?N12NNyN>NNDNNNNNRN :NeN$NN0@NFNpaNVH*n~p fRM`prAq0Jg*r:-f"J-gr -fr N1rAa v`vHx/ a"POpOANANaAC,fJfgDJf,J+`g& l+`J({gp,,rAN bHl,NXO~`ANAC,fL N^NuWarning - drive/directory has changed .TOS.TTP.PRG PATH%04x (%u) bytes USED at %08lx%04x (%u) bytes free at %08lx Total bytes allocated = %08lx (%lu)PATH=%sNVH*n~|,zr*gr#fRM-MpOACNa\Jo nr gr fR`a6aN ^N N pN~J,zgJgN N N XA-H-nBHn/ar.NvN PO,zgN p l˶(N&N N N NJNKg A욉NZ` JjAwNL L N^NuNV H/4*n&n ~~zB fp`Hx./ Nv:POJWDHH(B.v| JgHJoHz@HnvNbPO //3HnvNJ^O  sJfS Rl~R`Aw"HJfS @vHxK/ Hn&N.O Jg SAx/0Hn&NPO`zA&NRfpf`/,pHnvHn&BgpK?NAO)@L,N^NuNVH*n&n / / aPO.pfJfHx:/ Nu POJfp,// Nu POJfHz,N>XO-@Jg nJgA-H nJg6r;g r,gr fR`A"nd n-IR`A"nc,)g-IB/ /N.HnaO .pgj L(N^NuNVN 0N N N `N N\RN xN nN N Ĵg ,dÂN^lN > ,˺A˶N^\JgJ+`g l˶"H)H+`NNB,0N^NuJ,BgNNJgN'tJgpNKDJTgN~N]NuNVH*n|G-l ~Jf&k g ngZ Y܀pN,rUf* n YC/ //HzN] nXHpNHONsJg~` n"n-H`Jg/ //Hz`N]hONrJf K-H`dJg//HzVN]@O L(N^Nu/JgJ,̐fJ,f|N&fB,`J,f&|HxNXOUWDHH.B,JfJ,BgJ,̊fJ,f|NM"B,`\Jg*J,̊f$J̌fJ,̐fJ,f|pNIB,`,JTgJ,̋fJ,f|NB,` |0p`p.NuNVHJpfp)|t&l`*S g MJfS RѬtXK` ,tN*)@pg:&l`-@*S g&Hx=/ NqPOJg n-H MRMJfXK` nBL(N^NuNVH*nJghafJpgHx=/ NqRPO-@Jgr MJfS .R N*j-@JgR M"@f&lpJgr-n-KJgZ nfNr=f@ KRKJf lpt " // /.NDO &nJg$/ NXO KRKJg`RKR` KRKJg` nJ(gA pЇ,teV r@ҁЁ lpN"r-@f nN)`)np r@ҁЁ)@t nJg/NXO nRJg`&n n"KfB3x/ NXO` /.NXO nN) `,-l` n&P gHx=/ NoPOJg KNX`L(N^NuNVH*nJg/ HzNHnN~|Hna0O`,HzNXO&@ gJg/ HzNYPO` HlNYXOL(N^NuH*H.p l˶"MIapL NuH*H.J+`g l+`T` l˶&Hp M"KaPOJfHx:/ Nm.POJg `A-O"Ka/ Hl-ONfPOL(NuH*H&IJg RKp;g`,-gB L(NuH*H&I MN.Jg,✾g /,/ NPO/ / NPOL(NuNVlpOAN} ANV @C,fJfgAC,fNN^NuH.,*/*Hc(.,Jfzc N%n&@ g* ``pL(NuH. N8,Jf AZN|N`B,PNh LNuNVH*H&I-@N|vA-Hp Ma`-@f M-H n"nfHzHnN.HnNBHna2O.JjA쨼NT L(N^NuH|*< Ro" Ѕ. N$*@ g MN$f,`*` L NuNN&NNN^NbNENNNNVNANjN^ N:lN1nN=NN/N NN8N?N.N NcN˿ l˶h@˱p l˶(SN > l˶Cf l˶hQy|.-@ l˶J(bghb-@ l˶CN l˶CrNp l˶(dN  l˶hȋ l˶"Hj)Q+X l˶n)P+\a< l˶"Hr,pc)F0 l˶"Hx|<c)Fdp l˶(|)@A l˶"H Qdp@Ѐ`Cp0)@dĴg l̂N P ,dN f)@̂B̆ l˶zp0)@4p l˶(N t l˶h˭ l˶hˬB .rlAۏ"l˶R`p l˶()@ˌrc(e)Aˌ l˶hXp@W l˶h l˶J(WDHHA1-|Rr nAN@~@@>An"l˶)3B."l˶J)3WDHHBA>@n@A˯J+`g0 l+`(VDHH)B l+`h}r l+`(d)A̒r l+`(e)Ar l+`(f)A l+`hg̖ l+`J(jWDHHA| l+`"HtJQg@˯ l+`p Hg l "<-AJg)n"p l+`(n-@rg rgp`p-@Jg Jg ",,t*eJf *,eN@ l+`J(gNb l+`J(WDHH@p l+`(r(//NrPOpDea ` l˶C }fB .rlR l˶"HЀH Jqg" .rPNO*E / p0f` .rPNOA B0R` l˶"H(JQgp0$HC -f`B, -p l˶(Np` KNsJgANNtpL,N^NuNVHJ,OgHzHnAC]NPOJfH`tpOACNN".plA]Nt0pOANr.pgDJfaR`:ACpNspANF*@ fHnHlNM`p MaJgazL N^NuH l˶"Hz:) JgP*H>JGgF|pl, Ѐr25 fr2҆ҁAw;R`p0r MN`L NuH,,pA$NT&@ g A$NJfp l˶(drPNM^GhHx/ NrAN&PO~p$n\ A**p gLHx/NraFNPOJg l˶J(?WDHH`p, r/NHx/NrO R`L(Nu/ l˶(>Jfp?`p9@h<h=h;J(8WDHH@"h:#h9$p@%rAhg!hh(B#gA@x@jNra$Nup l˶(,"<XNLF)@ p(."<XNL2)@ p(/"<XNL)@ p(0"<XNL )@ p(1"<XNK)@ p(2"<hNK)@ ~)@ zp(-rdNK)@ vJ(~gp(~SrdNKJjR)@ vp)@ )@  )@ )@ J(3g)@ J(4g)@ J(7g)@ J(6g)@ J(5g)@ J(9g )@ J+`g8 l+`J(g)@ J(g)@ J(|g)@ p(~)@!J!fpd)@!A TC$aNu/~pl, A+XJgA+X d A+X!R`.NuH. l˶*H ,S"牒҇, SJg MJfS R` L NuNV/aVJfJpa @C }fpa @C -f~pl& rPNJ*A /H av @"ofR`.N^Nu/ l˶(tDUDHH $NuNVH1*H&IA TfB ^p KN-@g\r @2(+ARr2(+AVr2(+Abr2(+AZ+ABr2(+A^+AFr2( t4(&+C&r2( t4(҂+A*C IN n>(prCq1Jg"Cpr@r// / NO AHf n>(prCq1Jf>(prCq1Jf~pr@r/Hl/ NrO n>(prAq0Jf n>(prAq0Jf~pr@r/Hl/ NO / / avPOA Tfp@x@j MNhANTL(N^NuH*oGb*J+`g*~ l+`(pf *XG"pf *G. L(NuNVH*n&n p MN-@gN-S nJg>& nJg p gR`/ N8XO nr fRp nfR`&L(N^NuNN?NcTN"NNNUNNފNN0 nNeb`/ HlxHzLN@@ACNeO /.N jXO-@jJgx/HnNPTHx HnnHnN?O.pgR/./HnnN?6O Rg~POpN,L(N^NuNVXH*H&I.BzN/p N+8Jgz MCNe-@Jg` @Nd/ N/^/@p oNvXO-@^f-K^N>/.^p//N>O -@JfA칊"KN<`Jg/ HlxHzN>AbCfNdbO NTn/.NXO-@rJg/HnNNHx HnvHnN>O,pgpJgT/./HnvN=O RgVR r NcfJf .b".fNc/HzZNcNSPOJgr`/.BHnvN=lO RfXNdA"HJfS, N4-@ A"n`Sd nNNNNlNNL(N^NuNQN Npa|̐pN$.Jfp`4 ,A선JfpN%VAsNp` ,A선 pNpNuARNORUSAARNORDARNORFARNORENGARNORSVEARNORNLths'%s' : %s <%d %s %d> or NVHJ+`g l+`J(gCAf` ,A선 pCfACN]LpANݸ*@JfJgaAsN`Jgp`p// /Hx N6O)@g /NXOJf A콕N`H~p2l( /@pFNA<"/!fN `R`p:-f pN@p`a pL N^Nu/~p2l A< pNV AJf A찗a`J nNQ`Z MN-@f A찗a``( nNQSf6 nN-@p" nNr .SJg nNp nNb`J, fp l l@ l l@p)@ )@ |)@ x)@ tB, NJ, f n(fJ, gJg n)H l .ΐX)@ h` l\)H l ,T)@ h)H T"H)I \(r fp(rEҁgN8Jgp l TNB-@g @` l TNA @)H T`RNP.ANQ ,08r l l"nAN)@ h l l"HUI)I T)H \ n(f4zRp l* nN2-@rg l \)H \R hA@J0f .r g[f l \R \/H nN oR h l \/, h/, laPO)l ` daJgrA:NP , d `r l `C$NALNPNp"NOA챰N@jNOB, p-@ .rnJgUgp NP l `YH-HX nJgTpfLR t , tr NJf8NACNO/, tHzrNO .".NOdNNN?POJf n/Hl Na p l>N(p l>N l>(g` n/N:,Hxa PO n/Hl N9ZPO`C&$PgpC@J1g/ N!XOJfv n/N#(XOJfdp NNTNMH n/N9AN>|NNANdr2 AN>r2-AN>DXO .Jg0SgDSgSgHSg6Sgg` na`/.N!XOA&"n"`/.N XO`Hx/.a n.N!nPOJf n/N"XXOJg A&"n"Y`B/.NPO , JonA=NMNNN*-@rFbAq0gr0`r7rm0 n*r NM ЅACfB/.aPO n/N XOJf n/N!XOJg A&"n"Y` n"l `gYA&$n"Rg/ NXOY`NJACNL/, tHz"KNB>` Jg nNKB n"MNBJ, g ldSHpN`N`PJg J>g8 l>NK\Hl.zpA?NA\ON`Jg nNKr)C@J1g."Hr)C@J1fHx/HlN O TxA찋NJNKp ANL-@N:pg&A"HJfS )@ƐB/ )@a MabPO`@/HnN4.N6XA"HJfS" )AƒB/ )@)Aa Ma"O JgJfHn/-N6POJfANJ*AN9N, Fgzp0r,KfT/NbXOJf/NPXOJfr`rAXMJg,Hn/N6tPOJfHx/ a4POJ.gA&*R`pcHl)/Hz N#O L N^NuNVH4*n.|Jgh UpN9Jg| URHpN9|Jg|ACf JgSgSg`*AN"l` AN `p.N@AN J, g. ,JoPb//N9ZPO`PJjLD//N8PO`> , hЬ",08b U"H ,$H", \R// / N \O JgA`AC$IJfS/ //N 2O ,Ѭ \Ѭ hJg&| &l `JgA&"Sg c ,ѓXK`R xL,N^NuNuH/*H&UJ, g"p +gSK`p+g:UKp +g0SK`SKr fSKr fTKr g rpEЀfRKNGz|pl|JgN!JfN!BzpfprGҁgp_f KN7&@`pN8 JfpN Jg`prIҁf~-`|prHҁg prnFf~ ``prlFf~`PpN7Jg`@pr`Ff4~`0p fr gtpEЀfRK`pgp g|JgHpA@0Jg.p'f(p+A@J0gr.fp+A@J0fxJfN zp fHxaXO`pNFpfp`FNF`JgN pgNEp NER`L(Nu/ J, g: ,TЀЬTJjV)@8)@8N @"@8)I p)@D`4 ,0N @",0"@)A8)A8$@)J l)J p)@D)I P)@ `JVDHH$_NuJDg lDNBDNuH*oG MN .-gp`VA@J0xgpAl  MN ^.-gp`.A@J0xg  MN <.-gA)H TaL(NuH l T)H Tpf)H Tp=f~0pA@J0gpAd$pAq0gb l T)H Tpf2)H TprGҁgprIҁgp_gpN5FJg"`pA@J0fpAq0g`p f l Tp g prEҁf)H Tpfp`p(rEҁgNJgp l TN4&@ g p f)K T`& l T)H Tp gpg pfR T`S T l Trfp`pfp`S T*l T l T)H TpfF)H TprGҁgp_f N3)@ T`pN4.Jg`prIҁf~-`S T`"pA@J0gp-f l TN3)@ T`S T , T" r n L(NuH*H&Ipf:prGҁgp_f MN38*@`pN3Jg`prIҁfX~-pA@J0gHp-f MN2*@`*p'f$pA@J0g$r.fp-A@J0gp KN`jL(NuNVH*n&n -M-K n/"n/N/ L(N^Nu/ *HAֻfNV` Jg MNp*_Nu/.//HzNDPOpfA첣`A첨N1AnN1.NuH*o ./ SJg JfRM`L Nu/ A(NAa*@ g( l d )H d pe A_a\p`N1RJgp` l dBp*_Nu/.//aNXOJf N..NuH./ N, Ї"N"N,p?oNA@` NLNuNVH4*n&n m-H (dJo. hl"n )`-H n p$n"j\fAL `pL,N^NuNVHzG0 N0*kl g. +` uCfz l NB MN逑'Hl*Hp.,-@JWDHHA"l N-@JfRA"HJfS R܀`pc NF*@Jf NPp` N0)@ f MNN4p`B-l JWDHHA"l Nz-@Jf2A"nf . n+JfS RѮR` r MC2N'Ml '@dr'A`'AhJgZ +dJoR-A-A .d*Jf$/5HnN/POJ_DHHR-A`Jg .JoS`p'@`N?pL(N^NuNVH*n&n m"h\-H-IgPJfS rc>Hx Hn/.NO .pg"/, /HnNBO Rg aAT `pL(N^NuNVH*n&n m-HJlg (`"n il"P-IgrJfS rc`p,L/.Hl/NO r2p,Kf:Hx Hn/.NO Rg"/, BHnNO Rg a4AT `pL(N^NuH*o &opL(NuNVH..K0 NZB NNpNJg^Hl -N/@p oN(XO&@Jf A -N&@Jg KN KCN=N/ p//NL)@ NO J f(/ HxBN.O )@ Jf/ HlNPO`aZSgND`A+H@p,;@DA*p,;@p,;@4A+H\p@+@TB.p +@f+@A+HA+H+@+@V+@+@A+HLA+HJgA`A#2A2ړN,-ml/, NB l N\B nNPXOpNL(N^NuBanXONuHxabXONuNfNNtN+XNQNN~NeN84N6N7.N#DN NuNVN;NT:N#vNNHPNzNN8zNwN!NeN+N|NTN2:NNUdNN\lpapalJfp`|̊Jf*p/Hx/HxNdO)@Jf ANp`^JfVJ+`g l+`"Hh Qddpd`Chp0` <r///Hx)@NO)@Jf ANzp`pNuMerriam-WebsterIDEVan Dale %sphonenvexllexw%s %s '%s' : %lu%lu %s...NV/ pA N*@HxHnB/ NFOJgBAN:JA"HJfS C IN:.Hl_HzrN9POpfAdN:*_N^NuNVH.Jg ,A셴"0`r,Jgpo A"Nr`̌ ,fp`Jg*,̌aNpa)Ě AJf A7N*` A pCfHzHnNrACN9PpAN*@N4PO g$B// NO Rg A pNRfPp,xr,A80g&BNXOr1gBNrXOr2f AN` ANCa F̌p`)FpL N^Nu/. F̌Jgpf/,NBNfXO.NuNVH-H-HJfp`N\J, }gpA }N*@ gBB/,/ NpO)@ JfDp,xr,A80g&BNXOr1gBNXOr2f AN`tA"Ma`h/, HxHxNO JfPp,xr,A80g&BNBXOr1gBN4XOr2f ANL` A"Ma/, NFXOB BNǸJg l˶JPfp`~pl rPNA J0gA pN&@Jg$ THx/HnHnHn/ a OJfJf2A}Nap` ,"A!A!R g0p:+fpNߠ,rA`N5,/NXO,IAIR`>|BA -CfANACN6~pAN-@g/Hx@Hx N0O )@pL(N^Nu/Jg/,NZXOB~lV AJgA/0NbXO AB`( AJgA/0NXO ABR`J g/, N~. N|XOB NB,B.Nu/ *o MC NJf MN MCN5 *_Nu/.,a J,BgB,POJfbJ.MgpA["nVa `pa*` .".N0J,Of /HzN0PON Hl/HzHnN/AN lOJVg /.VN p"Hҁ lJ| r gUg*`,pf ;Jg ` `BKK(,KJgGgHx;/ NPO @GpHn// NNN3N=N{NNNJNENDN^NCNNDNCNNNX(N(NNNWN|kp lpNJ*@ gp f nb"M-I`N nN-@`> n(r f`p(rEҁf([fp(rGҁg (r-fUHN @N r> @gNJg lpN-@` nNZ*@pfp=-f JfVJfR` MNJgp -fSM`p -f-M`JpA@J0f[fp-rGҁf-M`"*nJ.kgRp -f l\fBB.k`< MNZL*@pA@J0gpAdJgp/HzNJPOJgB.k`J+`g l+`J(gp`pB@jJgZJfV .r NpJfHNHJ,Jgp"NA찾NB,JA챰N` .rNv/.HzNNNPONJf n-Hpf"-Hp=fz0`.pNJgR`pA@J0gpAd8p gpAq0g, n-HpAq0fB.lpS@k`xp,f|kp/HzNPOJgX n(@Ap'f.r'g4r`g,.r)f .t(gr"f.gB.k`p fnNJg p@l@kNWJf NN `lNJg6|kB.lp lpN*@Jg p f M` nN @-H`-lp`B.l` nNX -@N~/.HnaPO-@r oJf8AcNpdNN`Jg/.aN6NXOJgNJfN `B. .rm(A&HUKp'fp+NrrsfB|p/HnHnNO JgJ.g'/ HnNPOA"HJfS/.-Ia h"..-Aa V./.N <./.N -@ .A"n`Sd nN fN JO JgNVz-@N ` BavXOJgJg/,HnN POJfD/.aXOJfHnN"XOJfHnNXOJfJgHnN>XOJfn|k/.aTXOAKC$IJfS"HJfS " Ё",|U^-HcA]-HA"HJfS nJfS "Ё",|U^cACf`Hn/.HzHnNOA)HpN /@N JjR"/op` N W)@xApN -@ N N . r2 A N r2H fN V`@N .NhJg2SgSgFSgr g,`(NĆHnN`XO`N `NlHnNXOJfN `N ,NT-@/aN>HxHnNVO , Jo", HtmnҮA"HJfS/.-Ia"..-Aa./.N ./.N O -@".ҮA ."n`SdJf nN N N "NSZN nB,N NNS-@JfN `(Jf ,gAN pdN N`N Jf,gB.p".6/HznN POJg(|p.".6fB6HnNXOJfB.J.kfp nN JfJ.jfxHna.-@ av nN (XO @A p.g p)gp]fpg4 . Jo o"J g  o/.aN 0XOr op`p)@Fp,LA)N r)AFr2t,K=@fp nN nN nf`zHnlHnN FPOJf/.ajNXOr op`p)@Fp,LAN Br)AFr2t,K=@f@N/.aV./.N,` L N^NuN$NfNn NTNԬNyNNRN3N"NgfNN^N2fN6NeNeNzJNNwNZNTNUN.NVN>N DN.NNNN,NNQNN NN.\NXJNN xN N NNM&NNVH'..B.A/N JgRA/CN*@ g@ MNG K/ Hx/Nz MN(O Jgr gr f B`RK`zlT A"HJfS" tF/"n /1/NA"HJfS rF.Hz/NҬOR`A"HJfS, Jgpg-HpPACNN$p)@>NHl/fNPOJgz`zB,RNvN ,NNJp//prNPOJgBN ,!JNpNXO`JgNJNXJgNHnN"HnNXOR`L N^NuHNNA촒C/fA/CHNZNNm l˶J(gp`pNpNN2Hx/,(p"NH ,(UHx/prNON~ A촤 pp*g RA촤/0aXO`NmR fNmRNNANHzJaXON~ A pp*g RA/0aXO`Nl, g/Hz`N.POJg gTp g HxA셸/0NPON<~ Ad pp*g RAd/0a&XO`Nl, g r1NLNu/ *o/ HzNPO*_Nu/~LFpmЀn8 r A rNm~ r A rNmdR`.Nu/ *o MNlT*_NuNNNK|NeNTNNN N1N=NTN>DN,N8NZNմNLNbNVNgPN,NNN~NN~FN'NNN9NN/N{NrNN(4NNvNrN$NN,pNK8NN(dN6NNN[NoTNNpN8NNBpNzN:N{NMdNHNN8N4PN9NN.NN$NNNNNzNNNN"N *N2paSwap (cont.)Show more files:>Split screen:s^XLink filesExchange files:s^Y-Load file ...Catalogue files ...Save fileSave as ... Save all filesMerge file ...Rename document ...Document Settings ...New Document ...Clear TextClear all FilesCommand Mode:ESCDesktop menuHelp ...Quit ProtextAcute:a'Breve:sa~Caron:sa^Cedilla:sa,Circumflex:a^Diaeresis:a"Double acute:sa'Double grave:sa\Grave:a\Macron:a:Ogonek:a;Overdot:sa.Ring:a%Tilde:a~AccentsChoose character ...Add accent to letter:>Find text ...Replace text ...Next find:f6Previous find:f5Find word at cursor:s^f6Find word backwards:s^f5Goto line/page/col ...:^GLast position:^LInsert Date:aDInsert Time:aTSet Marker:^ZClear Markers:^KMove Block:^MCopy Block:F10Delete Block:^DELUndelete Block:^UCopy other Block:^OSave Block ...Count BlockFormat BlockFix BlockNumber lines in Block ...Remove numbers in BlockRun CONVERT programRun FSORT programImport Graphic ...Addition modeInsert resultEnd additionCalculate expression ...Document analysisGenerate Index/contentsSet index Word marker:aWSet index Phrase marker:aPSpool to fileClose spool fileSplit fileAdd Line numbers ...Remove line numbersCentre Line:^CIndent paragraph:sTABFormat paragraph:s^FFormat to end of para:^FFormat textFix textDefault ruler:^DCopy previous ruler:^RSoft hyphen:^-Footnote marker:^@FMultiple marker:^@?Non break hyphen:^N-Non break space:^NPrint text ...Print a file ...Print block ...TypewriterLoad Printer Driver ...Pause printingResume printingAbandon printingEcho screen to printerCancel echo to printerCheck from cursor:^SSingle word:^QThesaurus:^TSet ignore marker:a=Check whole textCheck current blockSpell check a file ...Lookup wordList dictionaryFind wordsAnagramsMake dictionaryCount dictionaryBuild word fileInsert wordsDelete wordsEdit user dictionary ...Edit exclusion dictionary ...No Style:s^X$Create/edit style ...More :>BlackRedGreenBlueCyanMagentaYellowColoursColours:>Bold:aBCondensed:^XCElite:^XEItalics:aIEnlarged:^XLNormal (pica):^XNProportional:^XPQuality:^XQSubscript:^XSSuperscript:^XTUnderline:aUDocument modeViewing options ...Define macro/glossary:^f1End definition:^f1Edit Macros ...Edit Glossary ...editing Options ...Line drawing ...:^f7Status InformationEdit configurationLoad new configurationRestore default configurationFileSwapEditBlockFormatPrintSpellStyleToolsOption Continue Yes No Print Skip Abort Retry Yes No CancelFind:Replace:optionsWordGlobalAllBackwardsIgnore SpacesCase specificMarked blockNumber: OKFind and ReplaceReplace and continue (Y)Replace and stop (X)Skip and continue (N)Cancel Store Ignore Change Lookup SkipLine:Column:Page:Go to placeFirst line:Increment:Number LinesLine drawingLine TypeSingleDoubleCharacter:edit mode keys^f7 Linedraw on/off^f8 Chardraw on/offs^f7 Toggle single/doubleLine DrawingDestinationPrinterScreenFile:PagesOddEvenPaper feedSingle sheetContinuousPage rangeWholeRangeStart:End:List:Print qualityQualityDraftPrinter:Printing OptionsWords Words:word list Alphabetical by Frequencystatistics Summary PagesWord AnalysisStyle:Name:FontPointCpiControl Codes:Font spacing: Save Style Editor (Printer: ) show Ruler [^VR]show Page breaks [^VP]show Tabs/line breaks [^VT]show Spaces [^VS]show soft Hyphensshow Index/Spell markersshow place markersshow Block markersshow Wysiwyg as codesshow other style Codes show All show None DefaultViewing options Add View Delete Load Use FinishExpression:Result:Decimal places for insertion: eValuate Insertformatting optionsauto Reformat [s^R]Word wrap [^W]right Justify [^J]Overwrite mode [^TAB]editing optionstyping Check [s^S]Page mode [^P]auto Indent [s^I]Box mode [^B]screen Height [aF]25 lines50 linesautoSavebackground PrintingProtext optionsSort files byNameExtensionDateSizeDisk orderDisplay formatNormalFullWith attributesBriefIgnore default extensionShow Hidden filesFile specification: Show AllFile selector optionsType file:TErase file:ERename file ...:RCopy file ...:CProtect/unprotect:^RMap directories:MMake new directory ...:NChange drive ...:DOptions ...:OQuit selector:ESCMark/unmark file:spaceMark all files:^MInvert marks:^IErase marked files:^ECopy marked files:^CUpdate marked files:^UMultiplePaper sizea3a4a5ListingCustomMarginsUnitsIn'sCm'sDefault StyleTop:Bottom:Left:Right:Gutter:<->STYLE_NAME_BUFFER<->Length: Width : Page OrientationLandscapePortraitSet Tabs Edit Headers Edit Footers Load SaveDocument Formatting Options... OKDocument Settings123456789Edit Both Footer Style Footer margin: OK CancelBlank line suppression on.Widows and Orphans on.Right Justify on.Inter Paragraph spacing on.Hyphenation on.Hyphenation factor (%):Tab leader:Line spacing:Document Formatting OptionsFilename:FilenameProtext 6.Protext 5.ASCII - Reformatable.ASCII - Fixed.ASCII - Page Image.Image FilePress F to catalogue files...Output FileWill create binary file.Image Layout Details : (inches)Width of image.Keep Aspect.Height of image.Use Printer Resolution. (to size)Distance from left edge of text.Centre image.Right Justify.Resolution(a)360*180Invert image. Go(x*y)Import Graphic (PCX/IMG/GIF/IFF)Undefined error occured.Image file not specifiedImage file not foundUnknown Image File FormatMemory allocation ErrorPixel aspect ratio unknownUser pressed ESCAPE keyEnd of file detected, before processing completed.No output file spec/open/foundFailed to open input fileFailed to open output fileFailed to Read from given fileNo Screen Descriptor detectedNo Image Descriptor detectedNeither Global Nor Local color mapWrong record type detectedPixels bigger than Width * HeightFailed to close given fileGiven file was not opened for readingImage is defective, decoding abortedError reading IMG file. AbortingFile is NOT recognised as a PCX fileUnrecognised IMG file formatFile is NOT recognised as an IFF/LBM fileFile is NOT recognised as a GIF filePrinter Error.Error Closing Input File.Error Closing Output File.Error Writing to file.Path:DrivesChange Drive/PathAbandonedMondayTuesdayWednesdayThursdayFridaySaturdaySunday Welcome to Protext v6.0 Demonstration Version --------------------------------------------- This demonstration program remains the copyright of Arnor Ltd. but may be freely copied and distributed subject to these conditions: 1. The supplied files may not be modified in any way. 2. No charge may be made other than to cover costs. 3. All the accompanying files must be supplied with the program. The full version of PROTEXT is available from: ---------------------------------------------- Arnor Ltd. 611 Lincoln Road Peterborough PE1 3HA England tel: 0733 68909 fax: 0733 67299 (c) Arnor 1993 Press a key to continue or ESC to quit...* Installing a printer for the Protext demonstration version ---------------------------------------------------------- A sample range of drivers are supplied with the demo version. The full package contains a large number of printer drivers. Those supplied with the demo version are for: 1. Epson compatible 9 pin 2. Epson compatible 24 pin 3. Epson ESC P/2 compatible 4. IBM compatible 24 pin 5. Canon BJ-10e 6. HP DeskJet 550C 7. HP LaserJet 3 8. Canon LBP-4 9. Simple backspacing printer Option 9 will give bold and underlining on virtually any printer (c) Arnor 1993 Press a digit to select a printer driver (1-9): Protext v6.0 Demonstration Version - Getting Started ----------------------------------------------------This is a fully functional version of Protext. The only limitation ison the length of documents that may be edited (2K). When this screen hascleared Protext will be in edit mode. Pressing ESC switches betweencommand mode (note the prompt) and edit (text entry) mode.The right mouse button or f3 accesses the menus. The menus showthe keyboard shortcuts for many editing commands. Type HELP fromcommand mode to return to these information screens.Instructions for this demo version are supplied as the file PROTEXT.DOCThis may now be printed by pressing 2, or to view on the screen press 1and type: TYPE PROTEXT.DOC. Choose one of the following options: 1. Try Protext for yourself ESC. Return to the opening screen (c) Arnor 1993 Press a digit (1-2) or ESC:STIBMVER5VER6MM6GFXCODENameExtensionDateSizeDisk OrderptFALaDpFЀALa8Nu$C$H.*HprFgprr <L NuH.*HprFgprrᡃL NuH.,prFfp`prr VDHH LNu ,LaNu/.ptF"aJgpFЀ"aJgr`r .Nu/.ptF"aJfpFЀ"a~Jfr`r .NuHJ,%faJga*@pfp-rFҁfptF",a4Jft.,t,,Haa*@pfp-rtFg:,< @<|TMN\ Maj*@p fNtJg *lp`| N ,tg NL NuH*H-p MN\pALa@L NuHHxNa*@ MaXOJgaJgN MaNȎ`aJg|J,%gat`p,<. ,,t*,H p(p/NaXO*@pf-f MaTNn ,tf pd lpUHNC` N2 N:ptF",LaJgpFЀ`ptF@Jfp-NXJf ,t//NPO ,tf "pdU Ma`ptFALapFЀALa N֖ lpNAL NuaXJfA}N`NuNV/aN_J,%g a Na`paNalACaJf, ldUH .U nTH//Nq|AN,PO` .T//.NqB,ANTN_BN_NNa..N^NuNVH $NACNaN@ZHxHnNPPOJg`pN@*@||Aa$NpNՌHxNXO*@ g Hx/ Nq>POCNJ&HnpA?NA\ON_azL$N^NuNVH*H&I. M"Ka,N`z-@ ,aJg `(Jf ` nc "STIe ` A쮏N^~pL(N^NuNVHaZN^N^J,%g a N_`N_NpACafJg ..TPb0 N?z*@ nb߮  n"M`Sd  nN `^ N@R&@ gH  n"K`SdN_*@ nd N // N?*@  K"M`Sd KN>PO` a0`a*N^a(a6N N]BN]N N_L(N^NuNVH~aNN]N]J,%g aN^`N^pACa^JWDHH,Jf$ ..U AN^ nC-IJfPbN *@Hx/.NoPO ndUMHx/.NoPO ndUM X// N>PO*@ nb XѮ&M K "n`Sd|  KC$N  KUHN>`AN\TaN N\ N\N N]L(N^NuNVH~N[HxN N]ACa,HxN POJg$ ..U AN] nC-IJg.Pb( N=**@ nTH "M`Sd  MC*tN ^`HxN AN[XON4N N[NN]*L N^Nu ,$aJgN[J,$}ga\`a,`A}N[TNuNVH ,!aJfJ,!NfN J,xg ,aJfGp`J,jg ,aJfGb`G!F-l$L.,$PJg2 nJ(g( (fa^Jf n (c&HpyЀѮS` SdcN\F KCpp""Q2ApN lpa$*@p g MN<8` N~JfpL(N^Nu/ *Hp[@gQ@f" `"p-@gS@f ` MN *@`RM`*_NuNVH*H&I ,!aJgp`2ptFa*fp`"pFЀa&fp` S"Uc&*-HpL(N^NuH#HxN N;Z)ltHx)@N N;DPO",tHH$,c .)G)A",Ȳc ,)F)@pLNuHN:.,,taJgh ,N} lpa*@p g Ma Ma*@p g Ma ,NpFЀN ,NptFN ,tgN|JfN~ N} NB,yL NuNVH.N:f,*,tB.a~*lpx MaT*@p gRpf>p-rtFf0g MagJ.f| MN>*@`gg`B. MN|H&@p+rMҁf N*lp`zp+g8TKJf ,PR@r g[fprFҁf|`p@J.g MaT`*TMpFЀALa`J.g ptFALaJg N{\Jf N{ NxL(N^NupaNNu/,%WDHH@%NWLJg aJga` aJga.NuNVH.,ptF"af*pFЀ"aZ@ptF"aL(pFЀ"a@@f.gJJg Jga`NT:NgHNZNY6N:N"NRNN"8NɘN`N&2N N[N~NpaNQb0|ap@R@QN8Nu%08lX %02X %f &%lX %%%.*f%s %f%u %02u:%02u:%02u%02u-%02u-%04u%04u-%02u-%02ugls*.GLSgloss key*.KEY^766^MM^13^^766^CAT^13^^902^^763^^13^^902^^536^onoff%s %dKEY %3d%s "%4s %03d, %c%u%cGLOSS %s %s%-*s %-28s: %s%-28s: %u%-28s: %g%-28s: %.2f"%-28s: %.2f cmFiles open on AFiles open on BPANIC %u*.* la@NuNVH nJg ACN00| "le Hzp&?NN\OLN^NuNVH'*H~|z0|fNO*@Np//prN*N/POrLm N/>N Ma gJg r<Ё` ЀІt^DHHЁr ЁrNjNM. r gFgSg,Sg Sgr g`:Sl| Ma`Rpo| Ma|`zJWDHH*`jJg-G`4pFbVAq0xgH N/pAN/\. g, .h Rpo| Ma` L N^NuH*Hp"N’~pl/ HzNMFPOpfN.@|pl"p5h/HzNM"POpfp N_\R`p N_R|pl 5hpcp`p.r N_.R`pfN-Nplp N_R`hL Nu/./pe /aXO rr0Ёr N^.NuNVH*nB.JgHx/ HnNMO B.NJ.gA-HHnANoXO&@J.f^ "+//HzHnHN~Hx.HnNnO-@g @-@AN^LN,6./HzNK.a"POB.`pL(N^NuNVH*n&n y4< y3T-y3-HHn-HANo$XO~-@pFl n xR`J.f| nJhf "n QJfS///.NLO `Rp0/(//HzHnNHx./.NmO-@g @-@A"HJfS/ //.NL2O A L(N^NuNVH#*nHx/ HnNLO B.J,OgA#3T <#3L3FA#3#3A#4|pFlA R`Ap@#4A4ؓNmrr294LfA-HHnANmXO-@J.f @Jhf /N*jXO` "(t4.///HzHnHNY@gt`p-@ g*@gY@fHx/ NYPO `Jfd MN*@` MN)N(,  M"lzN)t* MN)// N):PO*@ SJg `NjJgNjJf*lpSMRM`^L NuH.,,H*,tNFpNjJ,OgANjpa Nj NjtNZjNHZLNuNVpaN^NuNVpaN^Nu/ *op MaX*_Nu/ *op MaF*_NuNV/. GB.Hna..N^NuNV/. GB.Hna..N^NuNVH.-H-lH-ltp@@@pACNGBJo pACNG0JopACNG.JfANY&pANWJkp.NiN*J,Og,pAf&p )@/)@/AbNit gN&`p@Ag @gt`.JfANXpANW`Jk|.JfA$NXpANW@Jk\J.g HnN&XO`p )@/J.g HnN&XO`p )@/pNhNF @N'l*@B.J.fpAf8/,/Hz@HnN, N&O *@ A"M`Sd ,/Ѭ/`p-@,Jg(HnHnHn/ aOJfA쟴NV*`ACNV r$v?ă"vƒҁ///HzNCNOJoA쟴NUA쟋NUpANT,JoBHnHnHnHnaOJg .".Ё".Ё?r-?NAXON#L$N^NuNVH#$*nJg&HnHn MCNPOJfA쟧NUR`Jp*?NATO~> r-@ r-@ r-@A2NUN"Jg$SgSg6`L/././.HzNBBO`2/././.HzNB(O`/././.HzNBO|JoA쟧NTATNTN"JgSgSg`AdN@`AqN@`A~N@pANS,JoXHnHnACN~POJg Jg2ARNSpANRNJk\J.g HnN!XO`pF-@`pF-@pFf" .N!-@///.Hl}Nd"O` .".N!.N^NuNV/pFACNA.Jk8Jtg lpN!Bt RN")@p)@lJpgA"lpf)Gt.N^NuNVACN Jg .",۴N!N^NuNVACN Jg ,۰".N!N^NuNVHpOACN@b.Jn@J,ÐgAÐCf`A.N!| @CfA윓NRFpOAN!x.JkN@ACN>PJf `HJoBN?@ACzN?FpAN*@ fHnHlN` MN=ACÐN= / HxHnNO JgJfHxHz(HnN>O JfA-H~ MN=~*pgp g  n~-H~` n~B-frA-H~pA~CN>XJf|`ZG K/ Hx/N2O Jgr gr fB`RK`Gp fRK`p"fRKA"KNl` |`|JgA윽Np0 gp@g.p @g(p @g"p@gp@gp @gJGg Gbp^@fRp0r^///HzHnNyO g/ HnNPO`JgHn/.NTPO`xAN08`l gp0 KN0`ZJg @B.Hn/.NTFPO`8 r NC2`(L(N^NuNVH*n.N/Hl0@NSXOJg < Nf)@(f NS`HNB^&ld gJfN1BNSPJf( gV-k|p n0 gTr"Af|`AJgC`C/ /Hz/ NFO-g:`JgA/HxHz/,(NxO`A/HxHzN/O Jg/,(B/+aO `B/ /+aO g Hz./ NPOJgB/,(Hl0@NO JgD&S`Jg:N0)l0l0p l0C[!IHl0@NRHl0@NRvPOJg Hl0@NR>XOJgHl0@NR l(NXON04L(N^Nu/ *HJ,OgJ,g*B/ Hl0@NO @`J,f MNANQ@*_NuNVH*H.JgA&`A)// HztHnNw`AaL N^NuNVH*H.// HzRHnNw4AafL N^NuNVH?*H.,Jg <h` <X*J+`g x l+`(Jf*<pf*< ggB NQ H NQH$LL $NQ&/// Hz޴HnNvO` NPH NPH$LL $NP/// Hz|HnNvJO`> NPH NP~H$LL $NP/// HzJHnNv OAa8L N^NuNVH*H&I/ / HzHnNuAa L(N^NuJ,OgAaNuNVHB,Hl0@NP&XOJ,Og| l0C/!I`A/N?AaACatJ,CgAC`A0CIaZA+C@aNAat|~pl8 rPNA J0g"JgAJ`AX rPNrC a |R`J, }g AC }aAdC -aJ+`g l+`J(g CABaa ,rA|a ,N A즈"@aa ,rA즕ah ,rA즠aZ ,rA즮aL ,rA즼a>,f ,` ,rAa"axpAap@ЀAapAapA a|pAan lpCۏ"1AaVap,˱AaDa l˶C%IaA1C.*aJ+`g$ l+`TCIa l+`CIaaAECa|a ,TЬPA`a ,0Aya ,dA짮aaz ,A츖a ,۰A짎a ,۴A짠aJ,vg ,AXa ,A\aJ,OghJ,g()l0l0pHl0@NMHl0@NMXPOJg Hl0@NM XO`0N<^B,ON lN HzaN L|OAN-| .B,. nJgz nr gr,fR` nJgr*fRACNJf<``ACNJgJg .r@ҁdA-!`A쨯N:>p`( .Ѯ .r@ҁdrg A-!`p.N^NuH*o.,tN(bp,/ aXOJgN::p, /N6XO NJ lpN L NuNVHpN*@N g"~ SJgpNJfNIJgL N^NuNVlH*nN.J,vg$AײC"2B/ HnNIHnN`NN~ lNlJjV",(RNn,NTJjV",,RNV*N` N"NFJf* MN#Z,RlpfSl .lr-@t-A|`&p f .l-@t`pEЀfp f .l-@p .x".l|eJtg-ntl`Jpg".p-Al".lHhJgfr MNACaf&@ gL .hShJg MN" KN"RgNEJg KN"` KN"Rgp-nlx|-@p-@t` MN"N#L(N^NuNVH*H&I/HzHnNk\R MCfACN#~N&AN5TANxO Jgp`&ACN#F-@JfHnHl-NEPO .L(N^NuNVH.-HpOACN"Jn JgA쨊`A쨜N4pOAN3JorAN!J&@pAN!z*@ gXNDJfPA"KfAN4Jgp-r AN`Jf` p-r ANFJgN *@`L(N^Nu/ *op Ma:*_Nu/ *op Ma(*_NuNVpOACN" JnAN4pOAN2Jo4Jhg lhN pANl)@hfHnHlNDPO` @N N^Nu/ *oJ,OgpN!(/ a N!NNZN$NNN NN$NN6N"NN0@NpaNVH*n&M KNJgTNNp KN4-@NNJgN~`.JfJ,g KNJ @Jf KCN^ MCNH`pL(N^Nu%s %d '%s'%s. %ssav$T$: *.*NVH*n l˶"HG[-IJgBHx/ HnNpB.Hx HnN?O-@g @B MCNJgp`RVK` nJgDHx/HnN&B.Hx HnN?O-@g @B MCNJgp`V`pL(N^NuNVH*n&n l˶CINn l˶N/HnN?.HnNe@O Jg$ MNSfp`j/ aXOWgSg`p`Tp`PA-Hp"<"MN.p> ng SJgp nfp(rEҁgR`J, g`L(N^NuJ,&gh,#LJfA5`A#L//,HlHz2aJOJg SgSg`N|p`,p`(J,g,#LJfpNN>N(Ba pXO`pNuNVHK / A"nNRXOJ,g BHlHl~ACNNXO ~>`\AN-ANN. l N=.p0,Rgp0,g p0,f l r N-Np0,Rgp fp`&p0,g fp`p0,fp`pL N^NuH*o ,̖p@̖|OJ,Ng@R/ aXOJ,NfN-NG̖L NuNVHKB.J,OfNaXJfpOACN.JnpOA;CN.JkZJgANHJgK` gA"MNJg0aJf(Hna*XOJ$-@tJf N1rp`a | MCN&@ fAtNp`^Jtg"A$"KNSgAtN KN p`6Jgp KN `ptF KN VptFAlN nTHHnlHnp/.t ."Ka O ".沀g|JfJg l-H , rCIN Z-@f|B .SJg&p nfp(rFҁfz` RR`HnlHnp/.t . l"Ka O ".검gx|`rJg"Jgp KN pFЀ KN vpFЀAlN8N bJtgJgpr ntN :-@dg".pt4//N POpr ntN -@dg&/</N ndTH .lr2./N O p ntC$N Jf|p ntC$N Jf|p ntC$N ~Jf|p ntC$N jJf| nt (",$0Ө-Ah KN D nt!@"KN Sg|` .hShJg p KN fRf KN Rf|AtN hJg .|N/F .xN. L(N^Nu/ *oJ,OgpN / a N XO*_NuNV\H! NpOACN JnB~J,̖gJ,Og~JgpOAlCN VJj`N B.ACN JghAN jJg\AaJfPAC`fA`N @A/"@fBHn`aPOJg"J,˱fHnpA?NA\ON *A`CN LN^Nu/ *oHl aXO*_Nu/ *op Ma*_NuNVH'.Hl /-HNSvPOJWDHH,Jg|N p,LAN6r2p,KfVzp$n, A*JgJ.g aJgr`rAR`N N (NBHxNN 2PO|1.`v-npPACN zJo|B.-nACNJg .rct$d nJgtAq0(gp@@-A .r$n*A**p g f .a@`R`J.g |`tp`J.g AN~`J.gN"N F|1J.WDHH`J,&gACf`B.NJfNHlHnN,&POJgJ,&gp,LANr2p,Kf( l˶J(?WDHH@ N>NNp@1`pL N^NuH.|*,x A**pB/NaPOJWDHH,Jg l˶J(?WDHH@ NxB/NPO L NupAahJg HzaXONu/ *oJ,OgpN/ a NXO*_NuNV/pOACN^Jj`~J,̖gJ,Og~A#LCfJgHxOHnHl}NZO Jj(`nNAN @CfACN JgHNv.Jf rA#LA#Jg*ANvJg"AC#LfA#LNOHna"XONF.N^Nu/ *o MC#LN*_NuH*o MN"&@ KC#fA#NOL(Nu/ *oB/ aPO*_Nu/ *oHx/ aPO*_NuNV\H.pOACN,JopOAC\NJk A켰N&`6ANpOANJo NAN*@ gp// N4POL N^Nu/ *oBHx/ NO *_Nu/ *o/ NjXO*_NuNVHzHnAC쥵NPOJg HnN"XON^NuNVpOACNdJnAVNppOANJo NjANN^NuNVPH 4pOACN$JnA!N0pOANJoN(AC\fA\N&@AN-@TJglp nTN*@JfHnHlNq`N gJN'JfBA"KfA\NMNp,?NATO=@Pp*?NATO=@RA\CPNN*@`L,@N^Nu/ *opNb*_Nu/ *opNR*_Nu/ *opNB*_Nu/ *opN2*_Nu/ *opN"*_Nu/ *o/ NPXO*_NuNV/ *H/ HnNpHl./Npp,LANOr2p,Kgp`p*_N^Nu/ *H MNLJg Aar`r *_NuNVH*H.&M K-Hd:p[@gQ@g(`(p+NHJfp+NHJf KN&@`RKRK` " L(N^NuNVH*H.&IJgp" M"KNf|p A$N -@ M-Hdp[@g [@glW@gL`h-pNJgpB nC$NHXO*`pNoLJg p nNH MN*@`RRMr g rpEЀfRM`RRM`z n ݐ `pL(N^Nu/ prA$N*@ gR ,$Sr2// NPOprA$N*@ g, ,Lr2// NA ,Lr2./NO p`p*_NuNVH*H&I. n-H ndNp-H[@gQ@g8` np-HNJgpB M"KN$XO,Jg nF`R`L(N^NuH*H~NA8CN&@ g> KNm KNm,p@ gW@g`R`R KNmr g+g KN R+@NrL(NuH*H~&mHr frf`R` R+@L(NuN zNNENNbNiN:NNNfpN6NN6N3N"NgfN>DNNVN3N6NN N N#NhN:NN:lN6N2N7.N#DNYNN9NrNUJN6NBNNN=NN#vNNbN7NNrNʎN,pNFNK8NKN(dNNN8zNN:NNg8NTN|NTN; N?N,N=`NNNN/ N7N:N0fNNzN7nN3N>RNdNN8N6N4PN>nN(NUgTSg\SgdSglSg|SgSgSgSgSgSgSgSgSgSgSgSgSgUg2SgBYgSgSgSgSgSgSgSgSgSgSgSgSgSgSgSgSgSgSgSgSgSgSgSgSgSgYg"UgSgl `m zn r/NXO` @m Zn `r/NXO`|`Hz 6NXO`N>`Hz NXO`Hz NXO`Hz NXO`HzNHXO`|HzNXO`nN`fHzN@XO`XHzNXO`JHza XO`XO`&HzN FXO`HzN4XO` HzvN XO`HzhNXO`HzZN XO`HzLN"XO`HxANdXO`HxRNVXO`NB`HzaXO`Hz aHXO`HzNPXO`HzN>XO`vHzN XO`hHx*N fXO`ZHx#N XO`LHzNپXO`>HzNpXO`0HzNXO`"HxANXO`HxRNXO`HzrN XO`HzdN.XO`HxFN XO`Hx?N XO`Hx-N XO`Hx N XO`HzN hXO`N `HzN XO`HzNFXO`HzN pXO`rHzN.XO`dHzNdXO`VHzNXO`HHzNXO`:HzNXO`,N `$Hx=N "XO`HzN \XO`HztN XO`HzfN "XO`HzXN XO`HzJN XO LNuMALLINFOMILOADLSAVESCLEARFINDFREPLACERFINDBFBREPLACEBRBPMPRINTPMERGEMGOTOGSAVEBSBPRINTBPBTABCALCCASWAPSWOSWAPOSWNUMBERNUMNUMBERBNUMBABANDONABLOADCFGLCFGPRINTERPR?COUNTCTCOUNTBCTBDOCPROGFIXFIXBSAVEASASAVEABSABSAVEALLSALPRINTSPSPRINTSBPSBPRINTQPQPRINTQBPQBPRINTPPPPRINTPQPPQPRINTFPFPRINTFQPFQPRINTFBPFBPRINTPSPPSFORMATFTFORMATBFTBINDEXIXFRECORDFRTHESMMQUITQSPLITSPLSPELLSCSPELLBSCBMAKEDMKDSLLOOKUPLKBUILDBUINSWORDSIWDELWORDSDWFINDWFWANAGRAMANLISTDLDCOUNTDCODTYPEWRITERTWSTATUSSTATHELPHNAMENEXTCODEPAUSEGLOSSMACROKEYPHRASELMACROSLMLPHRASESLPCLEARKEYSCLRKSAVEKEYSSVKLOADKEYSLDKLGLOSSLGCLEARGLOSSCLRGSAVEGLOSSSVGLOADGLOSSLDGTYPETACCESSACCPROTECTPROTCHDIRCDEXECXEXECSXSSTOPSTCONTCOBACKLANGKEYBSPOOLSPONSPOOLOFFSPOFFPRINTONPRONPRINTOFFPROFFPANICCONFIGCFGFSORTCONVERTCVQWXCLECHOFFSYMBOLSYMTOUCHDATETIMEINKPATHSETA:AB:BC:CD:DE:EDRIVEDRPARALLELPARSERIALSERCATALOGCATERASEDELERARENAMERENMKDIRMDRMDIRRDDIRCOPYUPDATEUPKEYDEFGAUSSGALOISGDELSHOWSHWINDOWWINLINKCLSGFXPRINTGFXSTYLERESTYLERESLOADSTYLESLDSSAVESTYLESSVS%s %u '%.40s'This will destroy font info. Continueonoff/ *oJ,OgNpFNdNpA"MNJ,OgNT*_Nu/ *opA"MN*_Nu/ *oJgp,zA"MN`$p,zACNJfpANN&*_NuNVhH*nN~pl2 NJg$p,LAONr2p,Kfn NV`J,g*HlN֦XOJg SgJSg`B,` Hl@NXOJ,g*Hl*NvXOJg SgSg`B,` HlÐNXO|p$n A*&p gJ+g/HlHz\HnkN:O(J+gAkC/ Hz>/N9O HnkNXOJg SgSg`FB+`@*,B/NPOJ,g|OJ,#Lgp`A /NXOJfPB/NPOR`B*,|p$n, A*&p gB/NnNpB/NbO R`HzNjL(PN^NuNVH*nJg&M`A4N8pANJkG|Q/ N,L(N^NuH/,,tJgJ, fA$NJg K p,L MNr2p,KfpN*lpp g2[fpNrJf pNtJgUM MHx/NrPO`NJfA$NG p@j@xNNB ^ANpN NNL Nu/ *oJ, f HxaXO*_Nu/ *oJ, gBaXO*_NuH*oHzb/ NPOJf|`dHzN/ NPOJf p@@`H~p"gp'fGJg0pg(rRK NF`p.fJ-fp N2` MNL(Nu/ *oN$ fN*_Nu/ *op Nh*_NuNHN NNN\N"NN%NjNNRNNܒNNNeTNNNNNjNNDN0N\NpN!N6NNjNYN9NAjNNXN?N,NԀNNNTNN-N@HN[NhNN3NN`NfNPNpa/ *oprAaL*_Nu%-3u %g%.2f"%.1fcm .!?%lu/ *oprAa*_NuNVH74.,zp-lH-ltr-AJ-A~-H4&H|t@$@2@3@-Az-A-A NDHnNXO-@ J,OgA욵N^N*@-lN*-l&-l. ",\Ь"R-lt-lHl0@-@NXOJ,Og`Hl0@NXOJg&l0h` .".aPN` hA0@"HEp $$Q$"HEp $$Q$C,p ""Q"pNJ,J, fJ,Of,fp`p@#J,Of ,gp`p@"J,Of,g ,gr`rA!J,Of JfJfp`p@% MNRJf.p-@ MN@JgB`J.fBJg| `@p.[@gQ@g"`Jgp-rFҁg MNq*@`JfN :Jg.J.%g n4a J,OgHnN Hl0@N PO lpN-r grfJ.2g pR@2J.3gB.3RN Jg*lp`|Jg ,NJgp@p-@J.#gJ.g4Jfr-f0r -g(JNfrd`",N-l.-l&-A*`JNfJ*gJ.$fb|$ ,N VH .N HH(L L (N n/. //HlHnN rOA쾿CfACNf/..HzZHnN1HnHnN XOJ,g ,FѮ& Xf, .*N $<@YvN //HzHnN1ZO` . fB .&N H .N |H(L L (N //HzHnN1 O`@ .&N HH .N :H(L L (N `//HzHnN0OHzHnN vB.HnHnNN fORJpJf,Hn~Hn%Hn4HnHnJHnNACa O@#p-@*-l. ,N*c -l&-@*J.fN Jgp MN -@Jg*@` MN *@`pA@J0gprAejN / Hn9N ZPOѮz-@J.%g\A8"Hr.fBHn~A4C9aXOJf4 n4aB4B.%B~J,OfAN\`rAq0gRpA@J0frAq0gRM`Rpr-/Hz,@2@3N POJgRB.2`p/HzN pPOJgJ.2gRB.2RM`J.#g2JJg,Hn~Hn%Hn4HnHnJHnNACaO@ ",\Ь"RHJgU ,t",-AHt-ft -gRJNfRJNgRJ,Of .".aJ.gn/HlHnNO JgR/.HlHnNO Jg:J~g/.~Hl)HnNO Jg/.HlGHnNO Jgr`rAJ, fBJ.g:/.Hl[HnNpO Jg/.HlsHnNVO JgJg/.HlHnN6O JgJoD .zN-H N-H(L L (N//HlHnNOJg .JoB N-BH .N-4H(L L (N//HlHnNOJgLJgB N,H .N,H(L L (NR//HlHnNZOJgr`rAJ,OfFJ.%g@J.g:J."g n4C#aJ.!gJ~gJ.g .~ n4a4 n4a8J,OfJ,g .".a`J,Ogx-y'p@@Jg A"n"` A"n"/Hz/)`N,O A'"KNNL-@ g|r fFJ,!g p,-@`4J, g p,-@`"J,"g p,-@`J,#g r,-A l0CF!Ip,".fA0@CajAQ)H0x`*p,fJ4fAN+PB.`J.fDA:N:Hl,NXOB.J~g .~ n4C,a@J.f Hl,NXONnA0@C,aAk)H0x`p,fnJ4fAN*B.`J.f6A:N~Hl,NhB. n4CaXO@f Hl,NHXONlnA0@C,afAY)H0x`&p,fA0@CaFAz)H0x`p@J.g,)l0l0pHl0@NHl0@NPOJgHl0@NVXO`AN*`Hl,NHnNHnN n4aHl0@N OL,N^NuNVH*H&I-UJg4 n/(/ N)PO.Jj*n`Jo*nXM` nRh p`F nRpNMb-@fp`0*"n#H"#H KNJ n!@fp`1| pL(N^NuH*H g Ua mNL&m MNL*K`L(NuH*H&I+k,,+k00+k@@+kPPL(NuH*H&I gDNJgp`: U"KaJfp`,p0- //-HlHl,N2OJfp`*m`pL(NuH*H&I g8NJgp`. U"KaJfp` p0- //-HlN8O *m`pL(NuNVH*H.&I rNBz-@Jf Np`Hn M"na r nCNXO|lhJgd  n-pJ,Og$p n0( //(HlHl,NDO*`p n0( //(HlN~O *NJgzR`Jf g/ N8XO nNJ L(N^NuNVH*H&I g /. U"KaXO n R'*m`L(N^NuNVH4*n&n -M-K"n Q"n$Q0( j f/*/(N'6PO`"n Q$n"R0( i dp`pL,N^NuNVH*H&I/ / NFPOJf8 nJg& Pan nB n B nB/ / NPOJf / N @.Nu/ *HJ,wf MN|w*_NuH.J,wgp`"*lngR߬n lnreA졛a L NuNVH14*Ha -@g "t5f:-m t n("@3B r(3ASAf"#h ` "` r4gSgSfA "n"""` ma&@Jg n1|1k rm l@0;N.^@~:VV Ka 8Jg (LN@JWDHH N nH` Ka Jg LNx nH` Ka Jg LtvN$m "+`LNB nH` Ka Jg LN?N nH` Ka Jg ~LN?hNHLL N" nH` Lpkg Sa Jfr`r N nH` " SaN nH`  Ka Jg LN>"a @JfS"R-@ a-@g n"@f n Bh` Ka BJg SJfS NL nH` Ka Jg SNN$ nH`b KaJg\ SN&N nH`@ KaJg: SCa $<@vHNHJ.f$<@vN^l ASa`L$<@vNN=rNYAv p"HJfS R-Hal-@g n"@f n Bh` Ka$Jg SCa H nHJ.gnASa`h KaJg\ SJfS Ra-@gB S"@f nN n Bh` KaJg SJfS Ra-@g S"@f nNz n Bh` ma-@g @2( 4+ AoH`H$ n1B Sm "l@0;N|BBBB||||||BBBB``BB KaRJgB naDJf`0 KaJg$ naJf|`Jkf Sa HJg nJhf& Pa 4Jf KazJg nalJf<` KaJg naJf ` KaBJg na4Jf` Sm "l@0;NBLT\vBv"Rvvvvvvvvvvvv>Jkfl SJfS$n"RJfS " Ё. c A a` Ra-@g S"@f n//.NkLPO nBh `L nL NT nH`L nL Nb nH`L nL N( nH`p n ㈀f APa`\L nL N8 nH`: nL$<@4vNl n "(` "tvNjm* nL$<@4vNTl n "(` "$& "N nH`LN6Jg nLN6Jgr`r N nH`LN6xJf nLN6hJfr`r N nH`T"n Q"Sa-@fr` nR" N nH`$"n Q"SahJWDHH N nH .`pL,N^NuH*H0-J@gS@gl`j UJfBB;|`V Ua Jf AaTp`B;| UCf,-@r.gr/HlN n,-@fRp nCq1gR` nN?|-@ @-np:fRRp-@ACa> n,-@fRp nCq1gR` nN?-@ @p]g A0a`RJfB`Jg. . Ma -@ . Ma-@ naJg0R` . Ma-@ . Ma~-@ @JgNN-@ .*Jjz  n"K`SdB3XL(N^NuH*H~|r-gr+fRM,-@fJf&~`pAq0g|RM`JgJfp`pL NuH*H&I~ UN>*r- @f~R M"KNH,JgJgD L(NuH*H.JoJJg MaJf MNM$*@`Sg*Jg& MaJgRM`Jg MaJf MNL*@` `R&MJgRM` RJj:b `8 MN*@Jg MarJgb ` MNt*@ MaXJf` MNLL(NuH*H.JoSg,Jg( MNL|*@`&MJgRM`b ` MN$*@Rm L(Nu/ *HpJ@g@ g@g @ gU@fp`p*_NuNVH*H&I.z UpC@J1g Adp`: Upa8Jg$Snp`" ERp/HN"/R`B3X L(N^Nu/.prAq0Jf*p_g$p.gp?gpA@J0gpAdp`p.NuNV/ *H MCaJ.WDHH*_N^NuH*H&I/ "MaXON L(NuNVH'*H&I nB fp-@-@-@` HnHn MCaPOJf nHnHn KCaPOJfp n nJgp`/. .".N 0./@ .".N XO"/. .".첀gbot`t*$ "<mNKހ . l or N JgR .Ѕ, .谆g N JgR܅` L(N^NuNVH74*H&Iz nB-MACN^Jf`&p nC@J1g rAeR` nJg*pCq1frC@J1grAdR`ACN^~Jf8z|pl(p nC@J1grAe"FR" R`B6h` n nJgpCq1fR` nr0f,p(Aq0gp n(Aq0gp`p@ACN]Jf` n JgB.|p l0 HnAN/0N PPOJf R n |`R`J.fL|p lD A"HJfS/@ EN"/ "rIN Jf R n |`R`J.f8|p l0 HnAJ/0N POJf R n |`R`J.f,`N 0Jg SgSg`. n& ` . n & n rdl J.fl n r nvUf n N FJgp`p-@` "Az$0-B n> n " f n$v f vovmJg nJg np`pL,N^NuNVH.,zx ]m (<k ]R f <c` NJg <n` <m-@Jjޮ f p{Ѐmp ހzp n AாmR` S-@"AஒR-A N*Jg6p;m0 .roS` S .rfr` Az"0-Ap!f/ .".Aa8XO`$ ./AJ/0/.HzzHlNZOA LN^NuH*H.,*/N$Jg SgSg.`@///Hz@/ NO`*///Hz*/ NO`///Hz/ NO L NuNVH*H&IB,wB <-@N*)@f(JPgNHx <"<ANXO)@Jg8 @)K)Ujr)@n)Ax)Hr a,)ln)@J,wgB`Aa~ ,L(N^NuNVH.J,wfXar*@aZ,, ,r a2Jg0 ,ann$ ,aa/@  M"o ab*@J,wg`aL `pL N^NuH)lxJ,wf lxRx"lj qvp,vaJfp,vJ@g@ g@gS@gS@g*S@gS@gbS@gS@gS@gS@gS@g\S@gDS@gS@gDU@gT@ gS@gS@gS@gFS@g S@gn@=gHU@gl`p)@`8p)@`.p)@`$p)@`p)@ lxRx"lj 1@vr=gSx` lxRx"lj 1r@vA+f p)@`SxAa` lxRx"lj 1@vr&f p)@`Sx lxRx"lj 1r@vAq0gSxap4)@`RA졲a<`F lxRx"lj 1@vr0gr1fSxa.p4)@`A0rafA`ACINSt)@jfNM*_N^Nu%s? SYS_TIMESYS_DATESYS_LDATESYS_SDATESYS_DAYSYS_MONTH%02uSYS_DOCSYS_PROGSYS_LANGSYS_VERSYS_OSVER%1u.%u%u STSYS_PAGE%uSYS_PRINTERSYS_DIR%.*f%s %s = (Prec. = %dpcamigacccccccdddcdccdccccmxxxxxxxlllxlxxlxxxxciiiiiiivvviviiviiiixH*o &oJjg ljNQRBjL(NuH*o &o MaNJg M"Kar  MaL(NuH!*H. -"$-‚g Jg`FL Nu/ *H @epp- fAnNK -Ѐ+@"Fí -"-€VDHH*_NuNVH*n MaJgZpp- g|`D n N,-@ p nPH/N7(".R n./@/A N7 . /"/ MNXO`HzH/ N{BPOJf .Av p"Mf`jHz(/ N{POJf .R/Hz/ N{O `@Hz/ NzPOJfA+d"Mf`"Hz/ NzPOJfA촒"Mf`Hz/ NzPOJfA촚"Mf`Hz/ NzPOJf l4"Mf`Hz/ NzxPOJfLHzRp&?NN\O. rF"tF‚$vă///Hz/ Nz@B-Hz/ NJO`jHzv/ NzPOJf/,~Hzl/ NzO `FHz`/ NyPOJfJʞgA:`A0"Mf`HzD/ NyPOJf pO MN{`p` MJfS L,N^NuNV/ *nACf/ HnNJHAND*nN^NuNVH34*n&n ../ /,aPO-@f./ / aBPO,JjJ+`g l+`J(f/ aXO` nJ(f"h$Kf KJfS,`p(@gS@fJ nLN$r n(vփWDHHr Ka JfAND KJfS,`Hp n(/( /(/Hz/ NxO,,-@r.gHx./ NxPO-@Jg @-@ L,N^NuNV/ -HJg4"n ia nNH\ nNHP n*hANH@-M`*_N^NuNVH*n&n NG,HlHzjNϒ lCa L( N^NuH*H&I gN4 m"KaHx/ /a8.Hz(NLOJ-fp"NHl KNJ-fp"NHZANp-rFfprNH>`&rpЀfpRNH*`p-/HzNPOp)NH*m`fL(NuH!*o&o.<'Jg , n mAnNBHJfJJf" e Nw)@ [)@`Jf ,ZNF)@ l)H)l ,"$,A2!RL(NuH*o &oJfA젭NA M"KaJg2Sf lNv)Hp@`2 lJfp`p@` , lC.)H|L(NuH*o &o MaJgalJWDHHp Ma8L(NuNVH*n~B n N!-@ @r?fR ~pOA Ca n CN*JfpH n N/-@Jg~Jfpp- g MN1P`NE .ѭ2pp- fVJg J,DgLJ,fFp2g> n N0",(N1 &@A"HJfS RAND'@ |, .7@ L(N^NuNV/JgP lN,)@pOACa.Jo0ACNE)@fN? lNp@r)Ap`p.N^Nu/JgJ,gp`&a4.pg ap` lNDBaf.Nu/.)G.NuHJ,gp`.,p)@侀g ` lNt. Rg Sg"[g[gHWgHr g gr`lax`n lNtl.pfab`X r NJf Z`@p `< lNt:,p gpEЀf ` pgpfa` a6 `pFLNu|pNuH*o &op KaNatJfAN>> nN-@p nN*~-@BB.pfTah,pgp gJkpFoA"HRAR  m`a0,pgp fbJfHnBBpACaDO nr gr;gpfRK KN&@@r gr N_@`RK KN&@@r gr N^@aRK KN&@r g[fp+rHҁf KN&@*|~unF Ї* Ad)HC`fJf!HH(Jf ,`Jj,R`.S`pL(N^Nu%s '>%s' in document headerqiclex ; NVH*n-UHnaXO&@JgF+g -gpp- gf k/./ NPOJWDHHgLB-`Fpp- f>Hl`HlHzZHnN]OJ,0.gHzNHnN.6ANmPO`AN(L(N^NuNVH*n&n pp- f*ARN-d ,b)@. ,rc ,.",N)@.+m  U+H -HN/ a.XOpp- f lRNx.BR  UN,)@RL(N^NuH*o&m |z-lg Jg.-`~+Gp+@JfLp[@g(Q@g @?g.]@g @g$]@f( Ї+@|`|`pNLJg ` R+@ڇ`L(NuNV/ *nBA CaJg+n/ aPXO*_N^NuH*o &oJPfJTg KNt @NL(NuH*o &op+@*+@&+@b+@^+@Z+@VL(NuH*o &oAV"KIaL(NuH*o &oAZ"KIaL(NuH*o &oA^"KIaL(NuH*o &oAb"KIalL(NuH*o &oA&"KIaL(NuH*o &oA*"KIaL(NuH*o &oA*"KIa+m*&L(NuH*o &o/ NXO eBR` AR"KIaL(NuNV/ *nANC IaVJf Ma*_N^NuH*o &oA""KIN[RL(NuH*o &o M"Ka -b+@J-mg"-Z`r+AB-mg -^`p+@F"-:>BJ+Ap+@+@+@+@2B-+@+@+@pd+@pp- f~p l AN%H AJg0/@/@ A pNA"/ pN$A"/ ! AN$ AJg0/@/@ A pN`kL(NuNV/ *nBA Cafpfp-@ .rbB- .@Jf4 -ưc+@ -2c+@2 -2eTHzD/ aPO`F+m2Jfpd` -+@pp- f&B* n a-@ A CaJg)n**_N^NuH0*o&o-rcD$-&-޶cBR---d* -2c+@ -ްc+@+m2+m` / / a4POL( NuH*o &oAj <"KIa>L(NuH*o &oAjp@H@"KIaL(NuH*o &oAj <"KIaL(NuH*o &oAj <"KIaL(NuH*o &oAj <"KIaL(NuNVH*I-H~ACNK0Jg na-@ @r"g$r NJrIf&p n(NJrNf .r$NZ4-@~`Vp nNJrCf4p n(NJrMf ."<NBr2ЁrdN-@~` .rNY-@~* L N^NuH*H&I M"Ka"Sf r NrNY&L(NuNVH*n&n pO KaJg~` pH Ka.JgJfpp- fN` MN߭2pp- fFJ,Dg@J,f:p2g2 Ka^",(Nb-@ KN KN n!@ |, 1@ L(N^NuNVH'*H&I U-Ha. @r-@Aq0gNp.r0 nRHN @r-@Aq0g r NXrЁ.r0`*&p`p&gp#fvz~R nN @r-@Aq0g>z r/@Aq0g rt0`r NHr7" /Ё.` n*Jg& `*pL(N^Nu/ *H Ma.*@p@,g@fRM` *_NuNVH*n&n .pp- f*J,:gA$` l~pHl-HCTINXO.p- r KNJL(N^NuNVH*n&n| n a-@ @r=g r+gr-f|C Iat-@ p n NG. n r"f@pA CNHJJg.~ApZb& r N-@g/HnNHPOJgR`pAq0xJgp@Ѐހ`~`އ r// / a L(N^NuNVH*n&n -kgA$T`pp- fA`A// / -HaO .Jg-kf-lgNS`p+@`.Jʞg( lʞp"l0)p( r(Ё+@-H/ a|NXOpp- fANL(N^NuH*o &oHl/ / a^O L(NuH*o &oHl/ / a%s' - %s %s %u/ *op Ma*_Nu/ *op~F Ma*_Nu/ *op Ma*_Nu/ *opAЀ Ma*_Nu/ *op Ma*_Nu/ *opvF Ma*_Nu/ *op Ma*_Nu/ *op Ma*_Nu/ *op Max*_Nu/ *op Maf*_Nu/ *opBЀ MaR*_Nu/ *op Ma@*_Nu/ *oJ,OgpNz < MaN|*_Nu/ *opPЀ Ma*_NuH*H.N2J,Og fp`p@RJ,Og `fgA`A# J, fJ,!g ,#!z#!HlF/,HzDHljNBA$"NO gjGJ9gJ9gJ9gJ9"gN  Ma2NNCJ,OggJ,A f ANN\N)@Jg,5g.J,Og,0JghA0a Jf`XAa JgJJ,Og)lf6` p)@6pT2fAaJg|:B( nJg0,5g,N~-@p nAq0g5)n(`pOACN@JJoACNp)@rJrgN4)@~JfAN?lA~N0 lrN`Aa Hn/,rNPOtWDHHA0-@[f lr"l~NSfB,0/,~NPXO` p" lrN lrNz)@,5g. nN-@p nAq0g5)n(` AaB,:J,:gNfN?NNVJ, f-l\p n(rEҁg^N.JgVHnNXO*@JfFHl Hl`HlHzLHnN>|A AN>: nNhOJgV lNB`J nN` @C-Ip n(rMҁgrffJ,"f.J,"8g(A"8CN)@rJg ,")@r lrN J,Og,5ga J9"gAj)H(N Ra 2HlDN XO-@faN& N f N>`JoJPgN JTg lTN nBT,5gH lCۏ J1g8N JgFN p,LAON=r2p,KfN ` AN `,5f|A lpN l:C""""""2A:NA>NAC:""""""2`NJ`gN`.N^Nu/ *H MNJgp` MCNf)@Jf ANDp`p*_Nu/ *HpO MCN6JoAa`JA쫇N4pOANJjp`0AaJfp`"A쫠N pOANJjp`A*p*_NuNV,H*HJ`g, l`Jg" hN fp`p,KfN`6p,LA쬛N2~> fp`Tp,KfN`A쬭NV ,AlJf*/@NAl"/!f lCۏ B1p@~pLN^NuNV/ *HA#Cf/ NA#C+dfAC#f*nN^NuA)H,A*)H(AH)H$,VDHH@0Nu/./HlDN"PO.NupaNuN2J,RgN1f,5gNB,RNuHxHlNPONu,f,g ,Ѭf,fJfJfp"2f ,gp`pNuNN`NZNNN#N6N&NN2@NcTNNNvNNNNFNNJNN84Nq8NNZNմNN(NNNNN9NzNNUNVN>dN7N DN0NrNNN'NN%NN8zNNNΐNNNTNN2:NyN1DN:NMdN>RNN8N6NN(NNUdN׆N&NNNN NpaH*o/p// a0PO,JgLzp$n6 A*&p g&J+ fp@V@dr6g@: KN/^R`BN/NXOp@1,ɭg"B9" L(NuIFELSEENDIFWIDTHWRCCCREMPPFFMSMCABCPSSPSCODEHLSIMPLEMMMFPWCWWIDTHSACCWIDTHSSTARTENDFONTENTEREXITRULESCOPIESFPMPFDREGULARDOUBLEGROUPMENUMENUENDOMITASCENDACUTEGRAVETILDEUMLAUTDIAERESISCIRCUMFLEXMACRONCARONDACUTEDGRAVERINGBREVEOVERDOTCEDILLAOGONEKUNDERDOTCOPYCCCOPYRCDWMWFORMULASCALABLEPITCHPOINTDJBOLDGFXCODELECOPYWIDTHSMENUFONTFONTNAMEMAPSTYLEDPIGPIVRESHRESLANDSCAPEGFXTYPEASPQSCRIPTSIZEPOINTPRECVMSVMCOFFATCRREDGREENBLUECYANMAGENTAYELLOWBLACKWHITE0p=1psGERMANFifteen pitchSchmalschrift*.PPDConvert document to %s printer driver and stylesNV H74*n. MCfAN+xAN+AN+bHl0/N+POJgJf a`p`AN+NJfp`zACɓN+pAN+&@ g KC`N*A`CBN, g$A`N+|-@JRgA`CN)@ʔJfdAN+ACɏN+ppAN+(&@ g" KCpN*FpApCBaDJgp`/ HlHnN*,AN*lp`A`CpfApN*ApCɏN+pApCBaJg lʔNPBʔp`vABCN)Jf$HlCHn`N*POJf lʔNBʔp`Ba B.p)@ .JjR @m <@Hx"<A6N9"XO)@ʞJf r)A.` ,6r lʞ`Sd .JTN*R-@>f|ʜpA@ʝ)Hʘ`B,ʜN) N{n,J,ʜf$ lʔ (".J n>N)f-@F lʔNZBʔN{>*-EdJ,ʜf .F".Jg r)A.` n>"H&H-KN-I::dX nNr[Ag$YAgSAgWAf6RK`2 nN `( nN `RN nNr N)JgUNRN` nN -H:)||,p)@2pN/p)@ɜ)@ɠBlaBp@Ѐr`N)XO)@ɘJf p)@.`AɘCNN)P|p)@J,ʜf-n>N`)@ʑap-@NJ,ʜf nN:dx nNPWp .WfRN`p .WgJ nN)H=CgN'Jf&A ,J0g nNCh N'~Jfp)@.J.f l=-HN nNa-@NfzN(Jʔg lʔNBʔ n>N'VJ.ga~B,Q ,.Smf l^@0;NR",6@JA-H6`:A-H6`0An-H6`&AN-H6`A-H6`A2-H6`A&-H6/,/.6Hl.HnN&AN&p`pN-N0fJg<)|ɠJʢg. lʶJf& l1P lBPA)H=/aXO)|ɠp-@2 .2nr Nx l)HN/F-l.J.g n.Jg (r -@*NxZ"lJiffJif` .*"lɘ/) HlhHnN%p,LAN&O r2p,Kg p)@.`t .*r Nw l"l P.`pR2`: lɘN%BɘAa#-@2Rg .29@ɾ`9|ɾpN,,ɽJfR lʶ(Ug([fp@ɽ`6(Yf(Ug(Wfp@ɽ`(Sg(Yf|ɽ0,fN1"r N4z9@r2 <N()@p lʶ( r(Ҁfh lʶh p-@2 .2rPҁlr Nv l"H-I.Jif0(3@Jif l3hJi f l3h JQf:p0) lʞ$Hr*-A*tPԂev-C* .*r Nvx$l02Jif*_Nu/ *op a.*_Nu/ *opa*_Nu/ *oR ep)@.` Mar a`*_Nu/ *oJfp)@.`&A ,J0gAJ0WDHHpa"*_Nu/ *oJfp)@.`S*_Nu/.A ,J0g A`AB0.NuH*H&Mp fRK` Ka*Jgp`r g r gRK`p fpL(NuNVH*H~&MA-Hr gr g nRK-H` nB AzJgHnAz/0N~POJfp`R`pL(N^NuNVH*o$a.Jk pFo r NJg lʶz:Jg lʞx8Jg*`pa Zpa , lʞ&HBS @ rF@aJf lʶ 0`x lʞ 0`lJʦfNpa  <a 0 l1@N"pJgFp lʶ( l"lʞp0(0< lʦQ Ѐ lʦ/Ha o0L(N^NuNVH*oa,JkpFnJʪfJpa ppla l1@N"Jgp lʶ( l"lʞp0(pk lʪQ Nh,rPҁ܁ r N(^JgLppЀ ЀЀ lʪ/H a o 0 l=r;f R=a.`~ ЀЀ lʪ 1@L N^NuNVH*na Jga.JkpFnB l=p=g p gp,fR=`HnaXOJgN l=p fR=`p*f"R=HnaXOJg$ .".N'-@ ЀR lʢ .0`L N^Nu/ *o*_NuNV/.a Jg Ѐ lʮ/Ha o0.N^NuH., a l=r;fR= aLNuNVH.HnaXOJgF l=p fR=`p*f"R=Hna XOJg .".N&-@ lʶ .LN^Nu/. l=N.SgSg` lʶ` lʶ.NuNVH~,,-l=R lʞ*H nN^-@ ,ΰ6e p)@.p`$ np gp;f^pFmBT ,ΰ6dC// / NO | rF "<Nў@` @ n)H= `p+f&C INr @f na)@=-@`Dp"gp'f> ,6( c(< M CIN-@rgހѬ`ACNFJg GR ."R` GR RR`L N^NuNV/~ l=p fR=`p'gp"fdR=~ l=pf:R=~ l=r`Ff. r NDJg R=r l=Ё.R= l=r gR= `4A=CNxJg pF` l=r g rR= `p.N^Nu lʞNBʞpIrAɜQ)H(9|ɾ9| )|h9|, <)@ɤ)@ɠ)|ɜ < )@ɸ)@ɨ)A2)H)H)H)Hʲp)@.)Hʺ l0"NJB0" l0N>)H0)Hʮ)Hʪ)Hʦ)Hʢ)HʶAaXp@C@ lN lɘN lN l|N lрN lфN)H)Hɘ)H)H|)Hр)HфNuH*H MN&@NHx / Hl:NeB,BA:NHx.Hl:NbO&@ gBL(Nup)@2pNJlg lʞp0,"H)Iʺ ,ʞNuJʞgtJ0"g ,0&A0"NJg& .r lʞ"MN*Jg MNߢNDNp` MNߐHnBpA?NA\ONN"NpL$N^NuNV(H*H.-H.-H2-H-I* MN",pg MCN&@Jg MC6NJgpbrA>"KNJg .>fJgAR"n*NlJfA6CNZJfHlC/ NHPOJgtA"HJfS* RrA"KN8JgXACfHJff@JJg( .JN$-@2Jg( .Jr n2"KNJgJNg( .NN-@.Jg .Nr n."KNJg .BN-@Jg .Br n"KNJgB: .:Bdp n".:0FR:`JFfa Ma MCCf9n69n8)nʞ)nBaAVCɜp""Q2J2g n2)HNJlg lʞp0,)HʺJ.g )n.0)nN0a KNPp` nN  n2N  n.N KN.pL(N^NuH#. ,"҇$SFS‚, aJVDHH LNuH. ",Ё6c p)@.p`,߬ LNuJʶfpapa l1@NJfp`t lʞp"l0)p"lʶQNdJf p lʶ@ lʶ|p lʶ@ lʶ@ lʶ@ lʶ@ lʶ@ lʶ@ lʶ@pNuJʮfVpap0a* l1@NJfp`8 lʞp"l0)p/"lʮQp lʮ1@ lʮ1@ lʮ1@pNuJʢf"pa <a l0NJfp`pNuNV/./Jʲf8pafpހR` "<N$:r2 L NuNVN^Nu/ *HJʞgJg l"MNL`p*_NuNVH*n.zB. MCfANpA$NJg|pA$N&@ glAN~/ /NPOJfzJgPA$N2JgDp,L/@ANL/HzՂ//NO r2H gp,Lfzp/Hna4PO,JgJgJ.g|A:"HJfS RrA$AN-@g A:"@fJ0fp)@0p",0A$N)@$DNN2N N3NNN6N;2NNEN:N3hN7.N=N4>NrN3N=NʎNFNNN~NN|NN=`N N7NNN7nN4PN NXNN `*Jʦg"p"Hҁ lʦ|<Jg lʞ `pLNuSWCPDiv by zeroldriver2.cH.Jʪg pЀЀ lʪ|<Jg lʞ `pLNuH.Jʪg"pЀЀ lʪ|<(Jg lʞ `pLNuH.Jʮg Ѐ lʮ|<Jg lʞ `pLNuH.Jʲg Ѐ lʲ|<Jg lʞ `pLNuH*H.p",ɰA°gf,p-J@g S@gS@g,`FG|`:-f p@,`(G|`-f -|`@G ,ɰF. L NuNVH'.*H,ppfAT`A$&HfA`A$H-Pp-HNK4JgPp@FJfdp;@;@ ;@;|dpaJʶg0p lʶ(r(Ё;@ p lʶ(r(Ё;@ Ma Ma`p`Ѐ`jJf"prN -@Jg n /+ /N lPOp"HӮ n 0( ;@frx;AJhg&0(;@ r2)Ap0-NNrdҁN;@Jh g;h J(g"k `"l0-Ig(Jhg"p0( Ma -@rg +@ Mapr`ҁЁ`pN.Jg @p`zpN*Jghprpҁ-@",ɴA̘$0āJgF$āA̘* .ЀЮЀ lʺ-HJhg&0(;@ r2)Ap0-NMrdҁN ;@Jhg;hp0-@ g l h "MaB-@rg+@ Map@`p Ma,Jg p MN p*--@J-gXp-rѮ nJ(g"k `"l0p-@-IgJhgp0( Ma:-@ .rg+@` pa. Mav Mag .L(N^NuNVH4*H.pN}Jf pN}xJgp`p",ɴA°gp`p",ɰA°gp`Gp KNJ+g- rpfAT`A$-HfC`C$H$Qp+r-J-I-JJ*g h ` l0|-HgJjgp0*"KIa,pg 'F` Ka` KapL,N^NuH. ,2g6 lʞ)H)G2 r NJ l)Haa,aLalaaJʶgJf"p lʶ(r(Ё)@f)|Jʢg. lʶ(Ugp(r(ҀJga)@ʢ` lʶ(Ufp(r(Ё,p(r(Ё"Nf, r2ЁrdNn,Jf AjN8`:p0,",N:"Ё"Nn~, rF lʶ@  lʶ@LNu/~ l>Jfp` lʞ )@ʢ.Nu/~ l>(Jfp` lʞ )@ʦ.Nu/~ l>(Jfp` lʞ )@ʪ.Nu/~ l>( Jfp` lʞ )@ʲ.Nu/~ l>(Jfp` lʞ )@ʮp a)@pa)@( ,ʮ.Nu/~ l>(Jfp` lʞ )@ʶJgr @()A.fp)@.`r)A. ,ʶ.NuH*H~Jg*&l,Jg f.+`PK`+GL(NuJgp`pNuH.,Jʶg6 lʶz:Jg& lʞ*H-f-fA `z:`pL NuH*H~>- Jf&Jʶg p lʶ(r(Ё.Jf.<pH@g0Jʶg* lʶJ(g p("NGr2ЁrdN. a.)G -aL NuHJfF </"<PANXO)@Jg ,r l`Sd ,"<Nk)@ ,"<NGJ l"H&I*HdJg6 -f 2g,`NJ",Nk <NG l*H/ a"XOA ` lʞp"l0 L(NuNVH*n+l*2Gp a-@gRA"lNJgl lʞp"l0 ,-HNBH~ l< Ѐ/@/@ p n /00NBH o /H N\"/ 7R` KNN| L(N^NuJʶgp lʶ(r(Ё`pNuJʶgXJʢg< lʶ(Ugp(r(ҀJg p"lʢ0`*p( r(Ё`p lʶ(r(Ё`pNuNVH*H.,xJg l"MN*pgp-@-@ .nr NEX l&H lʞp0+p(-H亀fB aJg`.p n(f`p(r(ЁfJg* fJSfp n(r(Ёf .o(.-@R`> L(N^NuNVH4*H&Ip0+ r2+ Ma.pf`X r NDl l"lʞp0($Ip0*-H I-H-Jg * n,Jg f.(`P` L,N^NuNVH*H&I~Jʞg4 g0|plJ3hgp"3hg hhR`B6hA"Ma4. L(N^NuH!.Jlg*p0,"JjR$ԁr2 Nh&r2,N. LNu/.pd" Ѐ~A>0JgJʞg lʞ `p.NuH*H.p-r-Ҁ,Jg lʞ&HJSgp0fp`TK`pL(Nu/~pd a~Jgp`R`p.NuN5N4N+N!N NהNNN:NN NJ,yg4J, f.J,˭g(J,#g"J,fJ,&g,fHxNG$N?XONu%s%c, %c, %c, %c%ld%c%ld%.*fPress colour, one of RGBCMYK:>pa aavNuJ,#g$J, f,gJ,́gNA/N?NXOB,́NuNVH1NqJ,{gnJ,xghJ,̀WDHH@̀HxN@Tp`)@`NAN?N@bN=BN?J,̀WDHH@̀HxN@p`)@`NAB,xN?|POJ,{g J,gNAPN@N=dN?"NA.*@ ",\Ь"R)@pf>-pNsJg.pNsJg"pNrNJg p/N` XO MNe*@`)l/l /l / ,9@/ ,0*Jo"Hx NZFXOr2 ,0*N@r2,/Ҁ9A/J,gbHn/ a7PO&@ gLfLL NH N=.)n)n)KNu:,.ʲgN=J,gN>J,ːgNN>$L(N^Nu ,<tJnDrm)l@4)l<0)l8,)lt<)lH8)lD@NuH'Hl/N@.Ntl@.N<@. lpN|L@.N`B,pFbb r g$Ygr gN`Za`N>`NaN4`BaN5`6N7`.aN66`"J,vgaN4`HzN7XOJ,Rfa N`6a`.a`&a`a&`a `a `J,XgpN1|`J,XgpN1|`J,XgpN1|`aa `J,XgpN1|`aa `a `a `a~N0`varN2B`jafJ,}ga/`Xa`PaVJ,}ga/V`a Ra`4a`,an`$a a `aa ` aa *`aa j`aat`aa`aa `a`a`a+`N1"`N3`N1`N0z`N2(`ap,"B/aVPO`xaJ`paD`haH``aL`XaP`PaT`HaX`@a\`8a``0ad`(ah` al`ap`at`ax`a|`N0`a)Z`Hxa"^XO`N0`ANe`J,>WDHH@>`J, ga `J, fa `Hxa"XO`Hxa!XO`v/N0XO`lN.`fa.<``pRa-`XpGa-`PpBa-`HpCa-`@pMa-`8pYa-`0pKa-`( !m 9n  rN1T`/N.XOJ,fBNa:JgJ,#LfA$N.HJfNpJ,%g` ,h",LN.P`PL Nu/a ,trg..,$Uc" N1 ,fbr`" N1NU.Nu/at~ ,$UlN.rAe8 MNKN*@ MNWj @pA@J0gpAdpAq0f`:/ a*XOJf. MNK *@pA@J0grAd/ aXOJfp f/ a8XOL NuH*o p -f ` MNKr*@/ aXOJfpfp-NXhJfpA@J0grAdrAq0gRp -f ` MNK*@pA@J0gpAdpAq0fpfhp-NWJf`Xp -f `R MNJ*@pf p-NWJpA@J0gpAdpAq0f / aXOJg MNIL Nu/ N$*@p fa`/ a, @N#vXO*_Nu/ N%P*@p -fa`/ a @N#NXO*_Nu/ N#*@p faj`/ a" ./ N! MN#N$JPO*_NuHN$&@p +fa`"/ aH*@ " ./ N! MN"N$ POL(Nu lpaDN NuH./ rCg8r gUg4Sg@SgTUghgSgSgSg`a (`J, fa`J,WDHH@NH|`J,WDHH@NHd`N!j, ,LN Jf0,"A9A0,r?AfBl`9A N!|NH"`VJ, fPJ,WDHH@NaHN!`6BHxN$PO`(BHxN$xPO`BHxN$jPO` BHxN$\POLNuH*HNkr,N!.pf Nk`rAah.a6N^NuJ,"WDHH@"r̒fJWDHHpNNNupra"Nup"aNup"aNupraNuNVH.,N *@p fa`bJg M` / a XO @&H-Mpfp-NRJgTMJg pN!`pN nNFV*@eN`NFf MN L(N^NuNFr)l4D ,,N ,0NNF"NQNuHJ̆ghĴgbN $. ,̆ l̂r (f//,pN xPO*@`N*@ ,̆ l̂"M`Sd ,̆ M"l,NN־gNEaNL NuH/N!R*@p[@gQ@f,N{2Jfp`$*lp`-f MN>` MNE\*@`RM`L NuHN!*@p g MNE8*@N p[@gQ@fBNzJfa`8*lp`-pNQJgp/a MNXO` MND*@`RM`L NuHN *@Np -fN}|Jfa`< lpNP*@` MNE^*@pf-pNQpJgp/aP MNVXOL NuH /p",LNDJfp`p",!NDtJfJ,!NfNN^J,xgp",NDTJgJJ,jg(p",ND>JfAbCp$Ip$$Q4`A!FCpp""Q2ApNxap/a2XOLNuH/p/ap",LNCXOJgNCp/a"NOXNXO`2pNr*@NCprtFg prFҁfN` MN]hL NuNVH..N*,p0ЀAw&H:8+=kB l| r?gp_gP]g,]g8r gUg`vHxaXO`HxaXO`J, fa 2`J, fa ,`J, fHxHxN0NPO`pHxaXpNv*@NB MN\XO`RpFb Aq0xg rPЁr/aXO`*Jf~>` .rf~>` Uf ~>.B.J.fR` r2 N`&L(N^NupN6NBhA쩥a2/apNNBPXONuNVH1N*@p g| MNA&@r glrf t-vtFf[fp+rFҁgF KNA-@" .  KC`Sd  KNH// N~*@ A"M`SdNVL(N^NuH*o~lpAq0frRM Nh./ NXO,Jf|p@cg*@ gY@g(`6NA* NyNLN/,DNXO` N*`NA/aNLXOL NuH ./ J, fJ,!g|!|bp!JfJ,!NfNJJ,xg ,eBJ,jg ,dAbCp$Ip$$Q4`A!FCpp""Q2ApN ,d BaXOJfLNuNV/J, gp `p)@ZJ, gp ` <%)@ADN. Ggl Gb&p0Aq0g/,0HzNHnN?O `8p02,Gf",0`2,Af",0`",0//HzHnN?OHna8..N^Nup,LANQ(r2p,KfNlNNNNNuJlgBlN?LNuNVHN&@p +gh KN?*@pgXp nCNv,pfJلfAnNMBJg. MN// N{&@ A"K`Sd KNNPOL(N^NuHlހatXONuHlލahXONuHlޢa\XONuHlީaPXONuHlްaDXONuHl޽a8XONuHla,XONuHla XONuHlaXONuHlaXONuHlaXONuHlaXONuHlaXONuHlaXONuHlaXONuHl~aXONuHlaXONuH*oJ, gp`pJf l ^*&Up gRK` .|  lp"HSI T//,pNz&@  U"K`Sd x x  KC$NN&aPO L(Nu/ N=NrJfap`@ lpSHp f lpNI4*@p fp-rEҁgNrJfap`a4p*_NuH./N**N,b ,tcNuV lpNHr @f ,tcNu:Jf lpSHprEҁf ,tcNuJfaLNu/ *oJgprPҁЁr/a XO`*_NuNV//Nr/@ r oaSg Sf N0`N.N^NuH*H.,J, gp`zpNIrf0,g&Mpf8p-NIxJg*p-NJJg-f MNp`( MN;*@`*KJfpf-f MN`.Jfp-f-f MUHN`p MN @N|Hp`p/aXOJfxpNHJgprpҁfA@`Aa,,Nr2ҁAw*H=U=m=mB=@ lx* r#g_grgp$fpr`ҁfz`hpFbpAq0hJfp@f prpҁf NrЁr@*`,Jf|<.` .rf|<.` Uf|<.xJfR`Pp gJg r2 NV p/aXOL N^NuH'./J, fh r gr gg QfN~ z`~-zpNE,p0,"†g"Ft4ā9BN7pHx/N r2 NUPOLNuJ, fAza/arXONuJ, fJ,#WDHH@#NB,yNuJ, fJ,$WDHH@$NNuJ, f.J,!WDHH@!NP8NNp@j@x ,tNoNuJ, fJ,WDHH@NNNu/ *oA/)H(Hx/ /NO *_NuNN{^Nu/,g.,Jg ,"N6N{<` ,N{2.NuJ, WDHHr/NB,RN,N$XONuJ,˭WDHH@˭NNuJ,ˬWDHH@ˬNNuHJ,̀gJ, f J,gp`p.`J,$xf J,$vgp`p.,,,UJgS ",,/aXO|xLNuNVH1./$ ,,"Uc.`rd.")A-J N@$,,RH N HL L NH."LN^NuH1J,{g4 ,,RN `L ."N$f8|L-AaX*@r g$rlgrLf|--A` MN3z @N?*@`p@D@Ca`a^Nn` ,m a݊NX` ,oNF` ,#RЬ* ,//,fN PO(JfN`t ,)@$)@D NyF Nk gUg` N^`BN `L N^NuNVHN VJ,BgN.,",-JWDHH,pl. ,,Uc./aXOJgN lN lN ^Bp@B@DJgJ,̀f aِN `/,-JaXO|x`J,Cga*@pFg> Jbp,-ANrRg$SFg MN/4 @N;R*@` MNup- MNIBpJgRa*@SJg4 MN/ @N; *@p f ,Jr- MNm,*@`pNrRf` MNuBp,-A MNHNNJp@C@Dp)@J)@F`NJg(,H-ltNQ&@ g KN.|-@p nfB(pN<0Jg2pNNeNgPNYNwNnN6N"N$Ni6NTN|NY>NN~N bN >N/N6NYNPN|NtNUJNrN/N{NgnN$pNqJNUNT:NNgHNZNƸNVNBN׌N7NmNvNrN$NNY6NsN/NmNN6NN:NN:xNQNxNNONNa(N3NRN8NwNNyN12NNXJNuNNM:NyNMdNpNk6NZNNN"ZNUdN_fNvNpN`N[NNXN6NM&NNNNMNENfN2Np/Nn. S",#c/N$4XO.Nu%uhypH*o p@ gY@gP`Nh M"lzN2Sf< MN#&@p f(p+rEҁfr g[fp-rHҁg MNiL(NuH//Jfp@g@g` ~`~aKޢpr//aPO g/ N2XOL NuNVH. .pf|pf|Jgdpg\No*@J,"g/ aXOJg MN=*@`Hx/ N`PO*@pf`pA@J0fN`RM MNc*,,gJf ,ЀЬp g$J, fJ,#gN@XJfNgt R",bNf$`N{pF MNh*@ MN"*@-Mp -g0 MN"&@ K/aXOJg/ /,paPOJg *n`*K`p -f*na Maa,gpna`peap lpa NfNњHxNXO*@ g MNhL(N^NuH*o(-Jf(-*-&m ~|b8p[@g&@g$@ g@g@ g@g @ g`RK`R܅` L(NuH*o Hlpa. r MN_PXOL NuH*H/,$anXO.| l$ c |Jf~`R T// l,NPO*@  l$( rpgR$ SJg `Jg| L Nu/ *op[@gY@g2Y@g.@g(@ g"`$p-@ g@Vg @/gU@fp`p`p*_NuH*o &od/ aXOJfp` MN *@`pL(Nu/ *opa*_Nu/ *opa*_Nu/.J, flN pN1*J,OgA욧N1<,g NJf `*axJg"NJf,JgpFЀ",NJfN `pN0J,NfN>N+>.NuNVH. J, fN=VJf,,D*,HNjD-l",-@-Afp-@Jg ,S".NR-@|Nc/@pF oNe lpSHprEҁf Jg ,treU` ,f/NXO`N4(,ta/N)FDaNx0NbNΔHxNPO*@ g, MNeb MNm*@p fp-rEҁfNp@y@L N^NuJ, faNqNB,yNu/ B,yN<.Jg lpN.Jgaj`N͂B,yp`VpHf$NtNbp*@/ /,paPOJf /,paXOBa,gpna`peaBHlpaPO*_Nu/ J, fLN;Jg p lpN5*@Jg,p MN7 @K`*lpa"p M"MaJ,NgNw B,yN*_NuAZ)H,A[)H(Ap)H$J, f ,gp`p@0NuNVH'*n. l$( rpf Jfp`^B/a6PO|p*@Jf:p-@&U l$ (-@(kgJf (ЀШB|Jfjr@[Ag:YAgYAgAgA g`prMҁf> l$( rpg0Jg .p-@N"&@NJJg lp-H`JgrftBr grfz,`\SKp Ka`Jg lƱg@ KN(N&@`4p./a.XOr2Ӯ .R".c|` J.f-KB.`p./aXOr2Ӯ-K|` KSH/./aPOѮ-K|`@r f, KUH/./aPOѮ l$!n-K|`|r N&Jg @`p.N(Jgfp.rGҁf2/aXOr2 .Ё".Rc|` J.f-KB.`t N'Jgp./aXOB.`p./aLXOr2Ӯ .R".c|B.`p./aXOr2Ӯ .R".c|B.`Jg l$( rpgN`JfHJg/./aPOJg" KN-@ UNif @N&e K-HJPgf nN @N(JgT&npf6p*+f.Hx/ l(NHx/. l,NO @*-H` KNJg KN&@`p nfp(rFfT naV-@A ap U"naL l$( rpf Ua&@JgA*`BN`<,g lpaNNJfNp`PKp,g A aj`pea JgJ.fJgA` KN$ @C I*z`B,pL(N^NuH*H. l$( rpf6JfF,,,DN,Dg *lp` ,ʰf | `AN$$ @C INXHx/ l(NPO&M MN$n*@p fHx/ l(NPO`pfp -fHx/ l(NPO`Hx/ a$PO l$( rpf pr KNX L(NuNVH!*n.p[@g Q@g`-r_g r fJgHx/ l(NPO` MN#&@pfdp+rHҁfVAN#-@ @t g[fp(rHҁg-fHx/ l(NPO`pHx/ l(NPO `Z MN*@`NRM`HL(N^NuNVdH7*H.-Ih l$( rpf.,g J,DgJg,f,5g `J,$gz&M-hpr-A-K-E@AC""""""@Jʢgp@|Jfr@[AgYAg"YAg Agb`hJ.f-ER|`l KSH//a POڀpr-A-K-E@AC""""""@JʢgB.`|J.f|-ERHx a XOr2ځ`@r f KUH//a POڀ-E`|p.N!Jg @`p.rHҁgr N#(Jg.p.rGҁf:t g[f.r+vFf +fp./a XOr2ځB.`Xr N""JgJNr./-@aXOJʢf Ngp@B.`p./a XOr2ځB.bT`prEҁf l$ (-@(kgJf (ЀШ .搮RHo(kgJhg+r-gr+frpGЀg nhN jHx -@ha rr nh.?@ a `2/ t4r2ԁp nh(./B a >r2 / ЁHx-/@$a (POr2 /Ёr-A-@JʶgN-@fNb-@ .Ю".Rb .rdN/@ . l$"(N".N"/caTJgSK K-HNr @A@J0f nhaJgB.|/.hHnSNXPO-@pAR .pr.fSpASpB`/,HnHnSN.HnHnSN0OASC-EB~-H-H-I n@HJgr/aXOr2ځ nJgg pxЀJgr`rA}p fp./aXOr2-Al`p0fHxeaXOr2-Al`BlHx-aXOr2Ӯl .lЅ".RbHx aZXOr2Hfp-@ .".NL-@ .".N<-A`p".-@-A` .B-@ .".N-@ .".N l$( -Arpf|p2Jgr,f,gbJ.f\(lgHx aXOr2 .N^Ѯ`N".NLѮp-@ .".N-@ .".Nv-A` p-@-@ .АRR-@ Ka&@ Ka&@ Kax&@p gS .HJg .JnRS l$( rpfB .H",.tcN-@ .",.NӮ ,.".eR`p-@ .ЮHJgroҮ rpNЀѮJg@ KN/./ l,NPO&@ .SJg `Jg .rpd"$vԃ“-A`L(N^NuNVH?*H&I.p)@-M/.NXOJg nN -@` ." // l(NPOp g0JfatHx aXOr2p)@-K-A na ,,-@ @a-@p nf l$ (Ш*Jo(lg:Jg4 ".N d( ".N X-A ,.tc ",.N @-@`(B// l,NPO-@ SJg n -H`JgZ l$( rpfLpoЮrpN Ѐ//. l,NPO-@Jg& .rpd" n$vԃ“-H`L(N^NuH*Hp[@g Y@gY@g@g @_g` `-prHҁf `p f `TMpNpJg`TpNJgprGҁfp fp/ajXOr2Ӭ`npNJg`p/aXO`Pp/aXOr2ӬRM`6TM`0L NuH*Hp[@gY@gY@g@gZ`-pNJgTM`prHҁfp/aXOr2ӬTM`p f/,/ abPOѬTM` `2p/a0XOr2ӬRM`r/,/ a0POѬRM`\ L NuH/|J,0g>Jʢg2p"Hҁ lʢ< lʶJ(gp gRF0, @e RF`N, ,ɤgF LNuH/p@_g@/gU@gS@gS@gS@g@ g `t~ `p~-`l~`h l$( rpfp`b(kg,(r`(jg (vШ~,R`|Hx1a"XOz:p d `$pdd Ѐ` ЀЅ`p` p/aXOLNuH$*o./J,0g // aPO`  M$l$"j NL$NuNVH'*n l$&h ~l-@*(BN l$"(R-@-ApfpNJf,p f SKe`prgpRgޅ .Ѯʾ c .ʞ".Ɠ-@ޅ .Ѯp[@gN-@rc$S ".N~` S)@2Jʢf ` p` MN}*@AC""""""p-@-@p[@gY@gY@g`\p gtpNFJg`DpNrJgpNJgp/aXO`p/a8XOr2Ӯ .Ѯ`p/aXOr2Ӯ .Ѯ`n .".$.ʔ-@갂c-A` ."ށ". $ԁ-@c.``L(N^Nu l$( rpf Aah` C Ia\Nu/.p@bgS@g"W@g2U@g$]@g `2Aa2`4A$Ta(`*AHa` Aa`Aa ` l$aAC """""".Nu/ *HA ar g*[fp-NXJgp-/a(XO Ma*@`AC """""" *_Nu// p l$( rAN.NuNVHG:,fA`A*H~JgAR"MNb~HlHNTpXOJg +fdpJ+gh*, ,R lNv-@ l-H n|T/+Hzx/.N{"Ѯp n| n@r nA n@ nA\ .搬)@ + k"n`Sd +Ѭ l"H| l-HprNXpna,,BHxHnaO)FB -l l"nd IN(ѫ na* @C-I` +"+ NNAN ,R'@ lNH'@ )@ n"l`SdANtB+&S`|JgAR"MNHlHNRXOB,dL(N^NuH./ *oHx#/ /NO L NuNVXHaJgNG/N&XO*@ gN6/ HnNPO,p.6hfSB6h`/,Hn8HnNO JgnGpA/,Hn8/-H\NO ~ n\Jg<C8zH\Jg"pf?`pf!` pf%R`BApN NL(N^NuNVHJg ,A셴"0`r.Jfp`TgRa A pCfACN,0pAN&@ g,HzBHx/ NO)@g )GTp@̋`*K`KHn/ HnNx6ANBTp@̋L(N^NuJg/,NXOBBTNuH *HpA@J0grAer NJfpfvRMpf*p-rIҁg`rtGԂgTr N XJg>`XO*@ g -gp`p*_N^NuNV/ J,#ga Jfp`,-lpHnN>nXO*@Jfp`-gp`p-*_N^Nu/.Jg NN` NpN'.NuNV/ *H MCfHzxHnNfHlHnNfN|TAN*nN^NuNp@T@JNuH*H.  MNL Nu/ *H|zN?fp"Nep gp Nw MNeNeN?NN@*_Nu/|N2NvNv. o l r2 a B,Nh .NuNVH0*H&IHl.*/ NeHl/NeO @-HRH-H",t lv0ց`v$ltA҂`r0&"@.-H K"nf L( N^NuNJfN?N@ Nu/.NJg g fNFJfJgV l(gNF)Hp@w`bpopFm p gp f  lN`/Hz/,NO J,wg" ,@ЀR@"A@1 @mp`p.NuH./Jhg p gp fNVzpf2J,DfJ,EgNu ,-Bf ,-Fgv.<`l fJ,wf\a`T g g f,J, f&J,DgN r2/N~> aXO` g fJ,fJ,g NH.<J,f fJ,f g aPJfJ,EfJ,wgJfpK@ ,@ЀR@A@1| ,@Sl ЀA@ p eA@ pd R`TMS@J,DgAF"MNz|` ,WDHH*_Nup,rEҁg lpaJgr`r Nu/.J,wgJ,f ,@ЀA>1.Nu/ *HJ,g MN` MN>*_NuNV/ K / A"nNjAa*nN^Nu/./r^DHH.Nu/ *H Ma:" T*_NuN2p//prNjxNGlN4|xN4PONuH *Hrf(r-tGԂgt_gtrIҁgr`r`rpA@0" L NuNV-HpN^NuJ,Nf p@R@Q`N3NuJ,˯WDHHNu/J(g~ l()H(Jf^B(`XN.J,̑gF <Ьr gYgUf$/aXO.`"/ajXO.`/aXO.` /a:XO.pg .Nu/. o  l ` Nh.Nu/./p)@ o  l arAm l@0;N2<FPZdlt|.<`.<`.<`.<`.<`.<`z.<!`r.<`j~ `f.<`^.<`V.<`N.<`F.<`>.<`6.<`..<`&.<`.<`.<`.<`)G~ .Nu/./p)@ arCg2Sg6Sg:r gLUg8SgNuN#vNʎNJN(dNN6NNNNN7N*\N0hN7nN8NN\NN/N$NDNN6N NNCnNVH4*n&n MC$I0<$Q K$M0<$Q K0< QL,N^Nu%s - %s%-2u %.40s%4uK %.90sH./Jkp$op`JfXzp$nFx|p$n0 A**p g p@f J,&f*` fx`R`Jf.`R`Jfp`|p$n A**p g f `lR` <XN*&@Jfp`TA"K0<"Q rN"&Jg R\Hl/ aPO A*! ` KC0<"Q KN*,pL(NuH.///aXO*@Jfp`HNJg(Jf$pN*B&@Jg lXN))KXA)H`N/ Hlap0,ɾ g07l 7lp0,ɾ l h "KN$<.pg'G KN$$~pn. A̘"0†gp- "tpԂ҂t" KN$:R`Jf-lgN$`p+@/ N$XOL(NuCEFNFEIllegal locp(). Contact Arnor/ *Ha"t+HRJJfJ- gA-`A˿+HJ mJ+HN+H@A@azA@B/N#PO+mH@p6fA2C@p Q0*_Nu/ p)@T",`X[)AP*lXp r)M\p)Md| | @ ]B @ @ |! A a"B)l\ Tp)@ X| \)@ )@!:p)@!>N"A TN# p)@ )@ )@ )@ )@ )@ aafax*_NuH $NBN"JTg pN"*@Jg lXN"B)MXA)H`B,A$Nap)@$ap)@L)@#)@D)@4p)@0)@,)@H)@N%N%lN%Xp@#@#L@'NVJ,"8gJ,"gHl"8pA?NA\ON!A"8NӀp@"@"8J"gHl"pA?NA\ON!A"NXB,"J,#gHl#pA?NA\ON!B,#Aa l$HN!dB$HL$NuJ,(g l!XN!LJ,)g l!PN!>J,*g l!TN!0A TC!Fp""Q2p@*@)@(NuA!FCbp""Q2NuA!FCpp""Q2Apa N$>NuJ,xf ,trApa Nu/ *HJf+m  MN! RNpd+@B2*_Nu/ *Hp@-c:R---d,"-2c+A"-޲c+A+m2+mp`p*_NuH?*H&I UN(*-"J:f~`(-jg -"-"NH^rdNH` -"rNHL.,Jg -kg-kg ߭R`JfJgJ-g -kf Maۭ߭2 -2ЭzeB- MaJgb MN `Zp MaJg -z"-2$ԀԆ&-c` -2ЭzІbJ-f -kgB M"KaXOJg|`L(NuNVH*H&I-kgp`$-jg -` <X. -2Эz/@ -""NG2rdNFЀ"/Ҁcpp- f^p+rEҁf"l` Q hNr @(HpEЀf"l` Q"P iNr @(pEЀgp`| f UN&@Jf Kz(-HTH-HJf ,PRѮp gJg nNJgp nfp(NۂJgT` nRHN @PC-@ IN @PB.HzHn-@NPOJf`tHz HnNPOJf nN @p gp;fz`HzHnNlPOJfz`Jg, nN @(-HTH-HJf$ ,PRѮ` nNٶ-@p+rEҁgp n(f0p`.p n(fC INzr @(pEЀgp`pL(N^NuH*H.|Jrg\-kfTJ-gJ-fHJvf <`p* -~ЭvaXڀ -z"-2Ҁ҅dRRvۭzSrfJg -v` L NuNVH*H&I U-HHJf ,P"RӮAC""""""Jf ,PRp[@gQ@g`prHҁgpNvJgpAfNDh`pNٚJgJg@ -c -2"$.e`$ -2".d .2 .Sp`pL(N^NuH*H.-pfp`4J-g!Jg MaXJgApfN,B- Sr MapL Nu/Apa.a .NuAbaNu/.J,xfa rApaHa.Nu/.J,xg ,tda rApaa.Nu/. rAba.NuNVH'*H.,mJf~!JeJ,!NfNA!F-l$L-l$P-HJg. nJ(g$ (d"nc-HpyЀѮS`J,xgL ,tb4J, ff,g ,&.f& n"(cCp-I`" g"+dGpJ,jg* ,fb ncAb-H`" gdGbApfN  nH" g|"+*∺dn MCp""Q2 Sdca K"Mp""Q2J.g Ma^` Mapc MaBJfS`JgA"Mp""Q2"n Qdca" n"Mp""Q2J.g Ma` Ma c2 Ma M"UaJg Jg UJfNв @C Ia0S`L(N^NuNVH7*HH|z&U-l$l0rAp)H$-@-@-AJ, f ,gp`p@0ANSB,Xp f . n `VJf p n `Dpf|+p gzpNϰJfBpNJg6pNxJfJg SRRpNJg&p/NXO`Sp/NXOr2܁R KN:&@`Xp f// NPO܀ ,2RH".аc$. n ڂvCX`bSR`*$H&.c n ڃ|X`T*-A"Hlp-@pfJf)FTK`RK`Sp/N^XOr2܁RRK`*  n )FJ,Xgp` n )@0*)n$n0L(N^Nu/.a//aPO.NuH*o./Jf `|y  Ma&@N L(NuNVH0.-HJf `pdp@xbdB,j/an Aa 8XOPc AN` ld"nb $I R// / NYfO ߬d`&PEG " // /NY>O P߬T .L N^NuH*H.,Jg// aPO*@p" M`Sd L NuH*o./JgDN|ypcpJ,Afj)ĞdcHJ,Ng2pNJjp,LANr2p,KgHxHl/NPO`AN϶ ,d)@̆Ĵg ,̆ M"l̂`Sd&M*Jgp fS$SgpNͮJgN8ZJgNpALN$`jprlFfNv`XpN>JgNdpNX`>pN͚Jg2pNvrf 0,fp",ɠA°JgNS`L  MaL(NuNVH*H.Jg|pdp@xbdB,j/ a4XO ldd(-M&M " ,R//./ NWBO d`&PG K " ,/// -HNWO ߬PTL(N^NuNVH!4*HbbB,j ldb$&M "$ . ,PC M)Hd-I` "HPE "$ .&M߬d-H//./ NV ldBL,N^Nua lpN @C IanNu l`adNu/ *HN$h Ma*_NuNVH4*H-l$Ap)H$dc ,PRpeJ,xfbeJ,jg Ab-H`A!F-H-l$L(,$PJg( nJ(g"Pb $nc-HpyЀѮS`"n QdcaN nCpp""Q2Apa J, f ,gp`p@0N( lpNdaJfAN̜`&lp|zdp[@gDY@gY@g`// NFPO܀ ,2"RbR`*RpfJf)FTK`RK`+p gpN"JgTK`pNNJg6pNʒJg p/NdXOp_fp +g pNJfR`Rp/NXOr2܁TK`8Rp/NzXOr2܁RK`)n$J, f n(lgp`p@0 aH L,N^NuH*H.&I| SJgJfpgp f MSHHx/a PO`vpfpNvJg2pgp",LN3xJgUMHx/ aPOpALN4D`*pNJgpHl$HA$"KN XO*JgES`^Jgݬ$L(Nu/J,.f NJfr`r.JgNJfFJ,.f@NJf8N,.Ͳf,J,#g, lpN,.˲g,fJ,g,gN`Nd.NuJ,.fNtJgNfN`NuNVa-lpHn ,HrACa .N^Nu/ *Hpf p-N Jgp-NɶJgTM` *_Nua @aNuNV/.a-lpHn rACaL naXO .rg ",HҀ aF.N^NuNVan-lpHn ,HrACa .N^NuNVH~a,a6-lpHn ,HrACaXO .rgJf .`v .d6 ,He.NXJf& nNBJg nNV`Hp nN^-@`J, g J,ˬgJf lpa*Jg N ~`h .r naB`VLN^NuH!*H MN, @p gr g rf-f MN0*@` MNt @WDHH L Nu/.Jfp` )@H.Nu/ *H MN0R" // aPO*_NuNV/.ar/@  oa.N^NuH*H.prtFg prFҁf p Ma*@` MNb*@GpNJgpALN0`pNƘJgpNt L NuH.,Jf|0<WrAQ Nl)@XJfp`J lX)H` l˶J(?WDHH@ )l+\l)GNA$NGSg lXNp`adpLNuH*H&I. ,Xm",`l , K*L(NuH*H&IJ-g M"KaA "KaA"KaA"KaL(NuNVH/.*HPbp` zplf ",TЁJf$<`$<Ђ,gRJlg,,l` ,"c,ҬPbp` ND&@Jfpfp`R` ",T lXP$(Jolplfpg`P -A KNN-@ .N-@ nNJfp`Da g M"na . na0 N&@Jfp` g M"Ka  Ka pL(N^NuH*H.a/,T/ /,XNN Ap"MaAb"Maxa lXNO M)HXC)I\)I!F)I T ,T"HSI)Id)H`")APL NuH~|p$nj A**p gZ*-@JgNpgڭ< N&@ g8 "-Dl((,Hx/NP  Ka0Hx/N>O~` KNRR`JfL(NuNVHz~p$n A*-pJgp n@fjC INC na"n iDN nNz A*B|$oR A*Jg"A*C*!A*BS`&S` <XANIJg A*!zR`FJgNLN^NuH.,N,pc"S "N,P.R LNuH., d Ad LNuH. d Ad `&J:gK:Jg -d*U` - ` <XL NuNV/ *HJ-gHJ, f>-kg6A/H UN/ M"oarXOJg| MaJg MNB-*_N^Nu/ *H|*_NuNVH*H&I-K-H-H nN @C-I nbp )f-I`-IeJg .`.AN `~>- KN>+@Jf.<X+GL(N^NuH./ | ADcR` LNuNVHprAQ*l$L.,$PJgDJ-fAp"Mp""Q2`* ,6,Jk/aXO,R6h 6hdS`L N^NuH*o&l$L.,$PJgbB+S`L(NuH*l$L.,$PJg B-S`L Nu/ *H m8NB8B<*_NuJ$LfpryҁNH)@$Lgp)@$PNuH~p$n( A**p gA8 -N|NHNNNN NAN@zN-,N+PNGpaH./ / SJg pN9`LNu %.8s =%.*f%uK%-4u %-6lu%-7lu%s%lu%.2f"%.1fcm%g %.2f" %.1fcm %s%-5u%s %u %s %-15s %s %u %.15s (%uK) %s%u %s%u %s%uNo Style H./ Jf` N% N&,pf* ,̒)@J̒fN%`J,"WDHHr N% LNuBaXONuHxaXONuHxaXONuHxaXONuHxavXONuHxajXONuHxa^XONuHxaRXONuHx aFXONuHx a:XONuH/a*,,J, f J,gp`p,J,{gJ,̀g*,-JS`,,-JR ,,ЀrN%n(RJ,Rgo*`J,gY)Fop)@$`/Hxp"N7aPO R)@$LNuaaaxa|Nu/N$.,,J,{g J,̀g.,-JSHx adaaHxHxp"N6aaap.HxrAN6za BaO.Nu|Nu|NuBˆaNu/./)GD|ˊa.Nu|NuNVHp@@J,{gJ,̀gJ, fJ,ga.p"N$PNx*@x&Mzr g"rlgrLf(` KN~ @N&@R` ,H ,rc .",N#-@-l# .SJg2p[@gQ@g @Eg@ fSMB`pNJgR`pN#|.*,#RFf(,J Ь(R-@溮dpfpNJf⺬Ff|-p@ g4@gP@ gJ@gD@g@g@g`|C`,|R|`"SMJ.fg躄cp-` dp `pL,JfN",-ApN"a(`pNpRgR`LN"JgN#&L(N^NuNVH. $m~J,jf ,fN4AbC"p""Q2A"NJgataB,a:,,ˆ ,f)@ˆJg&"Sfbpa*,Pp l"a*@J,#gA""MNݜJgPgp//rN"p/ahr.a(XORJ, fpNJgpqЀNJg`J, fpN.JgJ.g .N ,".ұ-AggN'`N'.g,gN`N.g,gN'`N'.g,gNq`Nq.g,gNr`NrNB-@J.g .NjprGҁgp_fp fp-NqR`p@gS@gS@g4S@gP@ gZ``p Nq``0,gp `p,˞r Nq`@0,gp-`p,˝r Nq` Rp,ˡNq|`pNqt`pNqjp/N^XOr2܁R`&pNqJRp/NXOr2܁`SKJ.gLp MNJf@p[@gQ@g0`pN(JgpAN`prlFfR`SK`AC""""""NBJ.gLJ.f .NNxa`4Hx NJ.fN4J.gN L(N^Nua ,HS#",$NNu/./)G#aPa<.Nu/ ,H#b",ˌdt`$/aXO`$ ,(",#ҀR$,HcSԬˌS/aXO$NuH;~J,#gP ,.,g> lbN/AbCN&XOJg"AbC"p""Q2A"NʚJgSJ,ˊf2J,jg, ,f",te $ԇ&,$(Ub$ԇ)BD`J,#g ,t",ҀS$,Dc)AD` ,t"S$,Dc)AD",$$U&,Do J,RfU)ADB,ˊ",Dc`pNHJ,#gn ,tfЬ,,g> lbN/AbCN*XOJg"AbC"p""Q2A"NɞJgS Do NЎJf|)FDa)lD$LNu ,$jR)@DNuaa`Nu ,$Y)@DlBDNu l˶J(gp`pN l˶J(gp`pNjNu l˶J(gp`pN l˶J(gp`pN@NuJ,>ga`@J`f p l˶(A` p l˶(UNJ`f p l˶(B` p l˶(VNNuJ,>gaX`@J`f p l˶(C` p l˶(WNDJ`f p l˶(D` p l˶(XNNuJ,>ga4`@J`f p l˶(E` p l˶(YNJ`f p l˶(F` p l˶(ZNXNuJ,>ga`@J`f p l˶(I` p l˶(]NJ`f p l˶(J` p l˶(^N NuJ,>ga`@J`f p l˶(K` p l˶(_NZJ`f p l˶(L` p l˶(`NNuJ`f p l˶(M` p l˶(ar NfNuHJ,{g(J,̀f"Hl$lHlN0PO|J,̀WDHH@̀`|apNJfpNJfr`r.B,zp"Np'(fp N!$`ANa 0a pa J, g8p'(f AN`J,ˬggA`AN`A+N`tp'(g^J,˭fJ,#gRJ,$gA_`AdNJ,#gAi`AnNJ,˭gAs`A{NxJ,#gA쭃`A쭌Nd`aap N Zp'(gzapa J,g aN``J,XfJ,wf A쭕N`JJ,Wgp,W`J,-NgpgЀ`p:F@FJ,XgAC`AJN J,wgAQ`AXN pa p NJ, f J,!gA쭢`A쭨N afa"aap'(g$a aahpOrN N pOrN N B,JgN6JgHl$lHlNPOJ,̀WDHH@̀LNu|˚Nu/~,˚B,˚ .Nupd)@V|BJ,˚g l˶J(fa`paAN NuNVHp'(gaJ,˚gv l˶J(flJ,zg 2Ve\BVJ,BgR.,K.B,BN La,ACN Bpa .".N 6 N N D)ELN^Nup aVJ,"gA `AN Nupa:p'(fJ,$gA_`AdN j`$J, g AdN Z`J,$gAD`ATN DNuJ, f8pap'(fJ,#gAi`AnN `J,#gA0`A:N NuNVHANr.pa /HzHn)@tN r,AN Hx /aLN^Nup'(gpaZJ,%gA"`A)N NuJ,ga`&J,{g J,̀fa`aaaa$anNuJ, f J,!ga`aNuJ, f J,!ga `a0NuNVpa ,/Hz4Hn)@lNAN N^NuNVpa ,Hp n/HzHnNO `/HzHnNO ANN^Nu ,lgazNu ,pgaNu ,dtgaNuNVH7p a* ,tHdJ, fJ,!f/HlHzHnN O,`J+`gBp l+`(J@g S@gS@g,`VKX*<` KR*<l|=|.,`,Kpr AQJLfA쭷`A/HnNPO*@ JLf|˄`P~prEҁgNm2N.NײNN$N.6.04/ *oA"Mp ""Q"*_Nu : H*o&mH -"-@Ҁ.",, ,^DHHALg ` +@ S+@+@DJ-Lg m,0f B+`|xL(Nu/ *HN MN`N*_NuNVH*n&mH ,(Э.,-R*-TJ,fp`:N؆+@$N~/- / "-N(POJ-Mf N+@(`J-Nf m(N+@(J(f Np`NNxB/- / "-N.//a ./-/+ a +R"N ka"-k* +R"NOJg nNj m8-HgN\J-Lg +b-kz-@l ,(Ѯ//-/.a8O J+`g .R"N kra .Jj ,(Ѯ//-/.a O J+xg .R"NT kahJ/0/"//0///,0N"N *NppapNuPROTH*H&Ip Ma/ / ap.p Ma PO L(NuNVH*H-@ g@G0JSg8~>|<z: r2  Ma:-@gxl  nafۮR`L(N^NuNVH*n&n M"KaSgp`-mJgp n0(/HnaPp n0(.Hna/p0 @L NuH*o >/p0H@Hp0H@H@p0@ @L Nu/ *opr-Ё*_Nu/ *opH@B@r-HABAЁr-Ёr-Ё*_Nu/ *H Ma Ma*_Nu/ *H+H+H(+H +H$ Map*_Nu/ *HBUApCQp;@;@;| ;@ p;@;@;|p+@+@p*_Nu/ p,Nx*@ g MaJf MN *_Nu/ *HJg Uaj UNB*_NuH*H&I/ / a.p KaPO L(NuNVH'*n&n Ka Hn/ NPOJgp`p M"Ka-@Sg Ka .`,+*+~>+lprA"MNCJJgHnaZXOr2HpelHna@r2$.Q=@ " KaXO-@JfNq$`VHna n1@Hna n1@ .Qr"MNBPOJg"ޮ`b '@r MN,Jf'Ep` Hn/ NpL(N^Nu/ *Hp0-r*_NuH*H.pfF*MRM`pf FL Nu/ *HApaApaA paA paApaApaApaApaApa*_NuH*H&I. MNp,pgtJg p" MNNpr K"MNAJgB KavJSf8ApCTVf$ +nJfp0+r MNJfp` r MNJgp`pL(NuNV/ *Hp MCa\*_N^Nu/ *H MaJgp`p MavJfp`p*_NuH*Hp MaZJf2J,:g,A:"HJfS Rr MAa&@ g A:"KfL(NuNVH*H&I.p0 Ka-@Jg4p0r l,2,Q" Ma-@fp`  n"n`SdpL(N^NuH*HJ$g~pn Ѐ m$JPgp`R`pL NuH*Hz ~GJgZ SphgPp0(X KNJg:~, Sp hfC +I( SphfC +I SphfC +I$&S`JgSf L(NuHzd~|p$n" A**p gAa^Jg~R`JgSfL NuNN84N|N8zNBpaH*H&I~p0-l* /5 / NPO,Jf `Jj- fR`pL(NuH*Hp0- MG~p0-dRK + KJfS RR` B L(NuH.,/(p؀ rNj*@ g : ;@ ;@E L NuNVH74*H&I-UJfp`B n( g KCNo KJfS .\p n0(|-@伮lj n( g.B  p CNot .".زf `Jd.`0 /0 / NPO*Jf `& n( gJkR`p n0r2($H&.䶆f-B`$"p( SI$ -Bt4dNt4"t4(҂t4ԁ-A N-@Jfp`*p n0".Ё0p0(Ё1@ ."."nESJ"H".ܒ// /-H-JN n| C Kf n"HXI ../ /NOp n0(1@Rha L,N^NuH*H.|p0-l  u SHR`L NuH*H&I. M"Ka,pg  u SHL(NuN NN NJ`g a `a `,5g ,Jfa.Nuwcwfwmin% %u%c%c%u%c%c __________ *p+%uX&a+%uH%c%c%u%c%cacegijmnopqrsuvwxyz%g_ *r1Acc=%08lx,sty=%d,pt=%s,fn=%dHJgNpa!*@J`f)M`` ld )Md lN;.  la!0+@ l"H)//a!bPO`| L NuNV-l`Jg$ nXHa l`)P`J`fBdAa N^NuJ,EgJ,Fg J,fJg"a a:a%a@rpEЀgaz`Nu/.p ljN:RfN:.NuHJ,gZ , oa6`*l lN:& @C)I " . Ьʰea!: l "M`Sd߬`v,,*,R@J,:gJ,Ef Jfa\`aJgH , f@ ,ʐ( l"leA`Jf~>,Jf.<X L NuNVH?4*H. ,2.f `&M KN5B*,gAN5 Ka:)@",j-@-A,g Nx.rdNx` ,jrNx-@HJg,g".-@-A",z$ԁ&,ԃ(,fb:t,xE؄gr,gj҃ҀҮfc\ KN4lr @(pEЀfFp@@,c,, R@d ,zc)@)lz)l &`p"a J&fTJ,!f0|!ANrAN4,5g HxN3XOAC$I$$$$$$J,fA"HE$$$$$$J,fA"HE$$$$$$J,$kfAC$T""""""|-K nr g*[fp(N2bJg nh nN2"-@`p.r`ҁgPJ,$kfr,Qt "A$TN3J,fp,Qr.AN3|J,fp,Qr.AN3bJgJ,g,g `0a~Jf Ma*JPfJTg KN30,5g|`J,f J,Dgp`p, Ka-@AN2Jg.,rcJ\f lRN1 lRal)@\J&fj ,*",Nuz",bdp)@*J*f ,.)@* ,*",NuRr,/@$ ,bNu@"/$p,S/@$ -A"/$Ne)@& ,bЬ&r,Nu -@Jlgr2, <Ne`".Nt-@,f ,n` ,r",$Nt".Ҁ)A$ ,zЬЬ)@(".$䊒Ӭ( K"na*".Ӭ(-K-@JfRdLpffjAHxHzl/Nr~O JgNAHxHzV/NrdO Jg4AHxHz@/NrJO JgAHxHz*/Nr0O Jf|JfDp[@gQ@g @rf&RM`|paNpN.Jg pa8pa.`L NuNVH4J`g> l`*haJ,0gf MaHlHN-6XO`,gA:-M-H"n QJg-H` nN.X. Um n*(,܅ a\-@Jg "n i$n`Sd n "n`Sd n!FC Ia n!nX R` p Ma"*@J,dg ,fN,L,N^NuNVHAHN.pd)@&BzRB,J(g ,~aJf| ,~cN, ,~drAf,grA`,grAr)A$)A()A)| B, J,fJ,Dg,5f,5g*,5f" lCۏ"J1g,f ,g,5f,g,5gr/HlMHnNo8O J,g.|B,NaBHlpAC쑎NX8~>N+NPO`HnN,N~4.N,LXO fN,zp gp@J,gzp l|plJf.,g&,f A< p` Ad p*H`6pf.,g&,f A p` A p*H` g0 MN* l"Ma@pr la lN*//,aPOR`XR`HJ,"gB,"N+$,gpa,gp`pa,gp`pa,f ,n` ,r",$Nm)@$)l(,gv,fA`A&H-lphN)xp lF .Jo>,f A< p` Ad p-Hfpfp"Ka(R` .Ѭ(,gpa.L(N^NuNVH*H&I.-Ml|  fA,-H nN*\ l"naJgAR"Ka$z`z fp l"HN)` pr la*lJfnr gbr%fP-fRMHx/ aPO`/,~HzHnNll-@S./ aO .A"M`Sd`rfRMRM`*l Mad-@A N)6 laP,,gA N) "Ӭ( lN(-@ l"@a!"Ӭ(*n-@AC """"""Jg AR"Ka T//,an L(N^NuNVH#*H&I MN(. ,"R"rzҁ/t////HzHnNkV, Їa -@ A"n`Sd n "M`SdpnN'p n"KaAaL(N^NuNVH'.-@B.J&g,,z.,p)@&)@zJ,fJ,Dg,5g\ SJgHJ:g l:C""""""2R"A:a A>a AC:""""""2`AHN(8`,f ,n` ,r",$Nj)@$",Ҭ$,f҂)A(*,fA`A*HJg$( ,$",(aZ&@p 7@r2 AJPfJTg nN'p n"MaP-@ nN&X @C-Ip)g >Bd .".ȲcȚ`A:a *A>a "AC:""""""2`>AX"Mah`0,gJgpfN%L <Ьr-A-@ .r l6,f A p` .A p-HgXR` .Jjr-A .Ѭ(p-@ .r lX,f A p` ."A p-Hfpf&p"MaѮ-@ .d R`a@Ja:Jg,ghp2Jg^ 6cTpa pN%-@g* @Jg$/,6HzHnNgAapa O ` ,6@pAap)@6ap ap@p)@,J.f)@$ <Ь)@(",$Aaal,5g& lCۏ J1g,f,f|",5g@J,g:-lNX-@N$Z .SJg pxЀN$(`p NXv)nAHN$L(N^Nup"2f ,gp`pNuNV-@N^NuH. *@p,QrAN$p2g Map0,a*,)F a`AN#^L NuNVH/.p2gja@prpҁr/N"XO-@g"@ i`rtpԂt N" @&H gp",AN"Jf0|Jg "n i`prpҁr N"^ @&H`B.pN#P*@p,QrAN#, \DHH* rF(JgFgBprpҁr/N"XO-@g"@ i`prpҁr N! @&H|Jf(pr Fg przҁf:Jʶg4 lʶJ(g* MaJ.f Kap0,a J.g" Ka ` Ka `p,QrAN"pr Ff,gN `$N `przҁf,gN!`N!L(N^NuH*Hp[@gY@g2@g@Xg`&-p@ g@g_@g@g&@"gH@/gBU@g S@g0S@g"S@g@ gB`J|aL`p a`p-a`p a`p -fp-a|aL`pa`pN pN2Jgp-r-a `pa`J,fa:/,,/ NPO,,gT MNp&@ KNJg ,,І// NPO܀*K`p,/NrXOx8fx "Nb* "Nbx,`z۬, ,.rc ",.NbZ* a SJgrp,ar`p-*rp-fp-rڀTM` a ,.rc"Nb*۬,`$-r g r grf|aLpa L(Nu/.p'f2J,0f,,g$Jʶg lʶ(Uf,Lr cr(f~`GLp@ g,U@g(S@fB,`J,fap/NBXOr2Ӭ,p"2g@pf,5gpNT`pazp eX,5gP ,ɤJgDp aZ`fB-Hp(f| HnNXO*@ g-fpr laD`ppr la6p,rEҁg lr>gJpbN,f<,fJ,gBHlNPO` ,gB/,Np lƓNTPOL N^NuH*H g&~pFfp-rЁ.TM  Ma L NuNVH.,p"2g",5gpNHpNHpa`"prN-@g @a~`p@m @l@0;N $,4@0<8(DHLPTz `8z`4z`0z`,z`(z `$z` z`z`z`z`z` z`2z`.z`*p/HzLNUPOJfpNr-@pNh-@` -H-H N*@ RN&@ g na Ma napa g na Ka na`paL(N^NuNVH.-l(|ACNJgZ nNE-@ @r-fRACNJf-|` .-@e .bp`( .c,` cBp` nN-@`|LN^NuNVH.,p.a" @0"1AHJTf )@T)@X`tp lX0(d)lTX lX&h gp0+e)KX`p lX0(f$*H&m g p0e*K` n+H!K` lX!n n!K .L(N^NuNV/.-lTJgfp n0(dX n-hJg$ n a n"n!iAa` n-hC IaAa-n`)nTJTfA\an)lTX.N^NupabNuNVH/*H&m x0- @b r2)A `r2$, cr2p2-AJgbJʞg\pNFJgR ."<,NS Jg@p0,/@ <"/NC/@ ."/NRJgp ax .a.`xp axpKЀѮ Xdp"2Jg-|X Xep aX aX` ,ep2g pN~ @a^, gp0-@p-,fp0- Kad`p-,fr KCN`)@nJf N` .ra p"<A"lnN-@o Aa`" lnN}Bnp0- Ѭ pra l`Da`p-,f& .ra P/ NDp0- Ѭ pra 8`p g .",NQr¬2-@JgD ,rg,rg&rfr.gJʶg lʶ(tb[fzJfp ad`z .,d Jfp aL)lAN VHx N XO|<J,fp)@,Jg ,,І".Rbp a ` .,.Ro$ ,.rc"$ԁ ",.NP. afp)@,Ap"KIa .Ѭ,L(N^NuH.*lT gNaLARC\a g(p0-d Ma&M&k g Ka`*m`ARC\aJ aL(NupaNu/,rc.,`.,z ,Ьހ at.NuNVH/*H&I-@zAN J, f KN p0+ a ,ɰ",€,"€.gTJ+gp+3pa`,JgrA0paAkp,C`Sd`N0,2+ Af0,4+@f ,+g*9A9A KC"""""" KN Xp0,a ",ڱ¬ɨ( ,ɸF"€ a/ N tXOJg Ma @N |*@`,+gApN @a ɸa|p g Maj @N ^*@` ,ɸa L(N^NuH. ,*|Jg:pn4 "A̘°g rpҁЁr a A̘"0R`LNuH.|Jg:pn4 "A̘°g rpҁЁr az A̘"0R`LNuAC0""""""NupAC0aNuNVH.p0,/@ <"/N>, "NM.JgnpNy*@ gV Ma`pNy|*@ gJg a MaD`2zp0,rN=( eR` aJg p aTSf "NM(Ѭ L N^NuNVH?.| p ap Ny*@p2gJʞg gJf" lʶ(Ugp(r(ҀJgp|xJfp lʶ(r(Ё.Jf.< lʶJ(g,pH@Jg p("N r2ЁrdN<. NLl.Jʢf|Jgx lʶ(Uflp(r(Ҁp(t(Ԁ NL("Ҁ-@ "NL*p2ЮrdNKr2,-@ NK".$ЂNK.x-@Gpf( N..N^NuH*H. ,$",(a&&@|,  Ma'@ 7@L(NuH*H.Jg^pg2SgSg,Ug6rg0r g@`>pNJfa`Sf`$pN;Sf` r M"lNvSgNL NuNVH74*H&Iz-Ml|  ,$",(al @C-@A""""""B.|~dfr@[AgYAgAgA_g(`SMSM r-@-A-A MNJg Ю// N Ѯ MNjPO*@`ޮp,/NXOr2Hpc>,g6 .NI .-A".NIt-@ ,.rc .",.NIZ-@ " n-h -@JgroҮ rpNI.Ѐ`p".ҀҮҮT1Ap0ap n!@ -@ . n"n`Sd .ѮJg& .rpd" n$vԃ“-H`p,". n`Sd .Ѯ . M"n`Sd*n .Ѯ n |  n-h &n nNH:`2@r gRr NJfJ.fpn@,gUM`hp.rlFfRJ,0f|d`r NJgp./NFXOp.r Fgr NsJgT,g"p2gBJfHx_N6XOz:AC""""""`p.NVJg@`p./NPXOr2ށ`J.f|n,gSM`>p./NXOr2ށ`pr",.-@NEހ`Jf( nJ f6 -@T na n!@ "."@$I| "h  n L,N^NuH., ,UgWgSf:p ax ",NE<",.NE4aJf> ,rg[f0pAza6`$plaD "<hNERr a:p a LNuNV/ *op-r2- /@ N4/-/// /Hz N5*nN^Nu|DBap)@$)@()@)| B, )@z)@&J`gaX`Nu,Lr e p ap aNuNjNN$NNRN"N Nm(N?NNNlNN-hN7N!N.\NN6lN>N7nNHNN N8NxN4N N$\N N-$NKNmNNNi$N"NNN~NGpaNVH.N3N2|N3(YN34]JjV*V V//-@ "N3N3~PO)@VJf a/pN2nN2JfN2LN^Nu%luF[%s] L[%d]%.*sldialog.c%ld %s PS%gNVH?*H&I|B. m|B-HN1N2P-@J,fN2|N2@a)N3 --m-@JjVriЁg0SgSgU ,( R+@`4B`. ,( +@` ,H#"- d ,(+@`B -JjzrgЁg Sg(Sg` ,,W+@`Z ,,R+@`HB ,$"-lJjR-@ ,ѮJg ."-Ҁ,cS`+na.&Jg -"-ҀS,cS` -"- ҀS$-&-ւS//"N1 KN1-@ Ma/N1|HnHnACN1LO m-H nJgxpSmX lN@0;N@*@ nJ,g( h,"n`pxЀ nJgPrg,rg rg ` nJ,g h,"n (` nJ,g h,"n )(0` nJ,g h,"n )(` nJ$g-h$-HN0-@ n(gpJ,gj"h,`` nJ$gV (("($ԀW&( nl!C( ("U$($o"((ҀUoT!B((g p""MIa na p0ѮR`|J.f~0-J@k"0 m0-r2 "< "MIa :J,gp.< @@`DJ.g> nJg(fp0Ѯ` n(gJ(g~>(p0Ѯ`B.JfZJg8N/ȰlN/.pg NiJ.B`,B~ n>(`J,gN/:.`N.. Ni. r g6Ygg*rFgrg0rg*`|`|`B| D-@`ZN- ,* , m|-@-H nJg (m,"($Ԁl $(&.춂m((؂l xȨ]fVg"($ԀSf"($.촁m &((؁m""($.촁g ҨSf$m Шlp]fpr f(|`p n_fJ,flpf~ B, n-H f"m0-I-I`(f ( Jo ܀r0N2Ѯp0ѮR nJf m|-H0"nf-n n(ff n"nf(g` Jf. +(ЄS$l0 +(ЄS'@ p-@ f r -A`r-A`Jk +So < -@`xp-@`p$+(.$.Ho$+Slt-B`F$< -B`:Ҁf* .Ы".mЫnB` < -@` < -@+g( f <-@ f <-@ .gUggSgxrg>SgWgDSg$WgzSgFSgSgT`R p-@`R(p-@`S p-@`S(p-@` +(ЫU'@(p-@` +$T'@(p-@`n +(T'@(p-@`VB(p-@`H+g .rFbrAq0JfAq0gN"+ R-@ "+$N\-k,-A .䰫 gR| Bp .f . n pRP`p.N6g .R"+$N-A` ."+ g'@ p-@`z <fJgd .r gX gNBNS m-@-H nJg8Jf2p0(NS|fp nr gp`pr0Ӯ-@`Jg*.D`+g .r9n&r0o r1$l'@ p-@p -@`rFbr N -"-Npfp `J-f-gpWЀ`p fnpfp `p(r N JJ,{f Jلfa Hpfp ` J-gp*`p r N J,{f Jلfa &pfp `p)r N `lpfp `p[r N J,{f Jلfapfp ` J-gpX`p r N J,{f Jلfapfp `p]r N p N Jfp+@ UJfS X+@Jgpfp0- Ua`p0- Ua`pxЀJgp N Jg/./. .".N zPOaL N^NuNVH/*HJPfN 6N | MJfS".T",($*S-@JjRz.SJjR ,,"(Slx,SJjR ЅR"҄R// "N N PO)@Pg a N "n a(L,N^NuNVH4*H&I MJfS. n (Ы"n Щ,To ` (T *T ,(c(R.Y$KCЌp""Q nCмp""Q n Cp""Q)M\ U)@j)DXp)@КЬТЅ)@ W)@AL"naVL,N^Nu/ *HB"B MCaXO*_NuNV/ K / A"nN&B"BACa*nN^NuB"/,ZACaxXONu/ *H)| "B MCa\XO*_NuH*H. "< MaPL NuH*H. r Ma8L NuNVH..K/ A"n N AaL N^NuNVH#*H.,J,fJgG.A^p,K-Hf <'@r!A'F$t!B$`p'@!|!F$B$ g MCfHlHnN?hPO gA` MB/.p"Ka` g MNAN NzL(N^NuH*o./NT*pf/,ZHlp MCa4PO,`B"/,Z MCaXO,JgN L NuNVpJr AQB.A)HBHlpACaN^NuJZg lZN)HZBNu/ *oJ,g Ma` MND*_NuA)HNuBNuN)@0NNuNd ,0NNuN)@0N @r-@Aq0gLp,r0 nRHN= @r-@Aq0g r NrЁ,r0`&*p`pL(N^NuNV/ *I-HA"Ma*_N^NuNVH*H&I U-H~dBN-@p nAq0gACa"~p n-H@,gU@g@}gS@gS`f~`b~2`^ nN=-@p nAq0g>rp0p N`. nRHN<-@r @Cq1gpr0ހRpdfp`& . e"<` rdNЇ"&*pL(N^NuH*HpNJg@ UJfS "- .Ulp` JjR. rN`a/Hz\NdPONL NuH1. fA@ `H N$<@YvN//Hz&Hyj@NHx.Hyj@NO*@ g-@Aj@ L NuN`NNNN.NNNNNNN"NNINfNeTNN`NeNNNNNNN,NN|NN~NN~FN N|NNrN\NƸN#vNNvN$NK8NNKN6NNNNNNNNzNN*NfNNNNN6NNrNu)%*sPSstyle %c "%s" "%s" %s %s %s %s NVH*H&np+@ +@(+@$+I,-Ig>.  nJf+G$`(A"n"qa / HnN POJf+G R`L(N^NuH*H.Jg Nv M"@NL NuH.Jg&#) 9)9@1 NH*@ MC|IN` p0,1N.*@J|g l| `/ C)nIaXOL NuH.Jg&#* 9*9@1 N*@ MCрINl` p0,1N*@Jрg lр `/ C*.IaXOL Nu/ *H fKpA0"Ma Jфg lф `Hl0C(IavA0apapaRXO*_NuNVHp@@@JʞgHl$Hl$HN.POJgHl$NXOJgN &@N J KN &@Hx:/9,N PO*@ g*AJʞgC:`C0/ /N7Hz/N7OJфfBp@Ѐr`NXO)@фJg|  l*h g MJfSpx-Hdpznh r N l"lʞp0(p)-H-If8p)f0HlpHxHzHnN O . MC`SdK`R`Aф"MNR`Vp#)9@1#*9@1p@ь, JfpA` prr@Ё@ъp//apN A,ΓNPO. gJ,ьga pVfBNXOL(N^NuNVH*n&n y) 9(-H paA얨 L(N^NuNVH*n&n 9) l| h CN .a .raJgA얨 `AѲ L(N^NuNVp0,1raJgA얨 `AѦ N^NuNVp0,1raJgA얨 `A N^NuNVH*n&n 9*N lр"h HzN/ -IN 2POJf -|`B nCN .a6 .ra2JgA얨 `AѺ L(N^NuNVH*n&n J,ьga,ъprAq0Jf,ьprAq0Jf~ApN4V@ъ@ьB,1p"H l$H-HJhg A1-|-Hpn, A̘*0 r`Ё. n g n-HR` nB l$-@a z .-@JgJg .gB`-nR`(Jgpf .a` .ajz L(N^NuNV,ъ"RAъpZc|Aъp//aA얨 N^NuNV,ъ"SAъpAd|Zъp//a\A얨 N^NuNVH*n&n -k Jfpr KN--@Jg @B| nJg:~p n0xgR`THx/ /.N$O -@f,` Jj߮` . (zJ5Xg p 5XgR`TJg/p" KN-XO/p" KN-XO-@Jg  M"n`Sd/,$p0-&H|plJ3hgp"3hgA1HhhR`A1HB0hA1H `pL(N^NuNVH4.*Hz  l$H&HA|-Hpb$ "A̘°g r`Ё n-HR` nBJkgJkfp` l$AC$N N%ACNr*@ g ,0Sr l0"MNg MN%NL N^NuNVH4*nJ0f pNr)@0Jfp` l0Bp)@0A7"Ma,z&l0Jg4xp 3HgR`THxHn7/ NO .Jf*`Jj` 0"HHo ,0Ё l0N-@.Jg)@0 .Ѭ0 l0-H.Jg "H$IJfS R/// NO n."HJfS. R// /..NxO A7"n.`Sd .Jj ,0 l0N*)@0|1L,N^NuNVH*n &n0fp`p, g n-Hp gprAq0JgpN$$*r@p"-@-@ nr fR` nr"fC " -@pACN nr fR` nr"fC " -@pACNtJgACNJgL-nACNJg-n`. nN-@HxHz/NO Jf T-|B nr fR`p nrAq0Jg*r N#A˘"0R nr g`px-@ACNJfpx-@ .7@ .7@ .7@ .7@ .7@ &FL(N^NuNV$H*n.. ,..JfNPN MCNpOACN.JnpOACN.JoHxHxBHnaPO.N^NuNVH*n&n gf0<r MQ f&l0 gL-K nJg@HxHz/NO Jf n\H/ / /aO p ngR`T`L(N^Nu/ *oJ$fpr6 MN P+@$ -$*_NuH*o &oJ fJJ0fp)@0p",0 MN +@ Jg* @BJ0g ,0 l0"m `Sd/- / aPO - L(Nu/ *o/ anXOJfp`" MNxA$f l$H` l// afPO*_NuH*o &oJf$prN*JfN.`" g /+ /aPO L(NuNVH*np MNj&@ g/ Hl$Ha.a`PO~pnA|-Hpn& "+ A̘°g r`Ё n-HR` nB r@ЁAC!r2+/@/H/I N$/// // // HzHn4N*A4p0+/H,NHn/Hz|//8NڀA4p0+@/H/ /-HNnPO @  -HJgf-H nJg p gR` nr fRp nfRp lN&@ ."$ ./p lNBXO-@L(N^Nu%s %sonoffBLWORJIPHY %uHYTL %cLS %gHEEHOHFOEFOF%s%d %sHEFOOHOFEHEFHE oFO o<->STYLE_NAME_BUFFER<->Protext.SetError : Cannot Open Document Settings File.Current Document Settings Saved. Press a key ...Error saving Document Settings. Press a key ...%u%c 5 10 15 20-!L!L-NVH*H.,JgA`A// HzHnN rAa(L N^NuNVH!*H.p lNL&@Jfp`-K nJgC// / NO JfZ-n nJg p gR` nr fRp nfR ."$ ./p lNp`: nJg p gR` nr fRp nfXR`PpL(N^Nu/ KT, gp`p@1z@, gp`p@1{@N, gp`p@1|@~, gp`p@1}@, gp`p@1~@ ,!9@1r2+AHl 1 , v9@1r2+A*_NuNVH0p,1zrAa$p,1{rAap,1|rAap,1}rAa0,1 @c2<9A1p0,1/HzHnNprAa p,1~rAap,1.HzHnN\prAap0,1Nc$<@YvNc./Hz`HnN*prAaL N^NuH/KSGS @1xSJ,1g A *6&` A*6$L(Nu/ l0NB0~p l ЀЇr0NlBAKB,R` l(NB( l,NB,.NuH$J0f

nf@R.pl4 Ѐ n n0f n( n0f p6x&`R`*Jfp`pL,N^NuNVHnHnHnaO Jg/././.aFO N^NuNVhHp lN*@ gZJgV&MJg p gRM` " .pEЀd"  KCm`SdAm"HB/arXOr fRMp fRM`L(N^NuNV8H*H.&I,/ // HzhHn8NOJfo pA8a` prA8aL(N^NuH|Jg" rtFNhn l(Jf l,JfS`~p d*R rtFNh> l(*H l,&H K"Mf"JffJ,1gA`A ""Ka6`4J,1gA`A ""KaJ,1gA`A ""MaR`vJ,1gA`ApaJ,1gAb`A`p,1xraFL(Nu/./ rtFNg l0r$f"l,` rtFNg`"l(f.Nu/~p l /aXOR`.NuH|~Jg.p l( rtFNg l("l,fJfg|R`JgA엜`A엨#QLNu/~p l" rtFNf l(Jf& l,JfR`A4"l(fA4"l,f.Nu// G1a|JgJgAz`A엇#TvJgA엸`A#RJgA`A#S&,1JfA`A#SB,jaB,1yaBaaATvN l0NB0aa.NuH*o&o. ,S|1y rtFNe l0///,$aaHxaOA L(NuH*o &op)@$aDA L(NuH*o &op)@$a"A L(NuNVH*n.<#% G// aA L N^NuNVH*H.,x MNXJfpN\N @N&@N MCN[-@Jf NBp`p[@gQ@g|`\JgprFҁgpfpNJfpN.Jg `pfp@gS@g`z `z-` p nNp nN n(g|x`Hp@g<@pg@g `pf`p nNtp nNhN:Jg&lp`0 nN\JgxNX L(N^Nu/~pd$pA80x0A>J(g `R`p.NuaYfAA`AANuH./ |plpA80h0A>B(R`pA80x0A>|aLNu// G1JWDHHErWDHHEv.Nu/~J+`gg l+`J(gp`p.pf~p/aXO.NuJ9Egp`p@1Nu/./,1Sf rdNb"<Nb` rdNb"<Nb.Nu/./,1Sf "<Nbvr2ЁrdNb`` "<Nb^r2ЁrdNbH.Nu// G2zHJWDHHI.NuHa*. A2 <0A2 C2 1A2 1LNuNVH4a.KҎG A2 C2j-H-Id\ r0NaA>"H$i,"nTp/H n0/-H/I /JaXO o0r2 o!A( o0XM` A2 20p/a L,N^NuNVH~pl* A2 *HA>&HA-Hd:`R`Ba|7L(N^NuNVH*n . a, A2 Ѐ&HA2ZC2j-Ip0/-Ha,6apL(N^NuNVH'4*n&n m. ,rF́*ʁ r0N`z"pE r0N`j-p,p-H n-I-JN n nrtAq0@Jgr N-@Jf n$A -H nd"nJg -H-I` nd  -H` nBL,N^NuNVH*n.<'0 G// a A L N^NuH*o &oaFa|$2{/ / aPOA L(NuNVataAҮ N^NuNV/aZ.pfp`( A2 pC2JQHxaa.A ..N^NuNV/9HJ,2zgJg p`(Jfp` arA2 1aaA .N^NuNV,1Jf J9Egp`Z,1Sf J9Evgp`Fp0,1t/a 9@1tp0,1r.a9@1ra. a9@1r. a9@1talAҮ N^Nu/ *oAFN @"Mf*_NuNVHHnaANgXOJg`N0ACNU*@ fN\HzN`< M"lN`SWDHH.p lN2/aHl T/,N MNNL N^NuNVataA N^NuNVHHna4pA6aJfpA*arJfpAadJfpAaVJf SA4"HCC3RBprA5aBK4pdЀbA1-H r- M`SdRxB5xACN(Jg@ .d8p nN*p@!g @ g@fR`z! n `>A raJkg40+r-Ag*r$Ag$Hl$Hl$HNPOJgHl$NXOJfBkNL(N^NuNVH'a:Hxa|$2{AC1""2BpOA2 CQN,XO)@fN`p lC$N,Jgp lC$NJf ANn`pA$N,&@p A$N *@ g / anXO`anaxaAKN.|fHxaXOl1x1w`־fBaXOl1x1v`f AW4NF* ga`| fta g8 g4p lN| K"@f Jffp lNbr! M"@Vg4p,KAN,r2 N .p,Kgp f~ `.< fpOAC2 QJfp f|J, fvap A$"lNpA$"lNp A$N*@ gFp0-rAq0Jf(p0-rAq0Jfp0-rAq0Jg Hl$NXOANpNA TC$NNL(N^NuN&N"NNNJNJNNVN(NN:N6N%N9NrNNgHNNTNN/ NzN!N:NMdNN(NNN NXN"NBxpa/ *o/ aNCLXOp*_NuNeither Screen nor Image color map existsGIF87aNVH' BB/9ja^XO)@8gJ,Lg/aXO-@`NK l8. ^rNT"(-@-A-A NK l@!@ g .-@NKv)@0Jf` .r l0`Sd -@NKN l0 gB .̰l"l0 Q"l8 )R`p-@ .̰lD l0/H .NJ o g^ . l0 .$l0"R$P`SdR`)n4Hn/,8aPOJf .UgSg|Sg`/,8a $XOJf l8,(*(-h-h J$gp-@-@ .rl"AҰ-A ".Ё$.ȴlT .R//NJ . l0"P./ /,8avOJfNKJfd .A "0Ӯ`R`zB .".̲lH//NJ R l0"P./ /,8aOJfNKFJg p-@`R` l8J0gp"$(( l@!A`pJ,gp"( l@!@`XA$NNNp/-@N>lXO`^HnHn/,8aO JfJgHn/,8a POJgp-@`&NJJfZpf/,0/,8a PO-@/./,0a >B0 l@. NNN l@B .8a HB8 .`HxN=XO-@`LN^NuNVH*np8NHj&@ fHxN=p` <a8NHL-@JfHxN=zXO`'n4'H0'H, M"n#H4BprA"i4N ]g Hx N=prA"k4N \Wg Hx N;`" ЀІ m,nnR`pL(N^NuNVH*n&n prA"MN Ug Hx N;`p.r.Ё&pL(N^NuNVH4*n&n -m4 n(g HxN;8`\p"A$n"j4N Sg Hx N;`:p.@!g@ g@g`p&`p&`p&` BHxN:`pL,N^NuNVH*n&n ..|-m4 n(g HxN:`dJf.- n0 (0rd HxN:|`@// / aBO ,Jf* nJ0fHn/ a6PO,Jg ` Jfp` L(N^NuNVH'4*n&n ..|z-m4 n ($C!8E7-IC8-h -h-h-@-I-JJg$Jgl ERS "n".`ܺlvHn/.a"PO,Jg `n .f4 Sf nJ0gHxN9TXO fp`:p`4R`f\B . l n!R` n ( R!@"(R!Ap"$(!A"<!A-A`B .".l ER$(` n f^"n")U$.f@$."nR////A(-B/I,aO n"/  n"/`HxN8p`F-nB .R n8 .䰮o. n& nR"n"$n n-p` l o HxN7` nR ."n"Jgl ERS "n".` . gp n"($U n!("n")U$.f"/.///A(aO n"/`& )U/.///@(aO n"/-n` n!n!n$pL,N^NuNVH4*n&n -m4p"A$n"j4NjSg Hx N6`Z.rc> n8&. SRHp.r$n"j4AN(r.gHx N6`B nA8p!@0pL,N^NuNVH1*n&n AlPCp""Q" -(l6A8Hn//-4aO .Jg `fp."-(㠁,P(` -"$-,&6Ƃ& -,"-+@, -(R -"-o"-t l Ѐ+@RpL(N^NuH*o./,/zo R n .5` L NuNVH4*n&n -m4 n(g HxN5f`4p"A$n"j4NSg Hx N5D`p.&/./ a L,N^NuNVH4*n&n -m4p"A$n"j4NrSg Hx N4`L.rc> n8&. SRHp.r$n"j4AN0r.g Hx N4`BpL,N^NuH*o fp`N&m4+g HxN4tXO`6J0g /-0NDXOJ,g /-,NDXO g/ NDXO/ NDXOpL(NuNVH*n&n JfPp" K"MNSg Hx N4`NApr"MANjrg Hx N3`* np@S`+R+r nSpL(N^NuNVH3*n&m4+g HxN3`&A//+4aPOJfprA"k4N"Wg Hx N2`8 ЀІ m0nnR` -"- NF4'@0/ apL(N^NuNVH4*n-m4p"A$n"j4N|. nB(8!Fp"!AR!A R!A"R!A!@p!@$!|!@(!@,G!8. l 'R`pL,N^NuH*o./ g(|l /5NBXO BR`/ NAXOL NuNVH *n-m4 l8 l8!mp l8!@ l8!@ B l8B(J0g"$-( l@!A`J,g"- l@!@p l@ L N^NuNVH*n&m,HxN?XOJfp`L f&m0 f p l@ `6-l40 l40"ndkk\VK`HxNCpL(N^NuNVH*n&n |zxp-@/ -@a.a^XO,Jf|N2: l8. l@-h N$JfHxN08XO,`R ." s"n`SdRN%,Jf N<|Jg|` . l8eN%,N**N%( l@/($N@4 l@B$ l<.N@ XO lX@ MN>N@ MN>D@ MN>:@.N7v7@ MN>&@ MN>@.N7X7@.N7NXO7@ p0+^rN='@"pL(NuNVH*o&o +rNx'@ o "<'A /+ N8XOJfp`V~ lL ЀЇ/@ MN="/  ЀЇ/@ MN=v"/  ЀЇ/@ MN=^"/  R`pL(N^NuNVH*n~ l0 rN=2 l40&H ЀЇ MC iiR`/- N<@pL(N^NuH*o &oJ8f HxN)XO` / / a POL(NuH4*o&o~p+"+"N<,pcHxN(XO`B< N3'@@f HxN(XO`bp0+//+Hn/ aVPO,`.Hn/ aVPO,`Hn/ aPO,`Hn/ aPO, .r MN/./ a(POހJfe` L(N^NuNVH*n&n Hn/ aPO ._f / / a`/ / aL(N^NuNVH*n&n ~,+xHn/ a.N1D'@ MN,PO* .r g,Sg[gSf*x`&/ / aPO(`/ / aPO(` / / aPO r MN/+/ aDPOހJfe L(N^NuNVH*n&n ~| KCpj""QHn/ a.N0-@ MNPO-@ .SgUgSg*r f2|`.Hn/ a, "(N* N6*@ fHxNfXO(` N&@ fHxNJXO(` l@!K p lJ(f l@Jga& l< SgUg SgSfa.`a*.` l<,( l@ (NX*@ l@ fHxN XO` l@ ("l@ i$"M`SdJgjJffS l@Rp l|zpl pЀ n0XVDHHЂ,R` n-Hp.`L(N^NuNVTH ,4(-l4$x-@츮dzd0|pd$"A"҆C3d"qR`R`zd AC/ /a$POR`KX|pdzd AR`R` ./HnXaPO.Jg `R`PpL N^NuNVAnCHxHna`N^NuH l@*h$ l<&hJ9j`gD l@.(JotB|z@څpn lJWDHHRMJgpR`RKQ` l@.(Jo0B|z@څpn l MRMJgpR`RKQ`L(NuN4N7Npa/./ A@/0NlXO.Nu/./Jg/aXO .Nua"p@@r9A9A9A@%|@'@@48r)A@L@MNuwbrb/aD.Jfa ` .NuJ9k>g$Ak>CN .#jJf Hx N`XO`pNu/AjN.Jg(AjCN #jJf Hx N&XO`p` HxNXO.Nu//9jN XO.BjJg HxNXO/9jN xXO.BjJg HxNXO.NuaaaaFNuH*o&o ./$,/(*/,(/0 ㈀fF ㈀f"// a.////+// azO `BkkNup l8 l8!@ l8!@ l8!@ l8!@NuHNT. Wg Sg Sg ` | `|`|0 l<  l<@p l<@| r lHyjHlHzNO JjgHyk>HlHzNO HzNXONuNVH$*o~pd( Aoh/H M$o "RNZJg `R`HxNjpL$N^Nu/BkHyjaXO.Jk Aoh#kp`p.NuN3NKNVHH7*n~ MJfS,zB.Jgpg-MHxPHnHnaO JohN>Jgp`<.r-gr/fA-Hp.Netr@ACgP[AgNSAg]AgVSAg&SAg0SAgSAgYAg`SAgSAg`n/.aNi$Ak>Cf`z` nraerzc rAe.rZb(Hx/HnNZp.NdO rA)@`|&p//N$PO` l@(/Hna< l@L($<@YvNN9@p./NO `n l@0/HnaPO`V l@@/HnaPO l@L@$<@YvNNl9@` l@8/HnaPO l@L8$<@YvNXN69@`pk@'`|`JfACPfAPCjNgAjNJf HxN`~AjCf`J,LfN l< B( l< Smp lh@0;ND***HxHzHzHnN?HHnNtO`2HnNXOJf$ l<| `HnNڀXOJf l<| J,Lgpk>J,LffpL 0N^NuPS not implemented %s %dgfxcline.cEpsonLAZERJETLASERJET%s : %s [-p%s]NVH*n&n ..-K-M nJg raerzcrAerZcR` nJg2raerzc rAerZb SJg"n-H-I` nB " L(N^Nu/ *oJgraerzcrAerZcRM`*_Nu/ *oJgr0er9cRM` *_NuNVH *n&n /aXO-@ @t0e4p9b.NH nr0er9cr.fR`*p`BBpL(N^NuNVH*n&n ..-K Up gp fR` UJg. SJg& UJg "nR UHJg p gp f nB KJfS L(N^NuNVH*o&o ./$ SJg2JfJfp`(pN`r/@ N`"/,Jg `pL(N^NuNVtH*np-@~Hx(/ HnaO ,Jgpd"`"/HnHzzabO JfF/ aRXO-@~ @JgACN` .r grg rg `x~`t~`p~`lpd"`"/HnHzaO Jg"pd"`"/HnHzaO Jf~`$HnHlHlHzHnvN;LHnvNxO . l<@ L N^NuNVH*nG M-Hg nJgr gr;gR`BNHnaL(N^NuNN4N^N=N8NXZNƸNNNNppaJ,48fp``pN-)@4\NrHx HxKp"N1N4^PO)@Vfa4HxN$XO`$NFpN9p rN9Jg8rg0rg(rFm*` g  fz` f0 gf l4tJf, .l l4t"HRIa BR . l4tpa`NN] 4t-@ro l4t"HE I"Ja  .S . l4tJ,gr NR2N'a`ff^F r@ҁ)@pfD r Nd`2 l4tJg(N\x&@ 4t-@ l4tC`SdJg KN\P" // /,4t-@N l4t .C`Sdp l4ta O `a`p l4t-@Jg[f&p(N\nJgp l4t(NT l4t@` .NT l4tJ,ga|N&a`Vp l4t-@JgD[f&p(N\Jgp l4t(NT l4t@` .NT l4tJ,gaN&la`p l4tgaJfp l4tfaxJg` l4tN[Vr @faJf l4tN[>r @gaJg` g ,4`4plNb-@ m n .NS-@rAmNrZnF .Tn: l4t"HTIaT l4tpPЀЮ@paTa`a` ,4dЬ4`/@$N'-@"/$mN'ro .SJga`fJ,4|gB fSlp1-@`R 1oB .A= pJfR 2maJfaBJgJ,gp NO N$` .A=-pB nJg8NYz".Ҁ-@n" n"l4t`Sd .Ѭ4tѮѮ` l4tB`J,4|gBpf-n fSlp1-@`R 1op-@ ./@$ .A="/$ p"MNXJWDHH-AJfR 2mJf`Ta6JgJ`aJg>`aJg2J4dgpaJ,gN# l4tJgNXb&@ K"l4tar 4tp l4ta2`&l4tBJg KNX,&@R` l4tB 4t .Aa`-l4tBaJgR` . na n"l4ta .ꐬ4t`pNkf`hAހ-H`Aލ-H`Aޢ-H`vAީ-H`lAް-H`bA޽-H`XA-H`NA-H`DA-H`:A-H`0A-H`&A-H`A-H`A-H`A-H ,4t"$ -Agtm t @(gtm @NW2r @gp l4t( nCNR(-@Sf l4tnJ,gfN!p.NL`VpfNJلgH .Tn> l4t"HTIaTT4t l4tnnnJ,gN!z l4tWHa . g g g g g g gx gn gdp-@`Za:JfJ,4|gNbJfJVfp1` ,VSA= p-H"MfJfgdJg` ,VA= pNY ,V".R/@$ NYA="/$!Hf A}NL` M"@fRV 1VoBV .r g fD` .` .D`p`pL,N^NuH*H.J,gLJ,PfF,,4`z4plJg Ma*@RR`輬4pl SJg p NJ8RR` SJgN`L Nu l4tJg6R4` ,4p4l",4`mpa` J,gN l4tNT|)@4tp`pNu/ ,4t4x.pm p l4t(fp(NTJgW4t`,pmr l4t(fU4t`pmS4t`Jfp`(S4` ,4`4hlJ4dgpa@` J,gNp.NuH*H&Ic Jg`B` MJfS .R SJgxx`L(NuNtpaANJpNO*NuStack space exhausted Program aborted NV4o nN^NugLn$2H@`""""""""QQ`$2H@`# # # # # # # # QQNuJ9fHy?<&NN\NuJ9gHy?<&NN\B9NuH0AԀCԠ$Xg &Q"$`L Nu`z`n`b`V`J`>Jyg,H o0@ @@fL/9ԸNuHI$p#&p</<O/r<NPN,x9E nJyfE //HlNK8 "lh i"ino`HlNK8X0U@@A/0HlNK8P&lh/+/+HlNK8 J9g /Hl4NK8PL//Nj/ // /I$HlHNK8J9gv flH@HJfb/././. /.HlNK8/./././.HlNK8/.HlNK8P/.HlNK8PHlWNK8XJ>gHyNK8HyNK8XNN#D @g @g @g @fLJyf 9g ``\`Z0/@r< @ gB<< @pg6<: @g*< @g< @g<\ @g<I$J>gFp/Hy>NpNbNp9 @#ԼL/9ԼNupaNVH@I$ .# O Ny.y LN^NuH# ., "??t?NN\OHLNuMLb%cc%c/. ra.NuNV/~pl$"/A Aو"0aAو"/!R`|ٙ.N^NuH aJ7f0| ,7?//r?NNO LNuNVH?A4-HJ,8gRN-^p0,7",8&Ҭ8.R$,8"Ԭ8*A4"HJfS& R///N#2p0,7Hl4/N"N,`h n-HJgXpfr lh*H`p ld*Hp F8@gzp08@gprA5vQG5v,8Cg ,rft`tpfp lh*H~SGf`z~ G@G H ll*H @r @.-l7xpr-Ё"Hr~Sf`(.,G5vSGf,8Cg8CpA5vaN,8CgR.,G5v KRK H cprt‚`" HdpЀrt@Ԃ‚`pSGf,8Cg.,K5vp"tSGf,8Cg.,K5vprUҁpURMUGfK5v&l7,,7J,8gJ8g ,rf@FFFFFFFFFFFFFFF,8Cgp` p$F `Z ,rf ,8CgpF`pR7`2,8Cg ,"S`",. ,8 Jg SgSgSg``F``B ,8Jg&SgSgSg`U`F@` |`B+J,8gd ,8Jg&SgSgSg`U`F@` |`B+ ,8Jg&SgSgSg`U`F@` |`B+RMSGf2,8Cg ,8 JgSgSgSf`B ,8JgSgSgSf |`B+J,8g@ ,8JgSgSgSf |`B+ ,8JgSgSgSf |`B+ ,7gJ,8gr`r`rӬ7`L(N^NuNVH?*l7.,8 ,8R",8*,-l8J,8gp0,7$,8&Ԭ8.R&,8"ցR///N\O ,8"Ь8(ep0,7/NXO` ,8Rr A4`Sd ,8RA4B0p0,7Hl4/NPOB`R5f&&M ,5(& .&&&&&&&SDf`&pe gJg-M(,J,8g 5SDf*nRM`\ B@H@".BAHA@A @J,8g .@n7SDf .gJ,8gr`r`r @*HS`h&M*,J,8g.-K (&SDf n5&HSEf p̀`.-K (J,8g &&SDf`&SDf n7&HSEfJ,8g ` p̀`L(N^NuNVH/ .,*.(. ap82" lb1A&" lb1A*" lb1A(" lb1A,-@gr`r1A lbgp`p1@ lb1|" lbBh$LN^NuNVH.,-Ha QgQgp`?r?NNO(p0.Rr2.Rt4,7HnHx/)@\)A`NO p0.)@7J,zg$ \d)|\p@8@8p)@7`"rWDHH@8t7WDHHA8l8{J,ٙfJ,8fJ,zgBٔa( ,\",`NF",7NFr2,7HlPB/)@XNp0,7HnHn/NOp0.S)@8*p0.S)@8.JvgЀ)@8.p?NNTO)@7Nn lb*P"mL0-PHH7)IlJ,tfE*R)mLh <NC&@ g~ d(|pd"҆ $Ԁ lh(R`R`)Kh|tACHx/ /NACHx/ /NACHx/ /NACHx/ /NACHx / /NO*@ g ,X l7"MN6 *_Nu/ *H g ,X M"l7N MN>:*_NuNVH.,-H QgQg` *lh`*ld` fp`p"N@b M "n`SdpL N^NuH.*H,a JgB r l7"Ma XO`Hx r M"l7a XOL NuNVH'*H&I. $,7*-Ag ,7` -@Jg ,7` -@J,8g"*,  M"K`SdSf` f Jfr`r t$HHHJ,8f-B| ,=@ M"K-H-IJg" .".J,8g *.Jg &SfJg" .".J,8g *n&nSnf|L(N^NuNVH HHnHnHnHnHnHnr/HxdHn///////////HxHxHx!N O\,gLN^NuJ,f4|)l=p aVr//)@=paAaPO`afaNuJ,gB,Aa ,=a)l=Nu ,5NuH0.,,5 ,5gp nza 2 ,5r*N$A5"HE8&J""""""""""2 r*N$$$$$$$$$$4 ,8*",8.a @ ,82aJ86ga`a()G5 L Nu/J4g&pa.  @wrAaT ,4N/,p"aDJ,1g <rN5.NuH.J,2gB,2prFmpr}ҁnprqҁf,8Cga`a`prFf,8Cga`a`pr Ff,8Cga>`a$`a,apr@ҁr a a`pr`Ffpa h`zpN6Jg pa`dp e pa B`Tp[@m< @ l6@0;N4*"(**a.`$aR`a.`a`~pa`|2LNup",8.a xNu ,8.8faL` R",8*Aa ZNuJ8*f ,8a^a` ,8*SaNNuJ8.fa` ,8.S",8*Aa Nua ,8*Ra NuNVACaa* ,8.8gahapa` .".aN^Nu/pa.aXaJgN.Nup"aaBNuHaB5,,8**,8.a "aJgaa~pl, r*NA5C8 0R`J,tg J,8g J,ufp`pLNu|8>NuNuaJ,8>ga`a4NuaJ,8>ga `a NuaNuH.,*/(/ajJj ,("RށJj ,,"R܁Jj ,(RڀJj ,,"R؁ ,,c(p)@)G8")F8&")A8")A8"AalLNuNVH*H&I ,8"* ,8&& ,8"Ь8 n ,8&Ь8 n L(N^NuH*H&I*8*&8.L(Nu ,(RNu ,,RNu ,8RNu ,8RNu ,8*Nu/. ",8.a.NuH.,p̀ ,82@І*aX)E82 aLNuH.,p̀ ,82@"Ё*a()E82 ahLNuH~ά82pxЀ82, a aLNuH.a )@82|̀rxҁ* a^ a)G82LNua ,82NuaNua8CNuaNua8CNua8CNua8CNuax8CNual8CNua`8CNuaT8CNu ,8@Nu/.a>)G8@gagargagagaga.Nua8CNua8CNua8CNua8CNuaaBa aRafaaNu ,8*8caaNu/ *Hp Ma *_Nu/ *Hp Ma*_NupaNuNVH.*H,,8R*,8R-lJg@ fR m nP5vh5wh5xB,5y|dA5vhhR`p lh-HpfHp@5v@5w nP5xh5yh5z@5{|plA5|"nhhR`p@5@5`lp,3ЀAzP5vh5w-H nJfRS nJfRS|pl*A5v"nh-IJgA5v0hfRSR`L(N^NuJ,8>fJلg ,`pNu/.)G.NuB| ,S)@ـNu/.Jg( ,8*8caaR8* lRC4 .NuHJgX~A4 ,B0J,=g( ,,JgpgpfpgN ~a&JgN l ,ѬaBLNuH.,a )@8*)@Ь8")F8.",8.Ҭ8&)@)AaLNuNuaaNup//p"aPONuNV/.aS/@aSr//// p"N+..N^NuNVH?.,*.(. HnHnACa .Ї".҆$.ԅ&.ք./aNLN^Nup//p"aPONuJلgp`pNu/..NuNK|NNHN0N0N(NۜNNXNNN$NHJ,f|p@lAۏJ0`g~ lAۊJ0`gtJ,ۙfnAۊB0`NAN!fA3N!^NFN HЀAۀRpN1*p g f HЀAۀSpNp f HЀAۀSp` HaPJgR`hVF`LLNuH# .,plp?Bgr?NM\O` p?r?r?NM\O ,drcNpLNuH. lCۏ J1g2rAa0,aJgpfp~",a,aJg `aFJgp` p",aZLNu/.)G.Nu/.pl a*` WaH.Nu lCۏ J1gp` aNuNVH -@Bgp?NMXOJfp`pLN^NuNVH -@p?p?NMXOJfp`pLN^NuH <N,4*@Jg6 <.N,$&@Jf MN,p` KN+;|p;@;@;@ B L(NuH., ЀAۀRp Al*HJf.J,ۚfa*g Aۜ"0he ЀAۀSpp`JJg*U`JmgSmRm AۜRp0- Rm mfBm ЀAۀSppL NuNVH. ЀAۀJpf AlJfp` Al*H&M-U ЀAۀRp nJh f6Jf ЀCۀSqp`J,ۙfg*N* U-H`*H-U`| aJfp n0(0 pC۔1xf,f ЀCۀRqpCۊx,` p"a,z~`f|` p"a,Jg0 nRhSh CۜSRh hfBhA۔x ЀAۀSp L(N^Nu/. ЀAۀRp/ajXO ЀAۀBp AۜB.Nu ,aNuH. Aۜ,0 ЀAۀJpf AۊJ0xg D` LNuH~|p@l^ HЀAۀRp HAl*HJg, UJh f &PN)R~*`*<  MN'Jg~*U` HЀAۀSpVF` L(Nu/. ЀAۀJpfAۀRp a6.Nu/. ЀAۀJpgAۀSp a.Nu ,aNu ,aNu ,aNu/ lCۏ J1g~p@lp",aJgRGaL`.NuH./ Al*H&U g * KN(b`L(Nu/~pl /aXOV`.NupaNVH.,pmp o.,۰p۴fazzJkD ,۰r NA۰ *Px8Jg rȁ-@" MAat .Ѐ`S`zplB r NnA۰ *Px8Jg rȁ-@" MAa* .Ѐ`R`pfa)F۴)G۰L N^NuNVH*H., Ѐ MC`Sd ЀAw Ѐ"M`Sd ЀAw ЀC`SdL N^Nu/. ,۸gX)G۸ Sf&p@rA@A@@AA`(p@r<A@Apx@@p|@@.NuHK>JGg p0,Gp0" Ma Ѐ`L NuNVH.,, Jg SgDSgb`nHnBNLp0,7B/NO B ,op0,7/NXOS`aJfp@=rA=`B,=|=`aTp@=@=)G LN^Nu|{p)@Nu)l)lNuNVH.,*.(. a S",mH Rn@.g S",f a <`.g R",f a <` S",m| Rnt.g U",g.g T",f a< <`j.g S",f a <`J.g R",f a <`* ,moap` ,moap`LN^NuJ,=gJ,fp0,7Hx/NPORRNuJ,=gJ,fp0,7/NXOSSNuHI$.H,=,=@=Jg H l=N.B,= H2, HrJg.SgSgSf"g|~=`|=` g|}=J,=gl>=)l=)l=)l>=|=9G L HLNuHI$.,*( ,=,=@= H)@ H)@pf H` H)@ H"H l=N"D E H" HLNuNVJ=fp0,7Hl=Hz/NO J=fp0,7Hl=Hz^/NO p0,7HnHnHn/NLO0.H)@0.H)@pf 0.H`0.H)@N^NuJ=gp0,7Hl=/,=/NO B=J=gp0,7Hl=/,=/NO B=NuNVH3*HaHnHnACNPO .",mn$.&,mop`:. ,,Jm g"f mЭlp0- ``pL N^NuJ,=gJ,fN4BHxNGnPONuJ,fN3BBNGXPONuNNNNNpaNVH.gRXpd.KJf aJfp`n m d"Jf a&@ fp`NK`*m` m P"d&H"h+IA `"&H"K "& m#h+IA L(N^NuNVH4*H gYM-MG n"kd f 'HB`b&k` k"n#H'I K f&"ӓ i'H$K f, ѓ k'h` f i ё i#hL,N^NuH#$.HxpH?NA\O, "<Ёop`./pH?NA\O*@ fp`)F$)M *Aa L$NuH!$J glKJgb mJg*H` m"H ,$$l f>.Jf/, pI?NA\O)H +H`Jo//, BgpJ?NAO )G$BL$NuNV/ *n/ aF*nN^Nu/.//aXO.NuH./ gR a,Jnp` F LNu/ *o Ma.*_NuH./,/ "N!* /aXO*@Jg r M`Sd L NuNVH*n.. -MgR f/ah`zJf/ a`pX MYH&H P-H"e"߮-n n &C/ aR `8 e `.Y/aXO-@Jg"Y M"@`Sd/ aXO .L(N^NuNVH*H&I~paJgRM`Jg p;gp fp`0pN2Jgp`A-HA"nd\JgVpa^JfJpN2HJf>p'g8p"g2p;g,p.g&p f` nRp/HN oRM` nB-Mp naJgR`J.fp`.r:f nJgp`j~ r N sJgVA"sfJfg r NxA"sf(Jff" r N\)s= s"n)I=/ Np`R`pL(N^Nu...bakMonTueWedThuFriSatSunJanFebMarAprMayJunJulAugSepOctNovDec /.p@ g@fp`p.NuNVH*H&I MCN4-@g @ (r Ka\. nN5 L(N^NuNVH*H&IN8 MCN4-@g @ (r Ka. nN5N8 L(N^NuH#$.*H,NAL/N=RXO @2(p??/ tW?NAO NA,Jg N7Jp`pL$Nu/ *Hp" Ma"*_NuH*H.pr Ma pL NuH#$*H.,pr??/ tC?NAO L$NuNVH!$*H gpNr@`p. ?Hnr6?NAPO .".N\".NTL$N^NuH.*H|(BznNND, f* `np fpf"* `Z fpo"*SSNpFn.Aq0hg" r N 6p0r o_"*ݕ,R`x L NuH z|~p2l8 A="HA= pJfSE=đ R INBJg|*R`JfzLNu/.pNZJf NJgp`p.NuH.|J,,g"B,,prFmpr}ҁnp`pf|,p dp g p gp fbJ,gp/ l>NXO @`*H g8zpFfp-rЁ*TM SJgpa>,pf` pa,, L NuH.|pfp@-`TJ,-gB,-`HJ,gp/ l>NXO @`*H gz SJgpa,pf` pa , L Nu/.p/, /N:2PORfp`p.Nu/.pa.NuNVH!$*H MCfANBN=HnpA?NA\ON.Jg Jg MN3 L$N^NuNVTH*H&I MN.-@Jfp` nCfA-H KN.b-@Jfp`x nCTfATB-HN=DpF nN2-@g2 @(gA䱓N48p`2 n(gA"KN4p`N=Jgp` n"na L(N^NuH!4*H&IBNHnpA?NA\ONZJg AN1@` KCa(Jf M"Ka.Jfp`pL,N^Nu/. "<N]zJfp`4 rdN]jJf o pgr` rN]LJWDHH" .NuH.,*/ A"0҇( aJgpoR fp frnop LNuNVH*H.&IHnNHnNPO|-@pd$ HxA./0/.NBO JgR`&zp d( nXH HxCJ/1/NO JgR` n Jg-M nPH-Hr gr0fR n"n-H-Ip nAq0fAr"nf AN/0/ N;~ nHx// NpO` n p"MQB- .L(N^NuNVH n0( n2(@dp`, nhcp`0 n2@dp` nPcp`pN^NuNVH~z| Fl` HA? *p gJx ЀRr25 f؄ HA? N(Jgz. l኱f HA? )pRF`Jf L N^NuH*H MN)T&@ fp`(BN8&/ N8.N8 XOJg~Jg MN.6 L(NuH*H MN)&@ fp`(BN7/ N.N7XOJg~Jg MN- L(NuNVH/*n&n x@AfJf$`t `xJ.fp`npNpr./@ N`"/*p.~A@0p.|A@0gJgJf ` `JfJg ` Jft(`nL(N^NuNLNNN|a2Nu(null).\../..\PROTEXT CONFIG FILE Ver /N4. Gf `8p0a`.p0r,Kgp0r,Lf r aN .NuH*H.p @dp @g p @g><`, Gb&p0a.p0// NoPO&@ g " . L(Nu/./ r a .NuNV/~p2d: /@paA="/!f A}ap` A= pBR`p.N^NuBNuJ,f0J,Af*BNتS)@=NبSH=ro|B,xNup@x@NuA= ,A=xRr)@Nu ,SrA=pA=px)@NuNgah`aNu/ *H" VDHH@)M>*_NuNVH/.|p[@m( @ l"@0;NB`Rp fp~FfJgp a~ p~FgJ,gpa JgSrWDHH@p gJ,g",=R$,ogBp gRJ,g ,=m(,Nz-@NB-@NԒNԚN .NרHlN9X .NF .NאBNXO* f|x`B,xp fN` p NN)D`pN`pN,gp`,gD,g pN`pN -@rf p)@N)2 l N'B ,g pN-@rfp)@Jgp`pLN^NuN ,Jop a`pNu/ *Ha Ma,*_Nu/ *HN MJfS"a8 Ma*_NuH*H~ fKJg pa.`N. L Nu/. SJop ax`.NuH.p~Ff,,`Nj,l p aL a aNLNuH*H MaN. Gf `p0a.p0// NktPOJg L NuH*H Ma. Ggp @e r aNl L NuH.a,ad`LNu0| NuH Hzp&?NN\OJjRLNu/.pFcp`p@Ѐl /N XO` pA@0x.NuH.pFb$p@Ѐd /N XO.`|A0xJg. LNu/.pFcp`p@Ѐl /N XO` pA0x.NuH.pFb$p@Ѐd /N XO.`|A@0xJg. LNuNVH*H&I MCa.Jg& L(N^NuNVH*H&I-U nr gr,fR` n-Hp&gp#f* M"Ka^, `NpAq0fp`:B r N VrЁr0& n-HpAq0f nSH*pL(N^NuNVH!*H&I Up-HAq0fp`XB Hr9b rt0`r aBr7" /Ё& n-HpAq0f nSH*pL(N^NuH*H&MJg pa^` L(NuH*H&MJg pa` L(NuH#.*H&Ip fp`0f-t gp`p fFGp`TM`L(NuaNuprAQNJfNHxN XONB>N.N zJfp ap)@)@l{>pNu/.Jg Aa|N aJo `p/N XO.NuaBNdN߸N Xa~N ,JkN`pNN.FNPNuNVH*H&I.-U np gp fR`Jg p gp;f *p`Bp"gp'fB*R nJg(p g"g nR Sl nRH*p`lf\R`V|JfP np-HJ@g@ gY@g@g@ g @fS|` nR Sl*p` * .B3L(N^NuNVH*H&I-Kp:-f KRKp/Ha oTM` KRK/HN%BrAЁ o:pNtJg nTH"Mf`~N%rAЁr ngN$.p nrAN$n npOa np MCtVg gTM`p MC`Vgp MCJVfVMp,//.N(.PO @B-@` na0r NJf/,/.N-PO/ /.N-POpg N# KapL(N^NuNVH#$*H.N+lN$rAЁ@|:|\B.BgHnpG?NAPON+DJgp`2A"HJfS, op`"Mfpf /,/ N-2PO L$N^NuH' ., <"NL* rF@ @ @2Hlp ?NN\OLNuH#4./*o &o$p ?NMTO,p Sr VDHH L,NuNVH*H&I. SJg4paRr/@ aD"/,Jg `Jfp`RMRK`pL(N^Nu/ *Hp[@gQ@g `"p-ajJgA `A ` `A *_Nu/ *Hp-[@gQ@f `, MUH `$p-fp-aJg MWH ` MSH *_Nu/.prPҁmprLFnp`p.NuH.,*/(/Hx// "a O LNuNVH'.,*.NJ.gp @@@@@@`$|||||| "NJf A>!`R`L Nu/~pl A>Jg A> pN`R`p.Nu/ *H/ N(XO*_NuH./NXO*@ faJf L NuH.,//NPO*@ faJf L NuH*H.// NPO&@ fa`Jf L(NuNV/ "HJfS R-Hav*@ g n"Mf M` *_N^NuH K9R- -9c`p0@R- -5cN@R- -9c>@R- -5c.@R--t9bt3ct2e@R 2c|BL NuNV/ BDHnNHnN*@A pC9Q|B*nN^Nu/ I$HT>TVUHRD ,Dr2m p2DaL l>N(_NuNVaJ>fp0,7HnHl>Hz/NON^NuNVJ>g p0,7HnHl>/,>/NOB>N^NuNѤNӤNNNPNNNN۰NNьpa0|PCNuH Hzp&?NN\OLNu,Cf0|NuH Hzp&?NN\OLNu0|Nu0|Nu/ p)@B < N*@Jf ANp` MNaN*_NuaNuH.z Ї.xN\a,pfJfN(*JgN* o LNuHN,Nt a.NĀpf a.pg LNua6Rg`Nu/N>aa.NH .Nu/a.pg fNͺ` .NuHHxHx NPO.,p̀gJ,gJ,g )@ALNuaJgJ,AgpNPp`pNu/J,LgB,LaPp@A J,xgJ,Af6@xp@A `,a JRg J,Afa&. WDHH@A `p.NuH.,Aa8, ggN`NLNuBNu/.)G.Nu/Nʴa".pfN̞` .Nu/ *H)M\*_NuNV/a a:.pOЀf~F fax. g f. WDHHrA/ C>IN XOA>)H`pFo0 l( A; Jfp`* A; )pBlp`J\g / l\NXO. .N^Nu/a(.pgJfa.pga .` .Nu/.,~pg)@~ `HJtg"~ ll)HlStf lpNBp ` Jhg lhN.`~pfa .NuNVHJ,AgJhf JtfNP` ,rg .)A `J`gp l`-@H`fB`a JNg$BNaJfJgaaap`Jg*0,Rlr2ҁ lp0-@ fTBJhfJtg>Jtg a-@`$Jhg lh(g a$p`a-@p|far-@r^grf4 .`aV. N4.r@opn r NlbNp` nC@ J1gNr@-@`R@~plaxp|6xfB6x`R`B.A-HACN\pfp-@ .`Jp fp -@` p f(a,p g pEЀg)F~aJgap` .`aLN^Nup)@~JtgBt lpN`BpJhg lhNTBhNuJhf Jtfp`pNu/. A? Jg*A? pfBA? pN A? B.Nu/~p@Ѐl aR`B.NuH#~p@Ѐl A? BR`B~ ЀA<0JFgp0 GRrC$1(a `LNuNVH.,FB. AaLN^NuH*H~ ЀRr25 f L NuNVH*I-H~ nJg|-Hp^@f\| J@gR@^fR`Fp0A@J0gp0Nr@,R`$BACNH,. nr^fR Ѐ;RpFez ЀR; L N^NuNVH.*Hp΀ aDJfp` MCa,"AAa L N^NuNVH.,-H a "ҁ/@  nNA? "/!fA`N p`pLN^NuNVHa*pg|} :m >o `Na.pfNz`N :m8 l0@0;N Kހ`Kލ`Kީ` Kް`K޽ r  MCNr,pfp.` L N^NuH? aJ,=gp,=.|,=B,=)@>` ,",ᜲgAA*0R m,B`&p?p ?NMXO@>JAg ,ZAZp` B@H@rF"BAHA,t̂)@>rTmN 0lD@0;N^hr|66666666666666666666666 (0p;)@>`p<)@>`p=)@>`p>)@>`p?)@>`p@)@>`pA)@>`pB)@>`pC)@>`pD)@>`vpK)@>`npM)@>`fpG)@>`^p)@>`Vp)@>`Np)@>`Fp)@>`>p)@>`6p)@>`.p)@>`&p )@>`p )@>`p )@>`p )@>`p )@>pЀ>fJ,|g <`",>f ,>r~fzx",$,&,=)C ,=)@H>H>J,{f$&,ff ,="v(SDHH(JgB`)l=p@{Jg|{ <`JAgp,ZB,ZJ,g ,>"a~> f|LJ,WDHH@~ fJ,WDHH@~ f JRgSR ,ᘰfBRHz(p&?NN\O LNuNVH.*H. -@ S)@H)MJg ` <)@L N^Nu ,HJjJg lN)lHNu/. HB"<aXO.NuJ`VDHHNuNuNVH.,x r fp` rggx`pgx`fx`bgx`Xg(`Ng ЀAw"0H @gxpg$g ЀAw 0H @gx ЄЀAw: LN^Nu ,>Nu||NuB,|NuH*H l&P gA/ /NPOJoAd)H l&P g"A/ /NݶPO.Jf ` Jn)K`pL(NuNVH*H&I KCa MCa L(N^NuNVH *H&I Maj-@Jf8 MJfS"t ҂ N$-@Jg> @PH"Mf n"l "B"n iN KaЀ KNJ n!@JL(N^NuH*HAd)H l&P g.A/ /NPOJf kN l KN`)K`L(NuH*H Ma&@ g)kBlp`pL(NuJdg ldPHa~`NuNVH~KdJgf U"lኳWDHH,C/I haЀ o NJgJg U)h~ UC IJfS r Ё MNhJg~*U`Ad)H L N^Nu/a.. a .NuNVH/ p?p?NMXOJgHzp&?NN\O ,RHr@ҁmBp??NMXO(|} H@H. H@Hr,pra* Ef4RRg*p)@N ,ᜰgHzp&?NN\O ,)@BR`< .",ᘲg",AA!)@Hzp&?NN\Op?p?NMXOJf>LN^NuNPpa/ *HJgp:-fA ` *_Nu\H*Hp,// NPPO&@JfHx:/ N>PO&@ f&M`RK L(NuH*H Ma*@Hx./ NPO&@Jg ` B/ NKXPOL(NuNVH*H&I Ma-@p. nfRfRK/ /.N (JWDHH L(N^Nu/ *H Ma~ @B*_NuNVH*H&I Madr. @HfRKC Kf MNL(N^Nu/.p\g p/gp`p.NuH*H Ma Jgp`\p,// NJ~POJgp`D MJfS rcp`.~J5xgp5x/Hl;NJFPOJfR`J5xgp`pL Nu/ *Hp Ma*_NuNVH*H.GCHzxBACH-H MCCHfACHNB nJgpa Jg nR`p:+fprAq0Jg Ka&@p.f+fp+aJgVK`Jgp@*g(Y@gS@gJ@g>@g>@g*`BRpc`Jg|Jgpf`n-@`z`|`Jf(`Vp(*-@`p/Hl;N POJf6p c0JgR cd`RpcX`pcACH `pL(N^NuH*Hp Ma&@Jf A"Ma L(NuH*H Maf&@Jf A"Ma L(NuH*H Ma&@Jfp` K"MfpL(NuH.*HBN/ /N ,NPOJg|pfa L NuH*HBNVB/ N d.NLXOJg~pf JgaZ L NuH*H.,&I "N(Jf `BBN / /Hx/ N 8*N OJggzg Jga "N(L(NuH*H.,&I "N,(Jf `-@N lPOJgJg/.NvXO-HJf.p$fpN(,pWgpAfpy)@ naF`(Jf n|A!R`pf n|B!R .L(N^NuNVH!$*HBN gl <@gN|Jg Kp dp.Nΐ`pNΆS`|`L(Nu %08lx: %02x A0aNJf A.aBJgHlp//NO |Nuarnor.rscprotext.rsc\protext\\NV/ *H MCNAN,JgA)Hb <N`rAC""2/ HnNANPOJgA)Hb <N\`8AC2/ HnNxANPOJgA)Hb <N&`p*_N^NuNVH?4BnJ,g,zgNNN*@~plH r NP$AC&HJSg00H2+H4+H6+H8+H/////NOBSR`Hx/,NHnBNpNT*N(NNzNހOA)Hbp4Nd0.r Af0.]@g`B/,N4N$NNFNPO~pl r NObACHnHnHnHnHx B-HNOJgXJngR0. n00.HCE/J,E/J0E/ //4//4/ Hx/N9nbX <pNOR`h MN`JgN NPN& fp`pL,N^NuH~pl( r NNAC*HJUg9UbX <tN@BUR`L NuNNNdNNNpaBNu ,rﰁg fp` ,Nu|NuB,Nu/ :|)UA4**_NuH J,fHzp&?NN\O|LNu/ :|**_NuH J,gHzp&?NN\OB,LNuNVH/. H@H* r(|J,g"p@f^ HrAЁ/HlHlCNO JgHxHlC lNPO`N0HlHlCN&ACN̆NnNNTPO`@lz HtAЂ$HDA~/0(/HlHlCNOJgHxHlC lNPO,p0 fTNHlHlCNACNNPON^,pa@e pz@bF @gp0/HlN7POJgNp0r,g Ff H-@`p0r,f -|`p-@ .)@B,LN^NuNpaNVH*n&n ,,DL-M-K n."n "-H-ISfL(N^NuNVH*n&n ,,DL-M-K n"n-H-ISfL(N^NuNVL(N^NuNVH..*n&n/. /.p" M"Ka L(N^NuNVH7.,*H&ILtvNrlLNxHp`p&Jjp`pl"`" , .㈀ f&ADX-HADX"nd 0R`z`-lp)@z-|-@L$,Dz܇Sm KRKHx/ /HNPO o`~>,D Ѐ܀-lDSm8Hx/ N n0THx/ /H$NOr o2$0`~>,DRG$&lD܇Sm KRKHx/ /HNDPO o`RG( L(N^Nu| /,DNBD.DNBD.DNXOBDNuNVpH7..RG$ lD//.-HaPOr2,DS-@ܰlr2,D|`r2,D~Ѐ lD"np0*Ip,Gt-@-AJWDHHSJg RG(p`BF Jgp"-@`p"*plBF Jgp"-@`p"*pfpѮ`ۮ KRK"lDfSKB/.HntNnPO-@Jo RG(p`F Jgp"-@`p" tH-AJfpF"Jgr$-A`r®$Ђ-@F"Jgr$-A`r®$ЂF"-@Jgr$-A`r®$-BrāF"Jgr&-A`r®&ԃ".&-8R--B` RMp-@JgJfJ&n B .аl~rFf 6fbg ."$6fLJg ."$.Ĵg$`8 ."$6HJn RG( `. .r2,D|/@ 6N or2,D|-@$ 6(NR .Ѐ lD"np0*I|-A .SJgF Jgp"-@`p"*plBF Jgp"-@`p"*pfpѮ`ۮ KRK"lDfSKF Jgp"-@`p"p€RMp-@-AJg`HR`zRG( fp`B+ .L(N^NuNVHBp0,DS-@ .".ಀlҀR, Ѐ lD"n p0&IzF Jg ~ ` r-@rg*nSMF Jg ~ ` r-@-@pf$F"Jg ~"` r"Ӯ-A`RM lDfJf lDe-F`6 S-@`* .L(N^NuNNbpaNVPH*n&n )KK:0+Hr/HnP/ NHnPNx,,K>*څ  k .HnPNrOJf ` Ы2Hx#/+,/NlO '@6fp`~ k6^H'H:  k /HlKBNzPO)@K k:JgNRHlKBHnPNPOJf Ѕ`r lJt/ NXOJgb~ k6^H'H:  k /HlKBNzrPO)@K ,K>g,~ lJpHnPNXO(Jf ,K>Ѐ* Ї`RJkN|JfpL(N^NuNVH..*n )nK:B ,"<́ n0( Hmp`N)FK>*f< "h // NyHx/ NyXO-@Jfp` nBp`  nШ2Hx#/(,/NkzO n!@6fp`0(H/@ "/N-@ro-A&h6JgZp-@-@ .l,p-@Jg Ѯ n0(HѮ0(HR`"n i6#H:AKB)HK`, "n i /HlKBNxPO)@K"n i6^H#H:N Sm NJfp`HlKB/ Nxp,KL(N^NuNVH*n&n ..JfB`/ HnNxnHna./HnNL(N^NuH7*o./ zJgJPf0 lDDcp/// aO p lDr)@D)AP)HD ,Pn&rAX0$,D‚,P "&,P桀`( ",PtAX0&,DƂ*BP`rpL NuH*o./ ,PmrBP,p΀ ,DD*RoݬD`4RT m RT` ,T܀Hx// a*O p lDr)@D)AP)HD`PL NuH$*o./,/ Jgp"*)@P)AT`RTzHx#/ /,TNhO )@DJfp` lD"HE)ID)JDpL$NuNV/ *n/,DHn/ NO .Sg .Ugp`p*_N^NuNVH&n*KTKJgTp"Hҁ lJ~ lJg pA0xJg,`p f `pf/ /.Nv`BL(N^NuH*o&o./Sm|p"Ҁ6`L(NuNN'N' NN*N'ZN&paNVH/*nJ,FZgp`@-fHxNHxbNxp`&0- H"-2Ҁ m,)MDHx//-A-HN0O Rfp`/.N^XO-@JgѮHx/.N@Hx/.NO@r.tBB(G~" HoHxNHxaNx2PO`t HѮ H(USm KRKHx/./H$NVPO o`HxHlDHnNO 0,D@fHxNHxaNwPO` H//.N0,DH.HlD/.aOJg0,DH/HlD/.aO Jg0,DH/HlD/.aO Jg0,DH/HlD/.apO Jg0,D g0,DHЀ,/NrXO)@DJfHxNHxNwPO`P~0,DHl( ЀR lDHx/./H$N4PO o0`0,D"Hҁ lDh<,DH/NrBXO)@DJfHxNHxNvPO`&lD>,DHSm KRKHx/./H$NPO o`0,DH/NqXO)@DJg0,DH/NqXO)@DJfHxNHxNv0PO`r/.aXOѮ0,DH2,DHЁ2,DH4,DH҂4,DH҂4,DH҂ҁЁѮ0,D"SA9AD .)@DBD0,D g@0,DS@9@DH0,DH//,D/,D/,D/a HO)@DAEX)HF"AD)HF&`A)HF"At)HF&0,DH2,DHЁ*0,DHR)@FFZ/NpXO)@EJgP r Ё/NpXO)@EJg: ,FF/NpXO)@FJg$HxNpXO)@EJgHxNpXO)@EJfHxNHxNtPO`, ,FFZ)@D lE)HF)|FB9|E|FZp` |FZapL(N^Nu or J,FZgN/,ENpBE.ENpzBE.FNpnBF.ENpbBE.ENpVBE.DNpJBD.DNp>BD.DNp2BD.DNp&BD.DNpBD.DNpBD.DNpBD.DNoXOBDB,FZNuNVH'4*n.. ,.&n-F*,FJHx Hn/ NO )@J)@FJRfp`jSHlE HnN_POJf ,FJg HnHlE Np$POp9@Er¬FJAE `Tp,E op`0,ES@g< lD-h,p,E l(Jg" R KXKHx///.a OS`0,ES@gS@gU@g W@g`Hn/ aPOJfp`/ HnBaO 0,EU@gJf `|p,E 9@E9|EHlE HlEMNoB lF.HlEHlEHlEMNOJf9|E `6J,E g0J,E g*Hx HnHlEMNNO RgHnHlEMNnPOBEp)@FVAE)pFR ,FV"AE pHFN$gЀCE$lFR3/,D//A$N*POAE"/!m2 lF2/./,FVHlDNO Jf ,FVAE/0a>XOJf /,FVaXO`RFV ,FV"ҁ$,EAE1 ,FVAE)pFR`NJ,E g R/ /HnHlE NHn/ NeO @C)IFJf|pl AF !pAE0hz-@ܺlF0,DH// NPO-@ .ذFFl".$.дgR lF `AES0hR` ".$ lE"HAE!pAE0hѮ .R lEBR`NL(N^NuNV@H'..*n Sp,E lJjHxNHxlNgp`0,EU@g U@gW@fB/,E/ lD/(,aO <DH@H-@,Dg0,EHmp`p,E-@[g,E_fp-@`2,Er gr fp -@`p-@`HxNHxmNgNp`*HnA/,FJHlE N&pFJ lF:r,EHlEHlE//-@NO)@FR|plp".€f AE p +` AE+JgJo,Dfp-@ AE&pAF -ppAE0hz-@ܺlF .R lF/,DHn/NO -@Rg/.HnAHnN`O Jgpf2Hx HnHnAN O Rf AES0h`HnHnANbPO lF*/,FR/.HnHnANOJgB .rf( lFR2( t Bgt BgHnA/HnNO `HnHnANbPPO` AES0h`R/././.HnHnAatHnN`O lF"HFeB` &Hn/,FNaPO @C)IFR`B AE/0/,FJHnANO R` ,EL((N^NuNVH/..,.*. r "t ‚n r"t‚np`p-@g "t‚F,́Jf,Jg/. //.NO `/./. NaBPO`*n&MJgrgr/flxBJg /. // NXB/. NBO-@ `/ /. N`PO-@ Jf`0p/f n /-H `Hz/. N`PO-@ &M`RM`~L(N^NuH#./,/plp"$āfR` RLNuNVH*n&n JfBp`h .Ѐ*/N_BXO-@JfHxNHxNcp`@&xl2Hx/ N.Hx/ NO, " n0-HR`pL(N^NuNVH*o|~&lD0,DHl6 R lD R KRKHx/ /HNbPO or fB+` L(N^Nu/./ "<fG "<fg)GFB9|E.NuH1./plv"AEJgh"$AECE!(AECE!( Ѐ&փAECE18AECE!(Rpl Ѐ"ҁAECE1`LNu0,DNuNԬN NN/ ,E lE )@D lD*h,Hx// NhpD./ N$O*_NuNVH*n.. -| .z-lE-@Hx/ NPO,PQpmQgRpЀ,Jf`SmgRpЀ,`fp` /./ N8PO .ѮSmdBHx/ NvPOѮX-@pgSm0,DH// NLrxҁ-@2,DHӮ./-@NO Ѯ`BHx/ NPOXѮ-@pgSmN .R lE 0,DH// Nrxҁ-@2,DHӮ./-@NLO Ѯ` ." lEr )@EL N^NuNV/ *nHx / N\ZPOJg/./. / aXO `/./. / aO *_N^NunessmentableiblementssamenixlyingederestareammanumusbezalleiebdfglmnprtatecglnreNVH'*n/ HnN[|&MHxHn/ NۢO.pg"Jfp`|Hn/ N[POpfHxA//NhO Jo~/a XO)@F\Jfp`:B/ N&@./. /./ a ,BHnNO @SH-Hpgrfrsf|BfHxa zXO)@F\`/a lXO @ )HF\/.HnaPOJgB/ HnNJPOJfpfSRKHn/ NZPO  n ! R n!F\  nBp`fB/ N&@ "$ ./ aVO )@F\Jfp`: lF\B0( @ dd@0;NTj./ / aJPOJfp`HxHn/ NO .JoHxa bXO)@F\` / / aPOJfp`/ / aBPOJfp`/ / aPOJfp`B lF\/N POrs @(g/ / a POJfp`T/ HnNYHn/ NY @&@SKBHnHnNY.NOJgB Hx/@a @ "n"/# R n !B/ N|PO @G`&MBHnNf.Hn-@anO Jg4Hn/ NY  n ! R n!F\B/ N"O &@B  n Bp`p/ / aZPOJfp`ZHzd/ NX.NPOJfp`XOL(NuNVH*n&n p lF\h fHzl/ NS.N POJf*p`p h fHzD/ NS.NPOJfp`Bp+ramh l^@0;NlP^v0P6PPPPP|y/ NxXOJgp`b|ieB/ NZ`Lpe+f / NH`: lF\( f/ N2XOJgp`eB/ N` eB/ N XOJgp`B+/ N`p lF\h f>Hz^HnNR|yp@SKHnHn/ / aOJgp`y|ep@@HnHn/ / aV. `t0< lF\hg(|ep@@HnHn/ / a . `>/ NB`4pt+f,0< lF\hJ@geB/ NXOJgp`SKB/ NXOJgp`eB/ N`pc+f|/ NXOJgp`B+/ N`p+rarAgFpl+f/ NPXOrd0AHz/NQ,.N|POJgeB+/ Nh`ZB++f(@p@@SKHnHn/ / a. `$|ep@@HnHn/ / a. L(N^NuH*o &o+rag(rgfpd+feB/ NXO` / NXO`pL(NuH *o&o++fb/ N٠XOJgp`vp+/Hz NOPOJgB+/ NtXO`Pps+f|tB+/ NVXOJgp`,p`& " Wf2p+/HzNOlPOJgeB+/ NXOJgp`Bpi+f0Hz/ NO.NPOJgp`|yB/ NXO`ps+f:pn+f |dB/ NزXOJgp`|seB+/ NؒXO`np+/HzNNPOJg,Hz/ NO.NhPOJgp`>B/ NVXOJgp`, "$ pmHzHz/ / aO`/ N"XOL(NuH./ S| r NtAdJgB r NbAd20 Hf(pf r NFAp` r N6Ad `R`pLNuNVH*n..&MJfp`^  n !F\ R n!Jg<rfB+/ / N=POJg " n ! R n!` L(N^NuNVH*n/ HnNM./NM&@HnNOJfGB/./. NM.NPOJgAg/ / NMxPOHn/ NMlPOJVDHHL(N^NuNVH*nz|HxHn,/ NO .pgNJg/abXO)@F\Jfp`DHn,/ NM  n!F\ R n ! Bp`/ HnlNLHx HnlNL @GHx / NLR.Hn-@NL.HnNLp n.Hn,NL|./. Hn,ajO,Jg  n Jg n p/@rh fHxaXO n"/!  n p0( S@gU@gU@g @gU@fF  n /0/ NKHn/ aj R n ! B/0NO @K`\  n "n/ /aPOBF\`:Jg B n /0NPO @Kz  n "n/ /Hna\O Jg  nJg"Pri g"n // atPO`  n p(g r "nӱHnl/ NK&@  n ./ NJ R n !B/ N$O @Kz`t L(N^NuH!*o&o~ Jgpl"$+('(R`L(NuNVH&nKJgpf/. / NJhPO*@`/. / NJVHn/.NJJL(N^NuNpa/ KF*A*+H+H+H A+HA*+HAY)HJpAX)HJt*_Nupa/ KF*A|*+H+H+H Ah+HA+H*_Nu/ KF*AP*+H+H+H A+HA>+H*_Nu/ KF*A$*+H+H+H A+HA+H*_NuN xpa/ KF*A0*A+HA+HA+H A+HAV+H*_NuNVH*n&n ..)nF`JF`fp`H/ / NIPO lF`<( p@gp@fp`&Hx / NHvPOJg // aHPO` // aPOL(N^Nuablesesxeszesallydgeestmore ermost NV,H*n.. lF`:( H r g ]gUgUfp`/Hn,/ NO ,pgJfp`Hn,/ NH*p`pfLHxHn,/ NO Jo6HxHn/ NDzO Jo Hn,/ NG*@/Hn/ NGp`B.p f2Hx / NGV&@A.HnNGO p&M-KA-H`.pf$B.Hx / NGRPO @GB+-M-K`p`&// a*POJg/././ / aO`pL(N^NuNVH*n.. / HnNGPO lF`-P:( p@gp@fHx/ HnNƮO ,Jop` H// HnNƎO ,pg `p@fHx/ HnNhO ,Jo*p`p@fHx/ HnNDO ,Jop`p@f`HxHnHnNO ,JoFBHnN&@HxHnrHnNO,Jo/Hnr/ NF(POHn/ NFp`2Hn/ NF B/ NDO &@ lF`0( @ d@0;N,HH// / aO Jfp`/./ / aTO Jfp`p @gp @f/./ / a O Jfvp`/./ / aO Jf\p`v/./ / a0O JfDp`^Hz/ / azO Jg/ NCXOrdp`8// / a:O Jfp`"p`HxHn2/ NĮO ,Jfp`pL(N^NuNVH*n&n ..p+remN lD@0;N6R6666P666t6x66*sB+/ NXOJgp`|ie`sB+/ N͚XOJgp`e`pi+f(ps+f |eB/ NhXOJgp`pi@pu+f.pf(|iB+/ N8XOJgp`v|u|sHz/ NC.NPOJgp`Ne`:+rigrefJrfD@HzHnNCHnHnNCt|i|c KUHHnHn// aH, `esB/ N̒XOJfB`p`|s|xp@@HnHn/ / a, `HzP/ NB.NDPOJgp`e`npf+gdsB/ NXOJgp`XUKve`>pe+fps+fp`4sB+/ NXOJgp`pf+f|v/ N˼XOJgp`p`p f8p+rarAf"e|sB+/ NzXOJgp`|eps@@p@@HnHn/ / a, `pa+fnpm+ff|e/ NXOJgp`\|a`Hpu+f@rf:@|m|s|ap@@ KUHHnHn// ah, ` sB/ NʸL(N^NuNVH*n&n p+rcgvUgJ_g:r f|i/./ NA.NlPOJgp`|y/ NT`pl+flSK`hpl+f`pb+fX|yB/ N&XOJgDp`P/./ N@.N POJgp`6+rigrafHz/ N@.N`p`/./ N@|.NL(N^NuNVH*n&n p lF`h f:/./ N@F.NɖPOJgp` py+f|i/ Nv`p`p+ragUg"UgVWgSgWg@WgYgjUgYfx|i/./ N?.NPOJgp`|y`np lF`h fvpi+fJUK/ HnN?./N?~|y.HnN?lHnHn/ / aPO Jgp`$TK`$py+f/./ N?8.NȈPOJgp`SK/./ N?.NjPOJgp`e`/./ N>.NFPOJgp`+ragrif k/./ N>.NPOJgp`SK`r/.HnN>POk/.HnN>HnHn/ / ar. `L/./ N>n.NǾPOJgp`2RK/./ N>N.NǞPOJgp`SK/./ N>2.NǂL(N^NuNVH*n&n /./ N>.NXPOJgp`.B KWHHzN/N-POJf KSH/./N=.N$`pL(N^NuNVH*n&n /.HnN=PO|i++f/./ N=.N`hp+rbm0 l&@0;NVZVVVVVVV.|i/./ N=.NlPOJgp`|y`A/./N<.N>POJgp`Hn/ N<.N"POJgp`|s/ N XOJgp`|d/./ N<.N`xA/./N<|.NPOJgp`Tpi+f.ps@AHn/NHzHnN:2O`HzHnN: HzHnN:Op+regP_gr f|iHn/ N9.N6POJg/./ N9.N POJgp`$|y`SKHn/ N9.NPOJg/./ N9.NPOJgp`e`Hn/ N9n.N¾POJgv/.HnN9V|l.HnN9DHnHn/ / a(OJg@p`RKHn/ N9.NfPOJg/./ N9.NPPOJgp`TSKBHn/ N8.N2POJg/./ N8.NPOJgp` BBHnN{./N8Hn/ N8pL(xN^NuNV0HK0&n -M~Jgr/grf~B`RK`/./ N8T*@ ./ N8D*@HxHn/.NOJfp`0Jg  n f-K`-K-K `Hn0/.N7pL($N^NuNVH*n ..Hn/N'./ N7O &@) p n,SHmmHzR/ N7PO` A/0/ N7POL(N^Nuadjadvconjinterjnprppronvbunknown part of speech NVpN^NuNVH*n ..Hn/N&./ N7O &@) p n,SHmmHzV/ N6PO` A/0/ N6POL(N^NuAdjAdvKonjInterjSubstPrpPronVbunknown part of speech NVpN^NuNVH*n ..Hn/N&./ N6DO &@) p n,SHm4mHzL/ N6PO` A/0/ N5POL(N^Nubn.bw.vw.tw.zn.vz.vnw.ww.unknown part of speech NVpN^NuNVH*n ..Hn/N%H./ N5O &@) p n,SHmpmHzX/ N5VPO` A8/0/ N5@POL(N^Nuadj/advkonjinterjsubstpreppronverbunknown part of speech NVpN^NuNVH*n..Hn/N$./. N4O &@) p n*S|-HJf.// aPO&@ " pl `/./ N4n` nB/-HNwfPO @Cx-I  d`@0;NBBTTTTTT,,pg pgp`p(`(pg p gp`p(`p gp fx`xJf// a^PO&@ " pl `pf8p gp f,/,/ N3&@Hz/ N3&@./ N3O&@` A/0/ N3l&@./ N# O JfpgpgHz/ N3>&@./ N32O &@`n A/0/ N3PO&@ " pl `Hzf/ N2&@./ N2&@HzR/ N2&@ At./ N2O&@)p : /./ N2&@L(N^Nuadjectiveadverbconjunctioninterjectionnounprepositionpronounverbpast/past participlepastpast participlepluralcomparativesuperlativepresent 3rd person sing.present participleplural or second person singularfirst person singular of of , (unknown part of speech H*o ./Jk,mHz/ N1XPO` At/0/ N1BPOL NuNVH?*n.. ,.0-J@oT "&u fp`0+ S@g2U@g.U@g*U@g&Y@g"U@gQ@gU@gU@gU@gU@g U@gp`PxP؄ȭH < HHJoB2--bg6"$& u8"f2+ tBgSAfp`Jgp`+ gp0< kJ@gdJgJfZJg r $ӵ(` Hx/@$NZXO"/ + Ѐ"$ u("; " u0(H"-H€gp`L " u0( @ g]@gU@gU@fz`z` z`z`p`p"-H€WDHHL(N^NuNVH*n&n ..pm`gp` _g*YfL-Jg Sph gp`pHxNhXO-@`*-Kg Sph gp`JHxNBXO-@`p`6 n0( H/Hn/.NO JoAeHn/a, `pL(N^NuNVH*n&n Jg0rgr/fB/. / N6POJfp`"A-H RK`/. / NJWDHH L(N^NuNVH..,. *nz ЀR25Hl `pl Ѐ25HmR`pgfS" n&pp fpk fHxN"XO&@`. *n / HxHnN.O RfHxCHxN,Tp`RSGHxN'XO&@ gp0/ // N/O RfHxCHxN,.N(p`p0'@p.'@ L(N^Nu/ *o g/N'.N'XO*_NuNVH*n&n -n~ KRKb n-H`p n.r΁ Sm l@0;Nz >hp nC-H nB"npA-I`p-A0gpR`pr n@B-n`jS nB-n`X nB-n`Fp-A0gpK`pk n@B-n` nB(-n` nB-n nRf L(N^NuNVH*n&n../ / N'B/ NjO &@ Sm l@0;NZV 2NvSKp+A0gpFF`pvFR `HSKpA0gpE`pe`,RK`$SK` SKpA0gpC`pc`-/. / N&hL(N^NuNVH.. ,.poHxCHxlN)p`"B/.N'PO&@ fHxCHxN)vp` / /N(hPORfHxCHxN)P.N'p`/ HxHnN+O RfHxCHxN)".N'p`.rHf .rYg/ N'dHxCHxbN(p`x.]g/ N'DHxCHxaN(p`XJo" .g/ N'HxCHxgN(p`2/ Hx HnN&PO RfHxCHxN(.N&p`Hx8N#XO*@ fHxCHxN(Z.N&p`+Kn6n7;n;n;n&;n,A8/ Hx/N*dO RgA8/ Hx/N*JO RgAp0-/ //N*\O RgdAp0-r2-Ё/ //N*O Rg@A"p0-&/ //N*O Rg$A(p0-&r2-,Ё/ //N*LO Rf/ aHxCHxN'\p`Jng"p0./ /NPO+@.f/ ap`B.Jng,p0.r2./ //ahO +@2f/ ap`B2Jg +n +F`lp0.r2-/ ////-aO+@f / aNp`>p0.r2-&/ ////-"aO+@f / ap`/ N$XOB L(N^Nu/ *oJg(/-N<.N$XOJgHxCHxN&-E/.HxHnN'tO Rf"HxCHxN%RG(| .N p`Fp n0* " 0C-H-I MRM"n-IJgl`RG( .L(N^NuNVH>. ,. R/N XO-@Jgr2/./HnN'FO RfHxCHxN$\.N Pp`&&n*nSm*B/ NcPO @G`B .L(N^Nu/ *o g/N .N XO*_NuNVH*n&n ~ npg8/ / a.POJg` UgUgSg]gSgUg/ / aPOpf`rpf / / aPO nJ2g/(2/ / aO pfHx'/ NPOJg / / abPO`p g / / aPO// / apO / / a`L(N^NuH*o &o/ arB/ Nb" KWH.aZPOL(NuNVH*n&n / / aPO-@g" R`B/ NblPO" .// a4POJg KSH/aXOJg *nRM`L(N^NuNVH#*n&n |-H-H/ / ajPO-@g"$ .JfZp nrA0pagYg Yg]g]f.Jf|`,Jg /.apXO/.aD K.a\XO`|`|*nRM R-n KSH-H`jL(N^NuNVH*n&n ..B/ / aPO-@gp nrA0pagYgYg ]g]gYf|`| ." *Jf.p g(Jg$pe nf / aXO`Jg /.aXOJf n(f K/aXXO R KSH-H`RL(N^NuH*o &o g fp`Jg JfRMRK`Jg M` L(Nu/ *opYfprxҁ@*_Nu/ *opYfprxҁ@*_NuH*o ./ g pg pgp`bpl-fpe-gp`Npf-rdg rsgp`4prbg$Sg SgUgSgYg[g WgSg]fp`pL NuH*o &o MRMJg KRK/a:XO`L(NuH*o &o MRMJgp_fprxҁ@RK`L(NuNVH*n&n -M-KB/ N_$PO~-@"n Y-H-I gv*n nJgcSMfR` ngN"nbD"nJfSM ""nJ1g&IpYfprxҁ@ .`zJg( n&H n*H/ aAC./aPOL(N^NuH*o &oHx-/ NPOJfp`(Jg"r-f / aXO` Jg/ aXORK`pL(NuNVH-lF,F&nAF"lFeKFlFFJgp`e~|`,~ n"lFl"lFh~-Hp`l `B*lF Jgp`d~|`&~ n"lFl"lFh~-Hp`lB @Fp΀SAF"H)IF *HfRMRKJf)nFFFp`*c)nFFFp` n*Hd&M`pL(N^NupaNV0H*n&nA8)HFhA8)HFl)k Fd)kFvk6Fpk7Fq)kFp)@FrB,FzpHn/ /a8A.U.B/. N\ T.BHnpN\t.Hn0HnarO$,Jg k)HF)kF lFp0+)HFJ fRG$ k"kp0)HF/Hn0HnpHnBaO*J fRG(Jfp` k")HF)k(F lFp0+,)HFJ fRG$ k"k"p0)HF/Hn0HnpHnHxaO*J fRG(Jfp` S/ //. HnpHn/ apL(N^NuNVH#4. n"H@&I`-H*n nf `B `0|"n pE2h-I JgCh-H` n`-H Jg*r'g>]f,Fz@Fz ." rm` ."$ tm @B`pgBpgRJWDHHRMJgpf lG ngz////. lGNp`pL(N^NuNVH.. ,.*npoHxEHxlNp` Jj fKB/.N PO-@JfHxEHxNp`/./NPORfHxEHxN.N*p`/.Hx/ N O RgA/.Hx/NNO RfHxEHxN.Np`d-rcrc/.NHxEHxbNNp`:Jk$p-g/.NHxEHxgN&p`JgHxEHxaN.Npp`HxNXO&@ fHxEHxN.NFp`0- 7@7mAp0-/.//N O Rgp/./ / aO Rg\Ap0- R/.//NO RgJgtS`tBxpvAX0A8JGNgp,// lGNNPOL NuH#./,/pf~,GLJ,xg p,xS`p@xr$A8p,x"AXJGNg // lGNNPOLNu/./p,xЇrrA80 .Nu/./p,xЇrrAX0 .Nu/ *o)MGN*_NuH*o ~pn A|/0/ aPOJg `.R`~pn A/0/ aPOJg `R`pL NuEnglishGermanFrenchSpanishItalianBritishSwedishDanishNorwegianDutchPortugueseBrazilianCanadian-FrenchSwiss-GermanNynorskFinnishenggrmfrnspnitlbrtswddannrwdutprtbrzcfrsgrnynfinH8*o&oJgBrAetZb vx ք`t&erZb rt ҂`rfRMRK`JfJgp`pL(NuH*o./&o/ // N"O gp`pL(NuNVH*n.. Ѐ/NXO&@* fp`"/.// NO Rf B/ N8p`pL(N^NuNVH*n.. /NXO&@* fp`"/.// NNO Rf B/ Np`pL(N^NuNVH7 Jm, ,JhrgrfHKJJg@-f2-f*p lJ"Hfp-frhgRM`Hx BHnN<Hx BHnN<O lJ ~BJ|#J6xg SlB,K`6xS6xpJ@g(S@gS@g,@ gS@g ` lJdBxSlB,K`FJg"lJ iCJ/ NXO,Jg ІJgSHxBHlG|N;dO "t‚trAG|0&AG| lJd` lJdB"lJ iCJ/ NXOJf x`)GJp6xr"S/ar"xHlG|a&POJg R/HlG|a4PO lJdJ6xgp`p`P)GJ"lJ i CJHlG|/ NHlG|aO Jg R/HlG|aPO lJdJ6xgp`pR,G|gr#`rx,G|@G||p lHlG|atXOJgRB6x "t‚trAG|0‚JgFrAG|0&ƂAG| ,JhrgrfTAJ0xAJ0xfBpAJ0x lJ"Hf*pCJ1xf phAJ0xf p#xx#xR`p L(N^NuNVH;*nGKB~|Jg g `,KSg ,KUgp`|JKgp`r ,U*nTM ,JІ.SSm ,JhrgrfpfSRM` "t‚t&rAG|0(AG|Jf p,K)@Gx L(N^NuHKI~/ N] XO&@Jg / N\FXO`~K fJgp` <@L(NuNVH4"lJ iCJJ/ NXOJgp`,,JAJ*HzSm lJdJgAJ$lJ"j/// -HNO Jgp` *&n lJdpf,p Jhf.SJo lJd"Hpfp`^JfS`.SJkB lJdJg4CJ*IrgYf " f/ /.NPOfp`&MS`*n`4pL,N^NuH*o|~pl pR` L NuH?*o ./$Jorp nl,Jo, Mp/// NY MC.B/ N5TOp΀Jg4zp,Sm(prFt5h&Ɓ(rh*`L NuH*o&o~pl RRMRK`L(NuHxN2`XORfp`Jp)@JhA8)HJlA4)HJp)HJtC]p)IJx)HJ|)HJ)HJ)HJ)HJ)IJ)IJ)HJ)HJpNuH*o ,Jfp`H~f lJgp`.pJWgp` ~Jgf lJgp`pL NuNVH/*nGKBp)@J-@gSMpSKr$ `RgSMpSKr`8~| Ѐ lJ"Hzg: Ѐx lJ"Hg Cxg `p)@J-@`f lJgp-@pJUf~|Jgg`~| Ѐ lJ"HzgNpf~- Ѐ"Hz Ѐx lJ"Hg Cxf.p,.)@J-@`Jff lJgp-@JggpJg VDHH` L(N^Nu/ *ops-gfpc-fph-gp`p*_NugnumutnoittfahcstiehtiektumrattdnednmednnednrednsednabanaufausdurcheinerherhinnachumuntervorzuzurckzusammenberarmutsH3*o~pam rzn`(r~Ff~`tBԂf~`vJփf~`p`^,~pam rzn`4p~Ff~`(pBЀf~`pJЀf~`pFf~`p` A"0p€ L NuNVH=HxBHnN0O A*-H n&X"K-H gR neH*H~Jf4 MJ "$văv(t6*Jf)CGxpg`HxHn/. NTL(N^Nu/ *oHz/ N_BPOJgp//Hl/ N.OJjp`p*_Nu/ *op//Hl/ N.OJZDHH *_Nu/ *oB/ HlN>O RWDHH *_NuH*o&o./BJg@/ a\XOJg45xB5xHz/ N^POJg/ anXOJfxp` x`pL(NuHp",J*.)@Ijl AHJ0g/,J/a:POJf ЇAHJ0g/BaPOJf ЇAHJ0g/,J/aPOJf AHJ0g/BaPOJfR`z|lt AHJ0g*.RJl AHJ0xg //aPOJf@R` ІAHJ0g*.RJl AHJ0xg І//adPOJfR`R`LNusJM`gp,Mh&AMz daa2aaNuNVH?*n.. &n,.*.Hx/ HnNRxO "t‚v(r6& A rp$lP "t‚tr6‚g4AJ$// NPOm Ї"tt&p6g `R`pL(N^NuH./,/*RInd AH  rrpgpAH0Xf*`AJ$ "CH$/B/ //aOJgp`*`pLNuH/./,/*RIl AG""t‚tr‚Jg"lJ i CH$/ ///NO(Jg^, AH$"H Hx// NP AH$  rrp$ AHXr./aHOR`NLNuH/./,/*SJo AG  rrpg"lJ i CH/ ///NO(Jgv, AH"H Hx// NPO AH  rrp$ ,IذgAIICIIxX AHXr//a.POS`6LNuH#HlJ$NXO)@I.SmbAIIxAHB0x AH$HxB/N+AHB0x AHHxB/N* AGHxB/N*O$` ,IAHHxB/N*O lICH B1 lICII .,IS)GJSJm8SNVJf\"lJ iCJ$/ NXOJgHxN AGHxHlG|/NN"lJ i CJ$HlG|/ N AGHlG|/NO AG ,I"rrpgN"lJ iCJ$/ NXOJg* AG ,I"rrFp$ā` ,GxAIIxpm "lJ iCJ$/ NXO, Jg AG І"rrp$`HxBaP|HHx/,IaO lICH LNuH.,ISmBAHJ0xgAHJ0xg//azPOJfpAII0x//Hzh/aOJg~ ,Iؾl,Rl>AHJ0xg4AHJ0hg*//a$POJfpAII0h//Hz/aAHJ0xg4AHJ0hg*//aPOJfpAII0h//Hz/aOR`dLNuH./,///aPOJgp`h rlp`Z ,IjЀAIn*HUMAInepfp-fp`, ,IjЀRIjAIn*H  @ Ij\DHHL NuNVHxIjl Ѐ|AIn0zAIn0AJ$/HlJNB AJB0Hx`HlMzHnNK-lM`NZp)@M\NUjNV .,M`NZjOKMzSm4A ,Iذfp-` pCII1X////aO&`..Kp)@M\SmAp-///NSO &`R` L N^NuNVH?*n&n ..,.x*l6g*g& "t‚t&r n0ƒJg/RXR`B L(N^NuNVH/..*n ,.Jf8pAH0xfzAH0hpgpgpgK`If"lJ i/ NXOJgp`f/ N* AH$.B/// axOJf" AH/,I//// aVOJgp`"lJ i/ N*"lJ QpCH1x./NPOJg"lJ QpCH1h//NPOJfp`HlJ$HnNPOA"H&I ,JhrgrfJg++ffSK/ /NPO&@ ,Jhrgrf Ac++f AJ$0hfSKAJ$// NPOA*p mp`*)lJM4//,I/HlJ$NNO(Mdbp`zGJg. AH$//BHlJ$HnaڀBHnN$.O&@Jg8Jg& ,Jhrgrf++ffSK/R/ / NPO&@ ,IذgRJg,",Jhtgtf++f AJ$0hfSK/ AH//,I/HlJ$/ aOڀplp`(B/ N#POAr mp`/.//NOpL(N^NuNVH~B/.N#B*@/BB/. N#.O *@/B n"n fJgRR ` nr/g "n fg*H"n M-H -I*nRM&n r/gfRMg~`RK` gJp/f2 n&H-Hdp/fRK n-H`/ /.NlPO`T-MA~-H `BB/.N"V @*@SMBB/. N"BO @*@SMBJf nJf n Jfp`pL(N^NuH*o./pM\fJKfrgfp`p`2GMz|M`l$p+fA// apPOJg&R`pL(NuH./,/*/ *o$ Rfpfr`" `AJ$ /B/ //N0OJgp`^xAJ$0xAJ$B0xpf AJ$/NXOJf AJ$xp`&AJ$/NXOJgp`p* AJ$x L NuH./,/*/ *o$ Sfpfr`" `AJ$ /,I// //NxOJgp`dxAJ$0hAJ$B0hAJ$/NXOJgpgpf AJ$hp`&AJ$/NXOJgp`p* AJ$h L NuH./ ,/pf rfp`2pfgrfp`pfpgpg pgp`pLNu/ *o/ NfXOJgp`/ NXOJgp`p*_NuA8)HJlA )HJp)HJtC)IJxC)IJ|,Gg C")IJ`)HJ)HJC\)IJ)HJCGT)IJBJ)HJ)HJA )HGTA)HGXA6)HG\A)HG`AB)HGdAL)HGhA<)HGlA)HGpA)HGtNuHxNXORfp` p)@Jha>pNuHxNlXORfp` p)@JhapNu/./Jg ,G"A` ,G@")AG.NuH*o ~HlG,HlJ/,JNO Rg lJp"lG,// NPOJf L NuH!*o./r"fRMpfrtyA0fJ-g@rthA0fA/HlNPORVDHH `p lJpr L NuNVHAIz|Hx-/-HNڂPO*@ M gA/HlNPORf "AI䒈AJ&H KSKp-rtA0fp--f|UMUKpBHx-/.NPOJf2p' n(fh,J@JprA0plm2 l*A2;N,J@J`p,J@@JzT`^p' n(fR,J@JprqC1f"p(ruA0f,J"AJ`p,J@@JzV/.NAXOp-SMrA0Jg ragrefJfrdgrtg rAzJgr`"< `-p@z|R/.NB.XO*@ nJgNHx'/NrPO&@ g(Hz>/ /.NAO A-Hr"fR nJg/NAXO`zA-H fJfpf < ` <@`pL(N^NuHHx'HlJNPO*@ gbBHlG,HlJ/,JN،O Rgp'`B'Jg:r"fRMJg,p lG,)@M\BHlJHlM8N.HlJNO L NuH*o ./pg pgp` lJ/,M\/ NPOL NupaHxNJ(f8Hz0// N>O "AI䒈CJ "AJ`/ N>tXO`~K fnJg n.Jgp`pf < ` <@L(N^NuHxNPXORfp`Jp)@JhA8)HJlA)HJp)HJtC)IJx)HJ|)HJ)HJ)HJ)HJ)IJ)IJ)HJ)HJpNuH*o,Igp`|,If|~g lJ"Hgp`VJg lJgp`BpIWg|~Jg,g lJ"Hgp`Jg lJgp`pL NulmnrNVH?4*nGKBp)@Jr-@-AgSMtSKv `gSMpSKt`,Ifp-@~| Ѐ lJ"Hzg` Ѐxg lJ"Hg,C$Iz`Jg lJ"Hg Cxg ` )AJ-A`Jgf lJg-ApIWgB~| Ѐ lJ"Hzgvpf~- Ѐ"Hz Ѐxg lJ"Hg,C$Iz`Jg lJ"Hg Cxf4p,.)@J-@`$JgJff lJgp-@JggBJg VDHH` L,N^NuH *o p- lJfr/HzNFPOJg pe-fp`@rsfp`4regp`(tnfp`prgp`-f -fp`pL NuH*o~pam rzn`p`j,~pam rzn`@p~Ff~`4pAЀf~`(p|Ff~`pEЀf~`pJЀf~`p` A"0p€ L NuNuNVH..,. *.*n(pmF"lJ iCJ$/ NXO-@gpgpf .rgYfpfr`" `(pmAJ$/B/ //N OJgp`pL N^NuNVH..,. *.*n ,Iذfp`z(pmF"lJ iCJ$/ NXO-@gpgpf .rgYfpfr`" `*pmAJ$/,I// //NzOJgp`pL N^NuH./ ,/pf rfp`pfgpfp`pLNuNVpN^NuHx NXORfp`p )@JhA8)HJlA`)HJpA)HJtA)HJxAֈ)HJ|,Gg A)HJ`A^)HJAV)HJC)IJ)HJCGT)IJBJ)HJ)HJC8)IGTC^)IGX)HG\C)IG`Cv)IGdCL)IGh)HGlA)HGpA)HGtpNu/./Jg ,G"A` ,G@")AG.NuHxNXORfp`Jp)@JhA8)HJlA)HJp)HJtCf)IJx)HJ|)HJ)HJ)HJ)HJ)IJ)IJ)HJ)HJpNupaNVH.. ,.B/.N,PO*@ fHxFHxNp`B/ /NPORfHxFHxN.NPp`/ HxHnN&O RfHxFHxN.N"p`.rPf .rHgHxFHxbNє.Np`.SgHxFHxaNt.Np`Jo" .gFHxFHxgNN.Nϰp`|J.g .rcHxFHxgN&.Nψp`T~.AIxJ0xgAIxR0xp`6HxDN̄XO&@ fHxFHxN.NBp`&/ aXORf/ N(.N̶p`AIxR0x/ HxHnNXO RfHxFHxNЊ.N.ap`p0.'@r2.'Ap0.'@ p0.'@p0.'@p0.'@,p0.'@0(+ /N˴XO'@fHxFHxN.Nr.aHp`8p0./ //+NO RfHxFHxN.N:.ap`z k-Pl nRJf  k R`Ap0./ //N\O RfHxFHxNr.N.ap`A p0./ //N"O RfHxFHxN8.N͚.app``A$p0./ //NO RfHxFHxN.N`.a6p`&A(p0./ //NѮO RfHxFHxN.N&.ap`A4p0./ //NtO RfHxFHxNΊ.N.ap`A8p0./ //N:O RfHxFHxNP.N̲.ap`xA|"lJ$I-Hf"~A0hg ` pA0h, `ZBGJg6pZg.z*K~|JgL rX,rF́ lJ~Jg0ކJl( lJpg` lJpg " *(`JfrYg np -HRK`z lJxp l@tYfSRK n"t҂-HrfDtZg<  RK-H`* lJĐ *HpgJ Ad.SmrYfRK`pZg n-H n-H` nRfS` n-HQf* n -H nR"n-IJg` nBL,N^NuH*o&o|*,JSl, ІR.  lJ// N8POJk,`*S` ",JN(",JЁ ",JN( ,JЁBL(NuNVH*n ,JhSgXSgTYgPQgLG~ Jg*Qg&SgUg|A0x RM`RM` RM`BHnHna@POK|G~ JgLpgFp g*~pmpnpm"png,g ,Jhrgrf. `B/. HnaL(N^NuNVH# n"lJ ,JЀ&I-H-H nJg^"lJ*I-Hf ,J n-H`(f -f lJ "$ n-H`TM`pf/./.N\` nBL(N^NuNV`H*n&n ..Hn`/ aPOJf/ Hn`a\PO` ,J@Hn`a&AHn`/NL(TN^NuNVH7JgJ fHxFHxkN,p`: nJfHxFHxhNp` @oHxFHxkNp`/.N^XOeHxFHxiNp`z*nG~Jg|B ,Jhr fTrigrIfHrjA0hfA0xgrdҁ`r6FtA0xvA0h-Aشgz`rfpA0x-@rAf teff rGҁ-A`VrGҁfNz`JrOf teff rfF-A`0rfFf(z`$rUfpeff pMЀ-@` pMЀfzJg RM .` `BprK-@-@-A-A-A~JgRpfHxFHxjNvp` lJf zp-@`A0xgRA0xgp-@.gp.fr-AJgt-B`p.gB`vJgpp-@`fUMJgJg r.fz`Jgzp.fJg JgE`4p nA0g .rf`Jf`Kp~A0Jg AIJfHxFHxfN–POp` HxDAI/0HlJN&O p.Nu/ *oHx HlJ$/ NO )@I)@JRfp)@I`8HlJ$HlJNAJ)@I)@J.HlINHx BHlJNOp*_Nu/ *oHx HlJ/ NO )@JRfp)@J`HlJNLXO)@Jp*_NuNVH..,.B/.N^PO-n z-@ n*P gH&nJgc SKfRM`g&b Jf ." *Jf `X` L(N^NuNVH*n&n Hx Hn/ NO Rfp`&HxHnNJPO&@ gBBHn/ N. L(N^NupNu ,JhNuNVH.. aWfr rSg2*n|Jg&A0hgpA0hgp@Ѐf:RM`&nJg.*S|Jg A0hgp@ЀgAhRM`XK`L(N^NuNԬNDpaNVH-lK: n.($-h-h-h(-hpЬJ-h:*lKAKB-@-HB .AKB n&H| nz-H̺gpFg`Jg|`Jf/ Np`vnnS| n-HJfp`Vzl. ",J .䰆f p-HԻbHz M-H`>p n0h  n&pbz-M MRMfSM` KRKJgRM`Jf\| n-HJgJl&RMpfp n-HrFgRM`S`¼l`pFlTM`TMR`| n-HJgbJl* pf| n-HpFg `S`l`*pFl Ѐ n&H`  n-H`SJg`FpL(N^NuNVH*n.. Hx>NXO&@ fHxJHxNp`B/ NPO'@,fHxJHxN.aA0+ HЀ/+,//NO RgA0+H/+,//NO RfHxJHxN.a$p`A0+H///+aO -@JgA 0+ H///.aO Jf / ap`t 2+HЁ2+ HҁЁ2+HЁ@"<NR'@2pЬJ'@$2+HҀ'A(|0 +$ +$們 +(Ѐ L(N^NuNVH*n.. /NhXO&@ fHxJHxNp` n Sm & MRMJg` L(N^Nu/ *oJ-0g -(Ѐѭ -$ѭ -$ѭJ,g/-,NN.,NXO/-NR. NJ.NB.N:.N2.N,XO*_Nu/ *lK: ,K>Э2Hx"/-,/NO +@6fp`p*_NuH*o UMGKBKprFgB`>UMprFgTMBg p)@K` MRMJfp,KJfL(NuH*o&o~|JggpFf ` ` L(NuH*o lK:&h |0( H.Sl& ІR* /3/ aPOJk,`.S`)GK>L(NuNVH-lK:*lK n&h:~JgXJl pf~pFg `SK` n(l`&pFl Ѐ"n i` `B)MK KSH"n#H:/ aL(N^NuNVH*n&n B n0HJhgHxJHxgNB`:/ NXOr@eHxJHxiN&`)nK:/ aXOJg HlK/ NPOL(N^NuNVH*lK:0-Hr/Hn/.N2Hnax ,K> m &P.Hna*OJf/ HlKBNH.ap`anJfp` m6C~-H-H-IplV nJgNp2-HҀӮ+n:CKB)IK-Ha:HlKBHnN&PO,Jfp`Jk -nR`+n:JgAKB)HKa`/ HlKBNPO)@KHnNXOJgp`R lJt/.NXOJg@nnB.Hna6XOJg" lJpHnNXO.Jfp`JkaJfpL(pN^NuNVH*lK:/.aaDXOJfp` m6&HC~-H-IplBJg>p2-HҀӮ+n:AKB)HKaHlKB/.N%POJo -nR`+n:Jf$ ,K> m /HlKBN)@K.aPO` AKB)HKaHlKB/.N%TPOJo aJfp`pL(N^NuH*lK:&m:~Jfab`X$l ",JKpЁf4pK`( mp lK "m//NPO)@K+K:a*pL(Nu/ *lK:RK>0- H",K>laJfp`. m6^H+H: ,K> m /HlKBN)@K.aPOp*_NuNVH.. ,.Jkpop`pB/.NPO-@JfHxJHxNp`J /./NPOJgHxJHxNl.Np`/.Hx/.NO RfHxJHxN:.Np`Jf/.Np`z&n*KxJg  m/.NZp`  d@0;NTTn r gWgrgr g `/.Np``J+gFpf@"`:pf"` R`& r gWg`BR` ` /.Np`RM`DHxJHxmNHpL(N^NuH./,/*lK:Jgp`p"Ҁ//-/NO +@ Jfr-AAp`, m C/ aXO@ m XH+HAK)HK)@L$pL NuNVH-lK: n*h)ML( L$mp)@L `L/ aXOr- lK&HVM-M)@L KRKf KSH)HK "fRM n!MpL(N^Nua|Jg JL gp`:JK>g"lK: i /aXO)@K> fp`Hx /,K>aPOJfpNu/ *o)MK:-gHxKHxdNPOp` ,Jh-gHxKHxgNPOp`p*_Nu lK:(gHxKHxcNPOp` p lK:!@pNu"lK: i C/ ahXONuH*o&o~Jgpm|JgpmfJf L(NuNVH.. nJfHxKHxhNp`/.NnXOr@eHxKHxiNp`Jg"*nGKJgpYgRM`BKK`*nB/. / NO Jg*n TMGK nJg^pYf "WRK`Dpf/ / N n THHlK/Np`>pЀ"lJp fpJgRMR`B n THHlK/NPOpL(N^NuNVH*n.. &n H// aPOJf|`/ /.N,.NBPO, @VM-K MRMf fB L(N^NuH*o &M KRKgp+YfSK`L(NuNVH*n.. Hx\NXO&@ fHxKHxNDp`)KK:xgHx/ N,PO'@fHxKHxN.abp`RHxBaPOJf / aFp`6 ,Jh@pr'A k  k "HRI ,Jh ,J@@B. k XHHnBB/a * k C @H./ a O(<`nfHx/ NjPO'@f,B/ NZPO'@fHxKHxN<.ap`/+NZXO,JjHxKHxN.adp`T "<N J'@Jg8 +SHx /aPOJf / a,p` k /a XOJfS`Hx BarPOJf / ap` k  k "HRI@fg` p k Prg[gHxKHxaNT.ap` ,Jh+gHxKHxgN0.ap`tpffp k  k RHx @@p'@JgaJgHlK/ aPO,JkJfp`pL NuNVhH..*n/ aRXOJfp`Jg( ,J@@B.HxHnaaJf p+@p`+lK> - +@AHlK/N4PO ,L n r&nAK-@-H nJgp"Hҁ"lJ|-H QgO Rfp`Jg QfSKBRK-KRK n Jg6Hx / /NO .pggQf nRH/ /NPOHnaFXOJg"Hx0/,K>aPOJfp`>B/,L(a PO n Jfp`& n| @ /./HnaJ, L(N^NuNVH*n&n /.aXOJfp`Hx Hn/ N>O .pgdgHxHnNPO @BHnaXOJg ,L `pL(N^NuH*o &oJggp-r+`pYL(NuNVH*nBHn/ aO Jg0HnaXOJg"HnHlKBaPO.Jfp`Jja8JfpL N^NuNVH.. *ng`g /.aXO/ a^XOJgaJfp`HxHn`/.aO Jfp`p-@r-A-@ .Hx /6aPOJfp`apJfL <L$rddR`p-@aJgHlKHn`aXPOJk,,L `R .-`B .JkHx0/6aDPOJf Jgp@Ѐ`pr-Ap`aB,K-@HlKHlKBNa|POJf|*`HlKHn`aPO*Jn,,L -lL(JfaJ,,L -m . //- HnN . A&HHn`HlKB// aO&@Jk4HlKHn`// a&@ m L$ ,././ N O A, H/HnaPO n>/Hn/- N zO Jfp`zNJfp-@@z `p-@,<Jj-f,<Jg m /aXO`p*A-HJg/./ aPOJfp`n)|L$A+H A+HAK)HKaHlKHlKBN>POa mc m ",&lL(Hx/--Aa2POJf Jgp`p@Ѐr-Ap`HlKB/,L /-a(././-@NF . ܀ m C H./ a* m H./aNO Jf Jgp`p@Ѐr-Ap`hHlKHn`N\ -R. .Hx0/6adOJf Jgp`p@Ѐr-Ap` A,"m /// -IN| nTH H./al H./.a^NOJfp-@@p`S`zHx0BaPOJg4 -R/B/-N:O JgNJgHxBaPOJfp-@@p`X -SHlKBB//-a"-UHlKHlKB//-@a|&m ",JhAA-@" H./apL(N^NuH*o./|l8 -ІHx/aPOJfp` m B/aFNPOJfp`R`pL NuH*o&Mpr+၀. HL(NuH*o >/ HrF H@L NuNpaH./,/HxN$XO*@ fHxIHxNPOp`Z| /NXO+@f/ N\HxIHxNTO p`, @rdp` ,Jh+Gp+@+@p+@ L Nu/ *o| /-N.NXO*_NuH4*o./&o JgpJhgHxIHxgNPOp`RG$'k A Hl0/ /NO Rgd/ NXO,T +ІcHxIHxeNPORG(p`N l0"H$k  0/// Nzݫ l0RH./NOJg `p@Ѐ l0RG(pL,NuH*o&oJgpJhgHxIHxgNPOp`FRG$'k A Hl0/ /NO Rfp l0r@ҁfr`r.`~RG( L(NuH4*o&oJgpJhgHxIHxgNPOp``RG$'k A Hl0/ /N\O Rg|`4/ N.T l0"H$k  0./ /NRO |RG( L,NuNVH*n ..Jgp+@ -ep`PO&@Jg g lt Pt L(Nu/ *o/ N.aXO*_Nu/ *ltQMAL0e6p-S@gS@gU@gY@g`/NhXO`/NXO`/NJXO`AL0)Ht*_NuNtpa/ *op)@J/ aXO*_NuH*o p)@IBI/ N ,Jh-f.-g&p-fNJgp`HzHHlJ/NO PM`p*_Nu/ KL0td6 ,Jh-f&-gp-f U(f )HK: lJN`PM`*_NuNԔpaNV/ HnHlJNHnNHnHn)@P NACY./)HP )IP$aO)lPP)lPPKL0)@Ptd ,Jh-f-g)UK:NJgp`p-Y@gY@gZ` U(f lJHnNXOJfrHnN XOJgd,KB.fX,KC.fLHlKDaTNXOJf`8HnNXOJg*,KB.f,KC.fHlKDaNXOJfPM`*p*_N^NuNVHGh*n|Jfp`@pf(B,Kg.GhJg&p f+fTKRM` Ѐ lJ` Ah,. ,P rnrm////,P N"OMXeHnHnhaPO* ,PP.pnpm ,PP.pnpm. ,Prnrm//Hn/,P$NO(MdelGh*n| JgYg4`BKh`* Ѐ lJ~ r gUg`RK` `GKJgMdcp/// NO `L(N^NuNVH'*npz,&n )@P)@P~ Jgpgp g ~pmpnRPpmro "RP`f rfSP`",JhtgtfRP"$ԁrPFԁ,`$rgRPg r"ҀpPFҀ,* `RB L(N^Nu/ *o/ N@XOJf BP(p`B,PlpA0g|PlBPnp Jhf4JIf.Hx/ NPOJgp)@Pn`Hx/ NPOJgp)@PnHxHlJ$NpPO*@ gBHlJ$HlJNAJ)@I)@JBM\B,M8 lJNPOp*_NuHlJNXO)@JBM`BP(rl lJ` lJ)HM4l <` <)@MX)@MdNuNVH'pIf pI-@` ,I@-@JPng/,PnHx NPOAJ$HlM8-HNa*_Nu/ *o/ azXOJfAP( ` a$Nab*_Nu/ *o/ aPXOJfAP( ` aN>a8*_NuNH>/8JDj0.J@j=E`$Ff -f0,Z2-@fp`=E`REPM`0.J@j H/HxqaV`Jnfj H/NXOJgD0,ZU@f  l\//N%xPOJ@f"0,Z]@f.  l\//N%hPOJ@g0,]:H"H//a`0.HA[*H:+G;lZpL N^Nu// paepzb  ` .NuNVH'4>. *n HЀAP20 l\-Mp*=@-Hp@l HAT"Hҁ4HJBk n &HAV=P4.nAWT0"A$B =@@=@=A=B @ d@0;N(@jj^^^^| RFnl`| RFnlSK`| RFnl MRMp//H aXO o` n p"n0)&H0.SnJ@o@JgrpFfBn`JBnprFg:0.nl0Jg,Rnpnf MRMp//H aFXO o``JnfRn0.RnnlB`| RFnlSM`g pnf`JnWDHH=@` p@`xAB.CE-H-I-J0.rAg_@f8 n p"n0)&H0.SnJ@o@JgrpFf&n0.rAgr AfzJf(Jng <7<"<u` <~7<"<uH`/ NjXOH0.H//./ N}O gJnWDHH=@` p@`JfJng <` <-@` KCNNg(-@J.gJng <` <-@0.H//./ N}:O g` p@` HxN"XOJng(|nlprFЀ l\P0RFRM`Jng |nlpFrFRFRM`RE`P0." l\=@J(gGHX|=@ HrdRF`J,yg0.H nNN HЀrAXpf(AX&H|*nnlg0.` RF`p`0.L,N^NuNVH7$>. *n z,p@l"Hҁ$HAT"H6=JCkCWT$I=0AVPvf IBP` HЀrvf"Hp2 HЀ26Hp€Yg UgSg`. HAWT HЀYP` HAWT HЀXPRF`< HBHn/ /a* H.Hn/ N{"O|p@l. HAT"Hҁ460JBkAWT0RF` L$N^Nu/>/ JGk0,] @m H/HxaPO`4 HЀAPtJpg H/Hx.aPO` HЀAPt1p.NuNZtNANN paH/0&o 7|<+JFjz0,] k (`(*,  l\$HDn4~k n rn$2(fRG`k o `RF` H/Hx.NPOD@L NuNVH?4>. &n 8+  k$H G*RE j o H/HxmN`4 AQ HЀ0 HЀAP12*AXPAX1AY B0P|=Rj l HAT"H"Hҁ$*j 2CV I0AWT4-0=BB6n=BvCf& l\CT0R@1@`p@g[Bf AY PRF`f0*rAf 4.HYf S@gJng H/HxsNr` p@l HAT HЀ0pL,N^NuH&o >+ H2+ H//N|POJ@g0,]:H"H//NPO`X7| HЀrAPt10+ J@o& HR2+H//N|PO HЀAPvBp0,]:H"H//NPOLNuNVH/>. <.:.BlZp(@oBHxhN` H"H$H///NnO J@g0,]:HB/NR`dx0,] @l8 HЀAPtBprAP1 HAYB RDAQ1`xA[-Hp @l n0RDP`pLN^NuHJ\f p9@]:`|9FZ~0,] @l^ HЀAPtJpgJAPtBp H" l\2(H//N|POJ@gJFf0,]:H"H//NXPO,RG`/,\$NnB\$.\Nn)H\)H\ )H\.\NnB\.\NnXOB\Bl] LNupaNVH#&nBlZ/ N`TXO,JFj D@` k o H/HxkNX`/No,XO.p@@o. H//HnNuAHl/H NnR.Hl//$Nu` H2+ H.Hn/NO J@g0,]:H"H//NX`h0+ J@oAHl/HNnR.Hl//Nt HR2+H.Hn/NO.JGg, H2+ H//N| H"HR./NX`  l\0+ HS2(Hg H/Hx|NXPO`f HЀrAPv1 HЀAPt17F~k l H/ /N`POJ@f&RG`p @l AQ HЀ0p`R HЀ"HҁtAPv1APt17| H2+ H//N| HR2+H./N|0,ZLN^NupaH>/&o  l\Jhg"Kp0(SHxHl_>/ NsxO LNuNVH>. <.:.&np@gp@fB .".g6  l\ph f H/./NQPO` H/./N2vPOSEJEkN AQ HЀ8p@gp HBHlY4/ /N4OJ@gp@f& H/.HlY4/NJ~O J@g9|iZ` HB/.HlY4/N=OJ@g9|iZ` H"H/.HlYtAZT/0/N"H.HlY4/ /=@NO=@ .f"  l\/HlY4HlYtN%O J@gNJng H/.HlY4/NIO J@g9|iZJng" HB/.HlYt/N/&o,/ zp @l AQ HЀ8JDkp HBHlY4/ /NOJ@gP HB/HlY4/N;OJ@g60,]:H"H//N, H"HB// //HxaO0,Z`RE`ppLNuNVH>. &n ,.zp @lZ AQ HЀ8JDk> H"H/.HlYtAZT/0/N"H.HlY4/ /=@NO=@ .f$  l\/HlY4HlYtN#O J@gJngP H/.HlYt/NHO J@g60,]:H"H//N$ H"H.// //Hxa0,Z`Jngp HB/HlY4/N:tOJ@gV0,]:H"H//N HB/.HlYt/N:FOJ@g9|iZ H"H/.// //Hxa*0,Z` RE` D@LN^NuH>/&o,/ zp @l AQ HЀ8JDkn HBHlY4/ /NOJ@gN H/HlY4/NFO J@g60,]:H"H//N H"H.B/ //Hxa~O0,Z` RE`r D@LNupaNVH#>. BlZ H/NXO-@Jf2,]:H$H//NPO`Rp nh g H/Hx0NnPO`4 HAY,0Jf H/HxdNJPO` H//NXPOJlZf `pLN^NuH>/BlZ H"HAY/0/NJzPO,JFg `&0,]:rAfrd9A]:0,]:H"H//NPOpLNuNVH'>. &n <.BlZ H/NXO-@Jf2,]:H$H//N`r @h g"H/Hx0Nl`hd H/HxNT` Hr2//NJ>PO*Jf0,]:H"H//N&` H/ /Nn9|Z H./NXO J@g0,Z` Hr2// //NLOJ@g00,]:H"H//N Hr.// //HxNF0,Z`4 H// /NO J@g0,Z` HAY!AZT!pLN^NuNVH>. H/aXO,Jf0,Z`z HAZT p H///-HNO *JEo0,Z`J H//NJPOJ@g60,]:H"H//N H"HD.B/.//HxNl0,Z`pLN^NuNVH>. &n <.  l\ H/-HaXO-@Jf0,Z` n( g H/Hx6Nf`Hn//NO J@g0,]:H"H//N<`0.H@cr2 .Ҁ\H䲀oHn//.NO J@fp0. ft0.2.@\AHFe^BHnHl\N=nHn/./.NOJ@f H/.Hl\/NBjO J@g H/HxN`*.`2 Hr2//NGdPO*Jf0,]:H"H//NL`*. H/.// /N:O=@J@o0,Z` Hr2// //NIOJ@g80,]:H"H//N H2.HD.// //HxNj0,Z`@ HAY!AZT! .躀g "H//NHP0,]:H"H./N`pLN^NuH/>/&o . ,.&n H/ //N(O J@g0,]:H"H//Nz`NprFf"  l\Jh f H/HxrNL` HAY!AZT!p//N*LN^NuH>/,/&oJf.Jl]:g0,]:H"H//NPO`P H/HxeNPO`> HЀAP:0 H//NPOJ@g0,Z` H"H/ ///aOLNuH'0&o./ $o$/ W@gS@g"S@g.S@g:`F0,ZU@g0,Z]@f69|Z`.0,ZW@f&9|Z`0,ZW@f9|Z`0,ZU@f9|Zp@op9@Z`f|G[p @lB0J@k6JGgrAf l\//+NPO6`BHxpNNPO`RFP`p@g9GZ`9|Zp9@ZLNuNVH#>. &n BlZ H/N XO-@Jf2,]:H$H//N` @Jh g H/Hx0N` H/N#,XO,Jf0,]:H"H//N` H/ /N9|Z H./NO J@g0,Z`z H/ //N%O J@g00,]:H"H//NR Hr.// //HxN0,Z`4 H// /NO J@g0,Z` HAY!AZT!pLN^NuNVH#>. BlZ H/N XO-@Jf2,]:H$H//NPO`L @Jh g H/Hx0NPO`2 HAY,0Jf H/HxdNPO` H//NPOJlZf `pLN^NuH>/&o H/aRXO,Jf0,Z` H/// /N.O*JEo0,Z`f H/ //N#O J@g80,]:H"H//N H"HD.// //HxNlO0,Z` HAY!AZT!pLNuNVH>. H/aXO,Jf0,Z`z HAZT p H///-HNO *JEo0,Z`J H//N!POJ@g60,]:H"H//N2 H"HD.B/.//HxN0,Z`pLN^NuNVH0>/&o$o H"H/ //@N#.///aL N^NuNVH0>/&o$o H"HHlYt/ //@N#.///anL N^NuNVH0>/&o$o H"HHlYt/ //@N(v.///a,L N^NuH0>//&o H/ /Hxa0O LNuH>/&o H/ /Hxa O LNuH70>/""*Rt4**`,@f p0**\`9|0]:0,]:H"H//NRPO`2 H// // aO,p@g p@gp$@fpe9@Z0,ZL NuH>/&o H/ /HxaO LNuH>/&o H/ /HxaO LNuH!>/&oBlZ HAYJf H/HxdNۜPOH`L H"H/AY/0NۚPOJ@g0,ZH`& H"H$H/ AY/0(//aOHLNupaNVH*n>.Bf0,]& @mNNxA@CNf&@ fNS@fA@CNJ&@N>f g 0,]&R@9@]& L(N^NuH*o B- f0,]& @mNA@CN&@ fNS@fA@CN&@- f g 0,]&R@9@]& L(Nu/ *o0-H// NPOJ@g Hx1NXO`$0-H// aPO+@f Hx1NXO`p*_NuNVN^NuNV/ *n p*_N^NuNV/ *n p*_N^NuNV/ *n p*_N^NuNV/ *n p*_N^NuNV/ *n p*_N^NuN=N8N/ 9@]:.Nu/>/ H/HlNqBNl$PO.NuH*o>/ SGJ@o U`L NuH*o>/ M&HSKd SK`L(Nu/ &o0+>+ g9|6]:0,]:H`p&_NuH>/Bl]: H/aNXO&@ fp` +$LNup9@]:NuNVp9@]:N^NuNVH >. <.:.9|a_*+,R߫-k oHx'Np` + n `r2+b '@ `t4S&+ l t4S'B `t4ի +"+ l '@ `x DlA]<@RD` + R"<Ni( SDJ@o(HxHl]/0,] fHx/NXOp`JGkGnHxNXOp`  l\&Hp+@ngQ@g(S@g$U@g`9|]:p`/ aBXO7@ `p0+>$K<*Jkg20+Fb*py+f" k>l+ fJkf -K n<(`&n fp`N0+H2+H//a|POJ@gp`0p7@. RG nh+ gp`0,]2"RA9A]2g1A `|~&l\| RG2,] AlJkg0+Fb k>l,`SFp0"<9A]2~&l\ RG2,] AlJkgk`0,]2"RA9A]2 n1A LN^Nu/ &o0+>J+f|/ aXOJ@g0,]:`p&_NuH&o>/ SGJ@o@S`LNu/ &oHx/ N:AHx/N,AHx/aO&_NuH&oz Hx@/ // BNTOJ@g0,]:`Z/ aXOpk fJ<+<.Fn@p@ڀ" K//// BNOJ@g0,]:`  K/aTXORG`pLNuH&o0+><+<~zFnJ  KHx@/Hl]. <.z9E]:  l\&HJGk0,] Gn 9|]:`&pn+g 9|.]:` @ r AfA@/. /NLBk H./ NO '@Jf 9| ]:`z/ apXOJ@f0+ J@krAo 9| ]:`2,]$$Hr2+o 9|(]:`2,_<4Ag9|+]:`v k@:o9|-]:`f+tcf9|]:`T4+JCo9|]:`:JfS@g JBo9|]:`&$Kxk*>JGo p+u"Hg HxNzXOAhHx//+NPxHx/+NzHx/+ap0*./+// HxNO,J@g0,]:`|npL NuNVH0>. <.p9@]:" l\&HJGk0,] GnHxN`2pn+fHxN`0+>J@oHxN`pv+f*z-K REkO(L NuNVH0&n$n A~-H RGHrd`~ RGHrd n-H`pL N^Nu/ &op0 gr2 g r2 fp` Hx{N(XO&_NuNVH>. ,. &n:.Bl]: H/NXOJgxJf9|]:`l f9|!]:``  l\Hn//a`O J@f@HnaXXOJ@f20.Ec9|]:`"J@f9|]:`r2. g2<9A]:Jl]:gp`0.LN^NuNVH'0&n$n n<(:p(@* J@gS@gLW@gY@gY@fl~ RGFlgSprFStā,JFo `DJFj D@`:p`6. SGJ@o SSgprFtā` HxNXOL N^NuA NuH*o ./ +@r mNJgp#`pL NuH>/*o,/ &o$*/(// aPOJ@g Hx#NNXO`\Jfz:-JGf$ r K"mNSg6p+@Hx$NXO`* r K"mNSgp+@Hx%NXO`ۭpL(NuNV/ *n- f 0,]&S@9@]& mN@*_N^NuH $*o/ pA?NA\ONkJgp79@]:`pL$NuN84N9N7N7npaNVH0&n.0+ l\$H|:+pp9@]=@p+tf,/ a.//. N O J@n>pSf JEfJhf.J+tf:Jkf4 H// a.//. N OJ@o9|]p9@]p`JEfBl]9|]p`rJkfn F(RDp@oP J@jR@@"@9A]H// at.//. N O9@]o 2,],RF`J@f0,]`:,]`EovHxNZXO`jJk gd+gp=@ KC$/ / /. N O 9@]9k"]0,]o<+ RF`"J@fp9@]9|]2+ 9A] `Bl]9F]0,]EnNH// a.//. N O9@]o 9@]9k"]`J@j pEfp`J0,]`D0,]R@9@]`pSfJhf JkgJ+tfp9@]Bl]p`9l]]0+pR@9@]pL N^Nu/ &oB&_NuNVH0..&n Jf HxN*XO$l\-J:*| RF2,]"Al4 f0*kf / a `F0*Ed -J n:(v`/.a0XO$@ fp`/ // aO J@gp` L N^NuH0&o f0$l\&J<*~v RG2,]"Al0*Fd&J<+v`py+f/ NXOJ@gp` L NuH0&o0,]0"RA9A]0g7A`|$l\9|_D~ RG2,]"Al0*l_DdJ@g9@_Dv`Sl_Dp0,_D"<9A]0$l\~ RG2,]"AlJjg0,_Djv`0,]0"RA9A]07AL NuNVH0&n.. $n&7j|n7j:p*r 7@p7@7@7@ / aXO0*>J@o J-H` J-Hp0(//+//BNOJ@g0,]:`AhHx/+/NFAhHx/NAhHx/NOp+u2*>Hg HxNXOp+tf 7j6 7j2 *fB+`$@`7j8 7j4 *f|`@pL N^NuNV/>. Bl]: H/NXO-@Jfp` @Jh f 9|0]:p` n (.N^Nu/ &o +(&_NuH0&o>/Jkfb7G 0+7@+g,HX7@"HSHNV7@ kr2"HE `0 HS2+HNV7@ kr2 ` H// a*POL NuH0&o>++gRG+gRG+g"0+ H"HXSNVZ k"HE `0+ HS"HNV: k L NuNVH&n>.J+f HxNXO H// a @YHx/HnND HxHnN2 .LN^NuNVH0&n>. H// aPO @$@YJ+fHx/ HnNCO J+gHxHnNPO .L N^NuNVH'0>.p@m n0(pHR"Ho HxNRXO n:(,C$-I(gXp(f HY*` HY*0( @f .``&hphrh=@=A0( @or2(4(H҂@`p1@1@1@ JGo n$$H nRh SG0(h(gp1@H// / NBO XX`p1@p=@Jng nRhrtF‚=AJng nRhrtF‚1A"n=A`=@0.Eo HxNXO0.El("@ nh=AH// / NBO 0.0.SnJ@oB`FlHx/ / NAO X n0(HX1@` .L N^NupaH>/Bl]: H/NXO&@ g / NXOJgp`Jk gHx0N>XOp`RR$)k$_>J_>f 9|,]:`)k_HJ_Hfp0+// N2PO)@_HJfZ`lHxHl]LNuH>/,/Bl]: H/NXO&@ g/ NXOJf// aPOJ@g0,]:`Jk g Hx0N XO`tS +)@_Lf9| ]:`T'F|]/,/&oBl]: H/NXO$@ g// aPOJ@g0,]:`$ f Hx!NZXO`p// // /NOL NuH0>/,/&oBl]: H/NXO$@ g(/ NXOJf// aFPOJ@f/ N XOJ@g0,]:`$ f Hx!NXO`B/ // HxNNOL NuH&o ./Jf HxNXO`o HxNXO`pLNuH>/Bl]: H/NXO&@ fp`Jk g 9|0]:p` +LNuNVp9@]:N^NupaH0>/&oBl]: H/NXO$@ fp` HxE/ / aO 5l]%l],)@_PL NuNVH0>. &n Bl]: H/NXO$@ fp`RHxG/ / aDO )@_Tg&5l]%l],0*:H/Hl\T/.N=O `BjB/.N,XO ,_TL N^NuNVH0>. Bl]: H/NXO&@ fp`vJf /. Np`d/ /+NPPO$@ fp`L<+jpl6RF H// Nn2+:H.//. N=7F H./ N` 'jhBk`L N^NuNVH0>. Bl]: H/NXO$@ fp` Jf/. N>p` |(* / /NPPO&@ fp`:*p@o8SE H// Nn2*:H.//. N. Bl]: H/NXO$@ fp`/ N`XO)@_XJgJ_Xg6/ /,_XNPPO&@ fp`p+tgHx/ N^PO)@_X`J_Xf HxNXOJkpf$ +h)@_XJf`N/ /NPPO&@ fp`J%l_X5|Hx/ Nn2*:H.//. N:Hx/ N`/. N0Bjp%@L N^NuNVH0>. Bl]: H/NXO$@ fp`/ N`XO)@_\JgJ_\gF/ /,_\NPPO&@ fp`p+tg$)kh_\J_\f0+pH// N^PO)@_\`J_\f HxNXOJkpf$ +l)@_\Jf`T/ /NPPO&@ fp`P%l_\<+p5F H// Nn2*:H.//. N9 H./ N`/. NBjp%@L N^NuH0>/&o$o H/ / /a>O ,JgJl]g ` H/ /aPOL NuH0>/&o$o H/ /a H./aO L NuH0>/&o$o H/ /azPO,Jg$  l\0(:H// / N8O ` H/ /aPOL NuNVH0&n.p)@]()@],Hl\TN.N`XO)@_`Jf Bl]p`J_`gt ,_`)@](/ /NPPO$@ fp`xp*tgNHxL/. / NO 9@_dR@g*pl_df HxNXO0,_dH// N^PO)@_``)jh_``J_`f HxNܴXOp// / /. a L N^NuNVH0&n $n.pEfpE`pS//./ NO 9@_fR@f *h)@](/ /NPPO$@ fp`B)l](],0,_frAg0H// Nn2+:H./Hl\TN7"0,_fH./ N`pL N^NuH&o ./߫pLNuH&o >/JGj HxN۶XO/ NPXO|y7GppLNuNVH0 n"n :&HY$n~ HrdRG`L N^NuNVH0&n $n gVHxL/./ NO R@f> *h/ /)@_hNhPOJgp`&/ /NhPOJgp`/ /,_hNPPO$@` L N^NuNVH0>. <."n ip0)r$HS&JǐF. SGJ@oSS`L N^NuH0>/&o. <.Bl]: H/NXO&@ f0,]:`$/ NڠXOJg0,]:`Jf HxN`A\0+:H//. /-HN5 O p+fHn/ /.NO Bl]80,]8H)@](/ N`XO)@_lJfLJl]:f8/ N XOJ@f*/.B/./ a|OJ@fHx/ NPOJ@g0,]:`^p`XJ_lg ,_l)@](/ /NPPO$@ f0,]:`.p*tg|HxL/./ NO *p@gVp@f HxNXO0,]8"RA9A]8p @m HxNXO0,]8HA\(!_l H// N^PO)@_l`^)jh_l`TJ_lf HxNزXO/ /,_lNPOJ@f/ / /.N4O $@ f0,]:`jJl]f/ /NPOJ@g0,]:`PHxNP`F/ N XOJ@f0 H//././ / a.OJ@fHx/ NPOJ@g0,]:`pL N^NuNVH'0&n$n ..<.:+pREp+tf/ N2+H./Hl_pN2O Jl]g 0,]kpoBl]//./ aO 0+r=@k b4-S H// NPOJ@f/ /.NPOJ@g0,]:`Hp`BBHl]4/ aO -@Jf0,]:`"p+tf$ n1j6 1j2 *fB(`(@`" n1j8 1j4 *f|`@JFf J@jR@@=@`(p@f" rNC=@`"HRA=A0.H// NnPOr2+4+H҂t4+ -@겂o J@jR@@=@H// NnPO-@0+H//.Hl\N1j0.HR./ NO.Bn0.9@]9@]Jkf kp0+-H`A$-H+gp=@p0.///.aO 0+k"n ir2)r"kr2r2+rt4// /=@N0O 0+rn nhr7krp7@ 7@7@p+tf8/N2+H.Hl_p/N0v.N2+H.Hl\/N0\O n!khh +tAt-@Sf!@l'l]4h H2.H//N@POJ@f0.H// N,POJ@g0,]:` nJhgnp(tff/ /(hNPOJ@f/ n/(hNPPO&@ f0,]:`'l]4l0+pH// NPOJ@f/ n/(hNPOJ@g0,]:`PA\..0,]8"SA9A]8"HC\( 1HHg/ /NzPOJ@f$/ /.NP./ /.N4O&@ f0,]:`0,]H// N^POg0,]H// N^PO./ /.N$POJ@g0,]:` kp0+HxHl]4/N.O JkgA$HxHl]4/N.O kp0+Hx/NӶPOJkgtA$Hx/NӞPO``/ /.NҞPOJ@fHl\/,]4// aOJ@g0,]:`pL N^NuNVH/0&n.. ,.Jgp`p/Hl]4/ aO -@Jf0,]:`Jg.p n@t1k8 1k4 +tf|`8B`2p n@t1k6 1k2 +fB(`@/NXO$@p9@]9@]//./.azO nJ(tfE_p:+:p+@(JEoSE`Jg*z n1EpHx/Nn.Hl_p/.a$O`z H//.N*POJ@g0,]:`'l]4(pL N^NuNVH0&npk fRp0+\// N2PO n g0\=|0+=@=@Hn// N~O J@g*p`p`p0+// N2PO n fp`dBNXO$@ fp`Pp5@ 5@5@5@r5@pp+r 5@5k5k: n $|yp%@h%@l0+>@u L N^NuNVH70&n0,]n0,]l HxNXO n <+.pkrkHHHJ+gp+f HY,JAgz=E$H REFlSJf Rn`p=@ nHJngZ2,]SAHJAoD@o=@Jng"2.H4,]H҂$H²o 2,]$A=B n2.n-H`p=@0,]f kr2+"H$I`"DA9A]0.GFHJngRnJngRn+g=|0.n`p=@ kt4+$HJngnp4.2 $vFă=BJngp4.2 =@`p=@$SB9B]HHԀ Ho n9@]0,]H2.HЁ"Ho0,]H n J0f 0,]S@9@]`0,]nn0.Hr2+// /NO `ڐnHno HxNδXO0.k J2.4,]Jng4.BJAgFHt4+Hԁ2.Hԁ// /NO 0.kr0.Hr2+// /N\O `N0.H2.Hr2+4.H҂// /N0O 0.kr`0.Hr2+// /N O kp0+$HRk 0.k+g$HxHnN HxHn/ N(OXXkrJng Rkr0.Jng Rkr0.0.H//./ N(O 0.krGlXkr J"n Hx/ /N(dO L N^NuNVH0>. &n Bl]: H/NXO$@ f0,]:`FA\0*:H// /-HN'O p*fHn/ /.NO /././ aL N^NuH0>/&oBl]: H/NXO$@ fp`Xp*fHxN\XOp`BHxE/ / NO )@_JfHxN4XOp`// / aO J@gp` ,_L NuNVH0&n..Bl]:/ NpXOJg0,]:`/ N`XO)@_JfJl]:g0,]:`HxN˾`xJ_gx ,_)@](/ /NPPO$@ f0,]:`Pp*tgNHxL/. / NO 9@_R@g*pl_f HxNnXO0,_H// N^PO)@_`)jh_`J_f HxN>XO/ /,_NtPOJ@f/ / /. N4O $@ f0,]:`Jl]g"/ /NRPOJ@g0,]:`HxN`0,]H// NPOg/ /NPOJ@g0,]:`fHxNʢ`\/ N XOJ@g0,]:`H/ aN)R_0*pH./ NPOJ@f"/ /,_NPOJ@fHx/ NPOJ@g0,]:`pL N^NuNVH?0&n0+p2+ @fSkp0+krp7@7@7@ `zpkrk kt4+$H=@=A+g=|`v=CJ@g6 Jp&xFƄ,0+v$Ą*JAgr(„=A`z,=k0+2+ HR// =@NnPOFn(>. H2.H4.H҂// /NO ` F2.$@.=|Jng0.4. p=@Jng& J 2.H0.HҀ/// N$O JGo2 H2.H4.H҂4.H҂4.H҂// /N O ` HxNȺXO Fkkr0.7@SkpSk L N^NuNVH>. ,. Bl]: H/NVXO&@ gFpk g9|0]:`6Jf9|]:`*Hn// NԸO J@fp0. g0<9@]:Jl]:gp`0.LN^NuNVH'>. Bl]: H/NXO-@Jg /N:XOJgp`tp nh gHx0NǞp`ZBHnHl_Nz HHl_Hl_/NO,JgHn//.NO J@f@p0. g HxN>XO`& H/Hl_/NO J@g HxNXO`*/.N͒XOJ@f nR$)h$_>J_>f 9|,]:`/N΄XOJf `p0."\t4d HxNƸXO`n nR$)h$_>J_>f9|,]:`Rp0.\//N2,.NPOJ@f0Jg,\=|=nBnHn//.NLO J@f `p)@_>LN^NuNVH/>. ,. Bl]: H/N"XO-@Jg0/NƄXOJf$Hn//.NҐO J@fHnNӈXOJ@g0,]:`p0.І*\olHn//.NTO J@fVp0. fH0.2.$A(\D@c4=DBHnHl_N H.Hl_/N\OJ@g HxN\`FBHnHl_NҢ=|BnHn//.N.OJ@g0,]:` HB/Hl_/NLN^NuNVH>. ,. &n:.Bl]: H/NXO-@Jg /NPXOJg0,]:`$Jf HxNĺ` f Hx!NĪ`Hn//.N4O J@fHnN,XOJ@g0,]:`0.Ed HxNj`=E=|0.E(p n0(\r2c p@@c=E`xHn//N O J@g0,]:`tp0// //.HxNӊOJ@g0,]:`PJDgDp0\܀=| ]@=@BnHn//.NO J@g0,]:` H//az`/.N*LN^NuH>/,/&o :/& Hr2// //NdO(JDf0,]:`"  l\p0// //BNOLNupaNV .9@bX . 9@bZ .9@b\ .9@b^ .9@b` <lN?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}xe^H./ Jkpop`@ A*H0|"Ufp`& f UfK`p`*UB/NT.NPOpL NuN,paH0v$j4 eRHHxNXOL`<H@HB8F@BBDGmBCG`BBE?GhNH@.៳G@HB.៷GB.HG,HFކBGGHGHA,BFHFކHC,BFHFކH@HB,ރv݃ށ݃"HA&HCт$B@@H@HBBBނц҇tтNNuNV ,Sm* l"@0;Np")@`p!)@N^NuNV)nHxN\N^NupaH?@aLNu<<><H@HB8F@BBDGm\Bm fJgN´Gm fJg "NNJf$Jf HHxNvXOL <@rH@NuNPGm fJg "NbN:GfJfJfJfJfN(NN|`@ @BfJfJf`BCGN\BCG`B BG?GhNH@.音G@HB.| GBHD8"DHB8HA0BAHB:HC<HC>HGFHGBFHF݅dSD҃тBCHD,HBhBD HBH@HA0BA`&8HA0BAHB<.HGHGGHFBGGHFdSD҃тeSD҃т,HBhBE HBBH@HA0`:HA0HB<Őd SEЂeSEЂHEHBhp: "( :HDNJk&JjJfHJfDJf@ f8Nufe.f&NuJkfJfJf fNufe fNuDNuDNuH@HB<<><8F@:G@BBBBGf Ef*Bm.f.g "N^Dg~N8JEfDH@f(Jf"HBfJfFN "H@@@H@NuHBfJfH@@@H@Nu~G@BH@HBDg$f fNujD@8NN҃т m~ӇчE EeNtH@EDH@Nun BCFG Eg0JGf>HBfJf @@H@NuփՂJEf&H@ҁр`"Jf JfN*NP BHB @H@EFGGE G4nҁр G o &tG t`4EH@EDH@Nu Go6HCBBHBG"F,, Df<҃тE m E~ӇчH@E EdDH@NuNh mD҇~чEH@EDH@Nu m JElD`El?NAXON"tp` < f ?r>?NAXON"Lp)@p`.gn ?r>?NAXON"(p??/ rC?NAO N"?/ r  m + ?@H" M"k`Sd2/ k'HH *MJg / NXOJg ЇS"N " `JfP L(N^NuNVH*o-gd-g/ NHxB/-N6O.`l MHxB/(/HNO o "(.*h,` r fS SJf`,HxB/-NO .-g - ހ` L N^NuNVB n //.NO Jg p)@p`pN^NuH*o./,/-g/ NXOpf / NXOހ|+mp+@+m B- -g rí+@ ///-N$O Rfp`pL NuNVH*n&n .,P| nJg/N$XO+H@+g<@6g S@g@fN~r++WDHH,`:.<r++WDHH,`"|+H@ag S@g @f ~`.<H@ag@gN[@g`Jgp`p@/,T// N^O *pfp`Jg ,<@`,<@`zJgp`p/,T// NO *pfp`Jg|@܆`F|`BJgp`p@@/,T// NO *pfp`@Jg|@܆`|`p`.f"n#H#H#E#H#H #H#F L(N^NupaNVH*o$./(,/,&o0 "N*Jf `XJf xd+f/ NHXOJgp3SgpLFr@ҁf `p'@`+fct + k"M`Sd M +"///+NO ,pf +"N*,`"JfJf |` Ы"N,p'@`|Jg> m +?@H" k"M`Sd2/ k'HH*MJg./ N$XO(pf ЇS"N" ` S*MRMJf L(N^NuH*o&o`/ /NPORfp` HHfpL(NuNVH..*n | @S m4 mR -gp f/ NXO,Jg `& ` p3UgVpLFr@ҁf -+@ `6-gp`pnFrnFf+m ` p+@ `-g8B HxHn/-N4O ,pf `pg|`tJf$/ NXOJg p`b -+@ +m - Jn/ NXO,Jg `:J g mR S -gp f / NXO,Jg ` L N^NuNVHK`&M*S gJf f"Hx"NXO*@Jfp`&p!r MQ/ /. /.NL(N^NuNVH*n.. M S/HJg`&M nJgP m (,/Hx /(/ NLO*@ g " nѨ`B nݨ*Kƞ`(/N`XO,pf ofp`S p gJfxB /L(N^NuNV//.NXO.pg n p.N^NuNVH*n-gAfHlHxNVPOSm mRp`p3Sg$pLFr@ҁf` p+@p`-gPB~- JgB- `HxHn/-NO .Jo ~.`Jf`~`jJf/ N HXOJg p`P+m/-/-/-NRO +@.JoS mR~`Jf` B~ L N^NuNVH*n g-f*+mp+@B- +@ -g`pJgj - Jjr+A - .Jg,//-/-NO ,pf` g+m-gp+@ rí`+m p0gp`(p`$~K`Jg/ a*XOJg~*U f L N^NuH*o~-g / NXO.p fJg /-N(XOB/-NXO,pgJfpL NuNpaNVH!$*ll` mN*U fK`,pUf -.Jg//-/-NxO *U f` lXH/pA?NA\ONH l)PJf~Kc`JUg0-H/NXORXMm/.N L$N^NuH0$&HBHCCHBBBЂL NuJjDJjDaDNuaDDNuJjDaDNu/HA4fH@HAHB4g0H@40HB2$Nu/v|dQC|dYC| dUCJAkSC4HBBBHC604HAdSCЁr2HCH@A&$NuNV/.N.NxN^NuNVH $/.NFXO*@Jfp`.-gBUp` 0-?r>?NAXON BUJgp`pL$N^NuH./ p)@Jkl Ac*HJUg `p )@pL NuNVH p: n(f HH/NjXOrA?r?NAXOT/.p;?NA\ON 6LN^NuHp0/?@A0ACA`d2XH`"Q)_lNMLp"llN½NVHx B/.NN^NuNVHx B/.NN^NuNV/ <l nШ"($(///(/(/( A/0(A/0HzHlbN8Ab $.N^Nu%s %s %02d %02d:%02d:%02d %4d NZJpaNV nJfSHl/Hx/.NN^NuNV/ HzNXO*@ fP , d@@0;N""4""""".(""."K`K`K` K`KUbmbmbB,bAb)HbAHn/NPOV ."<NV)@bJgUbmbmbp@br)Ab`B,bBbAb)Hb*_N^NuTZCST6CET1???2???3GMT0NVH~A -H`p%f n-HH@dgF@ gW@f` n*X-H`H n,Kz-H`SM rASJjB.` nX/HnNPOK/ NXOހ`RRSm  l)H`< HHHl/NPO`(RSm  l)H` HHHl/NPO n-HJf L N^Nu0123456789acdef o /H0 HxCqr1fJm$nf Bt`<-fP`<+fJfp <0f8p<Xg<xf(p`"<f<0f xfRH` xfRHJgt<0mT<9n0`<Am>7l4&gHCHCJCfԃek`PPԁek`PP`JgD"/g"ASH"" L NupaNVH#4*H&n-I g0Bg/ p=?NAPO.Jk g BgpE?NAXO6 ?BgrF?NA\OJgp> nf<~p&(fCp?/ p=?NAPO,-H`FCp?/ p=?NAPO,`0~p&fCBg/ pNAXO~ rf~!r!~!vNA\O LNu09of!r!~!v yN09ofpNu yN09ofpNu yNNVH Blc 9|cp)@r)A/NXOJg9|cp9@c r)Ar)Ar)A9@c/NZXOJgpBЀ9|c` pB)@9|cp?p?pF?NA\O9|cp9@c9@c9|cp)@&)|"p)@HpB)@DJPg60,cH@9@c0,c H@9@c 0,cH@9@c9|c9|c/,`/. /.N.NpLN^NuN;pa/ *oJg -fp`6/,xN6XO+@+@Jf p )@p`+lxpp+@ +@*_NuNNuNVH..*n ,p1gp`JJfn-ffp+@ rg./ N\XOJg p` -+@ "-S+A Jk mR r` / /NDPO" `-g.pfp` @zHxHn/-NO (~`, -*Jg//-/-NO (`xpf` g-gr+A `"-+A m+HgS m mR ` / /NPOp0gp` pfp` L N^NuNV)nXpN^Nu/./JXg / lXNXO` /N XO.NuNnpa)_lHpJfp`> //o/@?<@NATO`)_lHp2/.?o ?A?<BNATO`)_lHpJfp`2/> o/o/H?<?JAk f)Hc?<?B?<BNA/@?Ap)@?@>B??Hx?<BNAO Jf|O )ocNATO lcJk"g fHyHx??<@NAO p`(cg. RAHyHx??<@NAO /,lLpNu  f `NAO NATO` ?/Hp?<?/B?<BNA/@2/ ?ABo>BBg?Hx?<BNAO rJWD?A NAO p0LpNu   /"_` "llLpJj$AD)@|ClApfp)@pNBN /Jkp)@N/2H@t `WWf(CQQ`дWWf CQQ g$Nu// "QS@t `| SAgU@c дgSAW  _ $Nu1 ^765^^520^383 ^765^^520^2 ^765^^914^3 ^902^4 ^765^^534^V5 ^765^^&2D9^6 ^765^^&2E0^7 ^895^8 ^512^9 ^538^10 ^&2EA^277 ^774^279 ^&2E6^280 ^&2E8^281 ^&2D8^282 ^&2D7^283 ^776^284 ^777^285 ^&20B^286 ^&20D^300 ^788^316 ^789^302 ^781^298 ^765^^536^b305 ^765^^536^i312 ^765^^536^#317 ^765^^536^u319 ^765^^536^*ffffffffffffffffffffffffffffffffffffgfffffg``gffffffffffg`gfffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffggffffffffffgg````ggffffffffffffffffffffgg``ggffffffffffffffffffffffffffffffffffffffffffffffffffffffffffHxLOHxCH2SSHxVHxHxMHxRHxI  DHxI xNI2xTI>xFHxINxHxI`x(HxInxHHxIxxQQIxIXIXIxIxIxIXIXIxIXJXJXJxJ"xJ4xCJJxLHxJbx FFJpx RRJxJxJxJxHxJxGJx HxKxDKxTK"xK0x HxKBt VKPtCK`tXKrxZHxK~HxKtSKtCKtFHxKtXKtANKtRRKxCLxFHxL$*GHxL8xALFxRLT,ELbxXL|xDWHxLAIL*WL#PHxLOLOLxTMxALMxRRM2MBMXMnMFMxXHxMMHxMMFMx?N-N N.xPN>xFNPtBN`xTNlxDHxNUNRNxAHxN EN CNNxO xO=O0ATOBABOVxSHxOnxWOzxLOxFOxAOxMOxCOxBOxIOxDOxUPxXPT KPZ RP^ GPd BPj CPp MPx YPB$BPC$PE$PI$IPL$PN$PP$PQ$PS$Q T$QU$UQ(xDQ6xVHxQJEQdEQxxMQxGHxQx OQx!NHxQx"IHxQxCQx#LRx$RRFFE ,PfRRRE ,PR"RW RG RARB RSRC RMS N%N%-R% S 0S(YSBXSXN Sn)SFF%  0SII%  0R S SLSTSSTDT CCE{TT&T:TNR S  Th!TvDTPTSTFFE&O0TRLTO TVT!$TI#TC5T)TWTRTA A%΂TEE%!ΆTT TE dΎT+UQ-UD:S N N% ΊU ^ R3 S ? U HRU2WR   U8UB U8UJ#UTAFUbFGUpU|S EUP DR U' %USSEѮ !UNNE1@UFE"  PJFE !1UP%%   PJP5& 1< !$UC%0  !pPJC51 1> !JUO OE 1QUAA5 xѬUV S ' R/ U.(lU4(<U<'VRV4PVPTVlSVHVI"VL"VB"VW"VC"W A ,WN ,W D zR+ S 6W*? ,EEW:AW@V "WFD+ WNL US# C, WTUWZ+ E 80 WbEEE4Wn4WvDDWV 6WI  WZ+ 8 2W2WRWWWJWOXAXCX,AX<I XNB/X\H!Xp2 Xz5 XS XP R1 S < XE4X?XNXE XDXS&XO0X 8XRYLYWYB.YIY6H$YHFY\A  jFE"R/ S :YfC 8tY|lTTYlEEYlRRYlCCYlHxYlMMYlNNYlDDHxZxOOHxZxZ.l ZFl ZXl ZhlrZ~lrZlrZZ + LZ33 LZ44 LZ55 LZII LZCC LL ML5 2~ KrW MW5 2 KrZ T5 2 KrB5 2 KrPJ PJ E5 2 KrR5 2 KrPJ PJ G5 2 KrZU ZN MZM MZ!YE2 '0L[T [ B [E [RPJ PJ ["G[* [BL[LWZY[V#![hA2 MX[rP+ MX[|!SE1[|S[H [F* [D N[V NO![O[ 1 R& [=>[11E> Fv[22E> Fv[33E> Fv[44E> Fv[55E> Fv[66E> Fv[77E> Fv[88E> Fv[9 9E > Fv "TO  FTE  F[B "SE #%G [* \S& \M( M57 1/ 1\& 5 \.( EK\8B1\TW1\lR1\~I1\H1\FFd1\T TE 1\L L5 d1\&  \. \(T\NNE O] 6]5]$R]:F]JP\&  \. ,WR]^IIE %O ]jFO E$O]O]]/]WW5 B]A ]H H5  B ]U , ^ D D D5 2C ^BC IJ ^PJ J^`RER ^xNKR ^ & ^^5YPb( E&O &b.D R [ " b60 _t~قويِْJ<٘ٞ٠٨6٪ٰPٴپhJZ4 P6ZFJ ;  >"*08<DjJR VJrX^bjbnJ~rJdxJ|Jڂڈ[ڌڔ[:ژڠ@ڤڬZZڰڸZlڼZZZZZZ Z[$`(0p4:%>FJJPJ|TZߚJJ\bfljpx|ۂۆJۊے0ۖۜ8۪۠ۮ۸ۼݢ \JrJ J &J,26J>F~JT~Xbhrv܀܄܌ܐܜܢܬܰܺ ܾL^pr bJJJ"(.8>F(LV6\J$bjVnJ t|@݀J ݆J݌J:ݐݘݜJRݢJ ݨJ2ݮJݲJݸJݼ$4DTdtJ^@ 0J i0$*b.48J@<JbBJ˾NJ@VJ\J0dJHjp=t|`ހJކJފޔ\ޘJ8zޞަ98ު޶5H޺/JJoJoJ>oJ|JJoJjoJjoJnoJoJpJ}hpJ}xp J}pJpJpJpJpJp&Jp*J}p2J|p6J|p:J|p>J||pBJHpJJ2pTJpZJp^JpdJpjJ&ppJ:pvJp~JpJpJpJpJpJtpJDpJpJpJ8pJJpJ^pJppJpJpJpJpJpJqJq JqJqJ$qJ8q&JLq.J`q8J}Dq@J}VqHJqLJqPJ6qXJ~$qbJ~PqhJ~qnJlqvJq~J\qJ}qq}qqqqqqqJbqJqJqJzqJLqJ\qJqJ&qqPqJrJrJr JrJ"rJ0r J@r(Jr.JJJ?}nUnUf˵fUKfUdUUdUɕ"UȕD"D @(@( @ @ ,dKIhh0Hhh0Gh0Axh0FZh0@<h0(h'!x&Z <H<<xH<<xH<<ZH<<PH<<HH<H<<@ @  J @ @ @%s : %3d%% @@ .IMG.PCX.IFF.LBM.GIF.TIF.BMPoIoDoNoSoXo]ob2@3#('")`~+\|&1|12@2"3#3'44(5[56^67`7 !88 9{9 0}0 )] -_}_aA)ACzZBZ\=<[<$*]*qQ9QS'mM 5MO(%'>%+``<>\>,wW?WY2,??3;..4://5=++~2"@34$6&7/{ 8([ 9)] 0=}+*~)#^+~|`<>3,;4.:5-_V<> ?\ :;zZBZ\@\'[{(]},yYAY[1|2@3#6/:<[;=]'(;:{)`'+}`<>\3,?4.!5'"36& 8({ 9)} '?; ^=[+*]'@(#)`'+2"@3#4$6&^7/{ 8([ 9)] 0=} +?\ [{]}'(`~)'*+\|^@`<>\|3,;4.:5-_V<>\|4$'(('1!|3#4$ 8({ 9)} '? +*[:;]'()`'+=  -_??'('<:51!2"34$5%6^7&8*9(0)-_=+ qQ9QSwW?WYeE-EGrR:RT tT<TVyYAY[uU=UWiI 1IK oO7OQpP8PR~[{]} aA)AC sS;SUdD,DFfF.FHgG/GIhH0HJjJ 2JLkK 3KMlL 4LN;:'@`#~zZBZ\xX@XZcC+CEvV>VXbB*BDnN6NPmM 5MO,<.>/?  !  " !#"$#%$&%'&( ') (*---+++!\|\|(())//**77889944556611223300...            !    Գ;ϸ ӺĽз Ⱥͼʻ(( *.*+$ h X?O    Dl@@N  CollinsLegal & Medical Supplements (C) 1982 Merriam-Webster, Inc.  H  \8   " ;;;;;;;;;HH HVxHhx8SHzxLLH8EHxJ, HxP&` $P4PJPLxPPR"xFR(WR.ER4BR: @RRB PRHSRN8YRT TRZVORb RnY RtN Rz  R  RA RR RYRNR S9 TJ SvS S~I SC SL SK  R %DLCPSLL % 1SCC%  1SPP%  1R S  SSt $@ R"<"FZ=Mc  c  #AEdit HeadersEdit FootersHF(Both Same)(Different)O Header Style Footer Style Header margin:Footer margin:(inches)(centimetres)Headers On Footers On FHSave AsSave Block AsFPJ^^^^__0_L_d____``,`J`n````aa6a\azaaaaPJPJbReading Writing PrintingPrintingTo fileErrorUnknown printer type specified. Image processing indicator Error: %s format not implemented.Loading %s... PROTEXT v%s DEMO (c) Arnor PROTEXT must be installed firstPROTEXT incorrectly installed - invalid path specifiedPrinter (%c) %-8s %s %sPress any key to continue ...Line too long for system commandNo room for configuration fileInvalid configuration fileDirDirectoryNot enough memoryBad command or file not foundFormatting...Counting...Fixing...Please enter help subject name: Unable to create a drive list.No Style.Save changesError : Cannot Open Document Settings File.Invalid path or file not foundDirectory: filefiles occupying %lu bytes. Free space %lu bytes.KNot enough memory to sort filesToo many files to sortAre you sureFile already being editedSave macro changes madeSave glossary changes madeINK number: INK value: SAVEKEYS filename: LOADKEYS filename: Bad key fileSAVEGLOSS filename: LOADGLOSS filename: Bad glossary file%lu bytes remaining in buffer (y/n)? WARNING - text has not been saved. CLEAR text - are you sureGOTO P(age), L(ine) or C(olumn) number: Enter configuration file name: INK %u is %u ( = &%03x)Invalid parametersEnter drive letter: File too large for demo versionData file too large for demo versionERASE filename: RENAME old filename: RENAME new filename: MKDIR directory name: RMDIR directory name: COPY from (filename): COPY to (file or path): No file to copyCopying %s to %sNot enough memory for copyFile cannot be copied onto itselfSource name must not be a directoryTOUCH filename: Current date is Current time is Enter new date (mm-dd-yy): (dd-mm-yy): (yy-mm-dd): Enter new time (hh:mm:ss): Invalid dateInvalid timeRecord filename: Invalid directoryToo many open filesCurrently defined variablesUnknown stored commandUnknown microspacing methodString too longParameter(s) expectedNesting too deepVariable expectedEL without IFEI without IFUN without RPCode sequence too longWrite file not openData file not definedData file exhaustedBad variable nameData item too longLine too longFilename expectedStoppedUnrecognised HELP subjectCannot find COMMAND.HLPCOMMAND.HLPExpression too complexHexadecimal number expectedIllegal character in expressionNumber too longSyntax errorIllegal operatorVariable name too longUnknown variableMissing ')'Division by zeroSearching...Found: %luReplaced: %luFIND string : REPLACE with: Too many wildcardsUnmatched wildcardsOptions are: All,Backwards,Case sensitive,Global,Spaces ignored,Word,numberEnter options (A,B,C,G,S,W,n): ' not foundReplace (y/n/x)?Incomplete '!' expressionbHCannot find %s - Insert disk containing file and press a keyFatal error 1Memory error getting file buffersError creating fileError writing fileRepositioning..File already exists. Overwrite itLOAD filename: MERGE filename: SAVE filename: SAVEB filename: Enter new name: Enter extension: Abandon unsaved fileEnter expression: Result is:Press SPACE or 0-9 to insert into textAdd or Remove (A/R): 1st number: Increment: SIMPLEtoken is %u (&%04x), key number %uDrive does not existMACRO string to assign to key: KEY number (S=shift, C=ctrl, A=alt): TYPE filename: EXEC filename: SPOOL filename: Spool file already openEnter printer driver name: Current CFG filenameProtext Status InformationDictionaries for checkingDictionary for updatingPage lengthLine spacingTop marginHeader marginFooter marginBottom marginSide marginContinuous printingNew page after printingHeadersFootersForm feedsBackupsSearch pathTemporary text pathDefault filename extensionMemory allocated to textMemory used by SPELLKeyboard languageKeyboard typeUndelete buffer sizeBackground printingTYPEWRITER MODEEnter text a line at a time then press RETURNQuick dictionaryONOFFCannot open file '%s'SPLIT filename: SPLIT size: CODE - press required key (ESC to end): ACCESS filename: PROTECT filename: Invalid tabsCannot run external programUnknown variable: Press one of P, R, S, T, V, Many thanks as always to David Foster, without whom ...Press printer control code (A to Z) or marker (#, * or =)Non-break character. Press hyphen or spacePress marker number (0 to 9) or one of [ F L R ? ]CLEAR text. Are you sureBad document numberCan't swapIndexing ... Page >>> Unattached Index Word Marker <<<Index abandonedContents abandonedIndex created withentryentriesContents file created. Press ESC key. Type line drawing character: Please wait ...Warning - Unrecoverable text. DeletePress macro key or glossary name, then key sequence (CTRL-f1 ends): Page %u. Press SPACE to print, RETURN to skip, ESC to endPRINTF output filename: PRINTF input filename (or press RETURN for current text): at lineSAVEA filename: Can't open output filePress ESC to editType CONT to continue printingRepeat buffer fullAbandon printer buffer contentsPrinter is on STOP with %lu bytes in bufferContinue printingFilling printer bufferLine buffer limit exceeded PROTEXT DocumentProgramAuto Indent On ESC for Command mode Ln Macro RJ WW AutFm TypChk f3 for Menu Page Ch Line Col No markers setMks << No File >> CAPS NUM SCR N+C C+S N+S NCS Overwrite Insert Box Wd-Wrap W-W off Right-Justify Justify Off ESC for Command mode Block not definedCursor in blockWarning - Box overwrite operation. ContinueDelete BOXOut of memoryOut of memory for indexingBox too bigBadly formed boxMaximum text size of demo version reached<< Current Text >><< Current Block >>Text too large - must spell check from disk file PROTEXT spelling checker. Checking: Options : S(tore), I(gnore), V(iew), C(hange), L(ookup), B(ack) Reading text ...Writing text ...Scanning text ...Sorting words ...Checking words ...Table overflow in dictionaryNo dictionaryChange to: Disk I/O errorStored word buffer full Spell checking ... (Press ESC twice to stop) No matching words foundReplace all occurrencesoccurrences changedPress a number to select word, any other key to continue: Adding words to dictionaryCounting words in dictionary Words checked: Word is in dictionaryDo you want to re-load the documentNumber of words checked: Number of unrecognised words:Number of words changed: Number of words stored: WARNING : Text may need re-formattingmatching wordwordsDictionary name: Word to lookup: Find word pattern: Anagram word pattern: Text file name: Name of file with words to insert: Name of file with words to delete: Name of file to spell check: Build input file name: Build output file name: Name of dictionary to list: Output file: Name of dictionary to count: Searching dictionary ...SILCBVSILC Read errorUnknown command%s in printer driver at line %uBad IF nestingWarning - missing ENDIFbRbZbbblbvb~bPROTEXTENGLISHbbccLcccdcdLdcddee(eFedeccceeef>cffcgcg6gZg~gggghh.chVccchehi"i`iij4cjrjjck*krkckckl$cclPeThank you for using this demonstration version of Protext.Check that the printer is ready. Press P to print or ESC to abandon: PCannot find PROTEXT.DOC. Press a key to continue... ("7?D (<AF# Invalid string operatorString too longMissing ']'Binary number expectedBadly formed or non-existent dateCursor not in blockPROTEXT will attempt to recover from this crash : if successful, corruption may still have left the system in an unstable state. It is recommended that you save the files you are editing on another disk, and then reboot before continuing. llllllSpell checking languageOpening the Proximity/%s dictionaries ...Dictionary '%s' is not for current languageError opening dictionary '%s'No language selectedLanguage not availableError opening file '%s'Error creating user dictionary '%s'Error opening user dictionary '%s'DIRD Confirm erase '%s'Enter file specification: MFADCNMFADCTRENODisk free space: %luKNot enough memory to map directoryTree overflowScanning directories. [Press ESC to stop] Use %c and %c to move to a directory, RETURN to select it, ESC to cancelPrinter driver '%s' not foundOriginal file has been changed since it was loaded. ALLNo PathCLEAR ALL FILES - are you sureUnnamedNew FileLASTUNRECOGNISED WORDUNRECWord too longSelect wordCANCELLoad againNumber of spaces to inset text: words in dictionaryRoman numeral must be between I and MMMCMXCIXCondition requiredSelect with mouse or cursor keys/returnDocProgTotalAutosave file '%s'Autosaving '%s'. Clear bufferUse graphics mode for that accentTo finish press EscSaving fileUnwanted parameterExpands to: Spelling checker pathPrinter driver pathRepeated word found - delete second occurrenceNo capital letter at start of sentence - correct thisAll rights reservedNo thesaurus for current languageError opening thesaurusNo thesaurus informationofInsert {Space}Delete all marked filesCopy marked filesCopy to (drive or path): Press SPACE to insert into text Help : Count : Macro listGlossary in file '%s'Sorted by %s. Hidden files shown. lllll%-34s : %4u%s %4u Page : Len : Page length = %.2f%sPage %u: %3u%c linesNumber of characters %luNumber of words %luNumber of different words %luNumber of lines %luNumber of sentences %luNumber of paragraphs %luNumber of pages %uAverage word length %.2f lettersAverage sentence length %.2f wordsAverage page length %.2f wordsNo data availableCurrent printer driverMacro file last loadedThesaurus nameSummaryAlphabetical SortNumerical SortPAGES Block DocumentSPAFNWhole documentWhole blockError reading file '%s'Cannot find file '%s'Save unsaved file (Yes/No/Esc)? Name for glossary: Phrase for glossary: GlossaryGMacrosMNameNKeyKExpansionEGlossary EditorMacro EditorDelete glossary entry '%s'Clear entire glossaryDelete macro for '%s'Delete word '%s'Reset macros ResetR ClearCWordsWword (T)TEdit user dictionaryEdit exclusion dictionaryTOPICSFont not definedBackTopicsUnable to cross-reference any furtherSearching for anagrams...Searching for words...Found anagramsFound wordsHelp topicsCannot split file - use SAVEBUpdate marked filesPress style code letter (A to Z, or $)Too many fonts CONFIG.PRGCONVERT.PRGFSORT.PRG &",04<#FJ$R%Z`dlr x|!htvz~hh @z !@z -@z L@z! @z!!@z!-@z!L@z- @z-!@z--@z-L@z>>AAS RAV~BL R`BM BlCC8XCE)KCF.COACP9CS3JCWLdDC/DE PfDF-DM3nDP/`DU%EA2EC QEF EEH EEIELEMBEN JEP D:EX.FC RFD M(FE JFF9FM BNFN KFO FFP9FSWFX G2GC2@GI1DHE ExHM B0HSWHY LIB 'IDIE'IFIG SIN 4IP LIUL @zL!@zL-@zLARLFGVLL@zLS CHMC5MF:MM5MP:MS9NC2NP:NSWOC3 OF EOH EHOMBOP DhPA CfPC Q PE:6PL BPN CPO:ZPP GvPQ:PR6PS:~PW ARC7RJGRL*RP&RU*RV*nSA2SC ORSKSL OtSMBST3SV0TL LvTM BUN'PUSIVWCWFWM50WO R>CO "7Yyb KRGBCMY>-------!-------!-------!-------!-------!-------!-------!-------!----R  @ @ @@|    dlg`\j $$ϢЀ(scal)xAX `   LOADSTYLES filename: SAVESTYLES filename: RESTYLE filename: !+ % ptK<pp 5 57 57'0 FORMLISTPROPCAT FTXTILBMPICSPICTBMHDCMAPBODYGRABDESTSPRTCAMGTEXT~`ejotyӃӈ Ӎ Ӓ ӗ Ӝ ӡӦӫӰn$mmjbjj==  DP\htɀɌCGS_hlqO}``xp`~88<``ll``~p00660x8<```lxp``~~888x<<````ll````~~pp00066000xx88<<xlfflx6 >ff<`|f|```|ff|``x|nffffn|xl88l>~fff~<``|~ff~|`````|~ffff~|```D|88||888TT88|T8l|88||8888|T<~ff|~gccc8lxlff8`0vl88l88l 03ff3f<0 < `0fl00~03fff< 8oooooooooqrosooqsotbootbuotbuoqvoqvo  $(,048<@DHLPTX\`dh  $(,048<@DHLPTX\`dh T $$$xx<<Ey09?6C,?zGz??uOs;ZwH01M8O?FnCAy7Aׄ@È@Y@$PROTEXTNo memory for expansion stringInsufficient memory for program to runFile '%.56s' not foundDisk error %dDisk fullBad filename '%.60s'Invalid pathPath not found or File already existsToo many files openCannot write to open input fileAccess denied - read only file or directoryNo room for copy stringPress any key to continue: Directory of same name existsFile '%s' is read-onlyFile '%s' already exists Press RETURN after inserting next sheet of paper, or ESC to stop printingYNZZZZZZZZZ[[[[[&[8[H[X[b[n[[[[[[[[[\\Please insert disk for drive %c and press a key: Drive %c: %s. Abort or Retry : ARIBusOdd AddressInstructionDivisionCHKTRAPPrivilege You may be able to continue by pressing the UNDO key. A 68000 processor exception (%u) has occurred at address %06lx. This occurred OUTSIDE the current program. Description: %s Error. Prog limits: %06lx-%06lx. Offset: %06lx. Registers: a0=%08lx, a1=%08lx, a6=%08lx, a7=%08lx d0=%08lx, d1=%08lx Params: %08lx, %08lx, %08lx, %08lx Locals: %08lx, %08lx, %08lx, %08lx Lastframe: %08lx Ret Addr: %08lx Directory full (or read-only file)<>|/[],.:;{}*?"^\?v|                PPTX^ffflrxxx| $$$(,2226hhrzhrhh0Rd,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,xzx"&*.26:>BFJ HHHHHHDDDDDD  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~CueaaaaceeeiiiAAEeEooouuOUaiounNAEIOUAIOUEIAEIOUEeaAnoOyYlLsOo  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~"IHA IiA xiAAAIAA 8AAPA  aberalsauchbeidedanndasdadassdeindemdendennderderendesdessendichdiedieserdirdortduereseucheuerichihmihnenihrirgendjederjenerjetztkeinmanmanchermehrmehreremeinmeistemichmirnachdemnichtsniemandnochnuroboderseinsichsiesobaldsolchersonstsowieundunsunserwannwarumwasweilwennwerwieworumzwarb "&*04:>BJTdjjusqullorsqumnpresqupuisquququelququoiqustacheachischachureaieaineaineuseaineusesaineuxalagealleandicaperanterapperaranguerarassantarassantearassantesarcelerarnacherarponnerasarderasardeuseasardeusesasardeuxausserautauteautesavreareurtibouideuseideusesideuxirarchieochetockeyeurollandaisollandaiseollandeomardonteonteuseonteuxoquetorsouilleouleouletteouleuseouleusesouleuxouppeourraousseuisuituitaineuitimerisserterelleellesililsonH2I[V[Aki)Y.>IRyQIVQI@1m5DPA[vC^6iQEAPaQ ?@ LT $-7BN[ix.pfd.pfd.pfx.pfxrb+rb+w+bw+b Prodata fatal error #%d. The c-tree(TM) file handler is the CONFIDENTIAL and PROPRIETARY property of FairCom. Any unauthorized use, reproduction or transfer of c-tree is strictly prohibited. Copyright (c) 1984, 1985, 1986, 1987, 1988 FairCom (Subject to limited distribution and restricted disclosure only.) ALL RIGHTS RESERVED.@x&VѼ ((((( H ((((( H  (X:\X .P(,@| `N̼*      |^ |F * *f^vbt$$,   LPvF<X    r6*        .     .J>B 2T     xf l ~  >p            F    "2    \     @@@ $ &*>tN    PfHhb "6 (  > *B"""Z( `|4FD2PDl6* RzPL t8.Tfv>::  >. >   "      2  &r `    $ P x  6*   z  6  6 T  4Pn4(`J2>d8*.آXF$D0(:PxN>lbbrjl88f*XR*&$44($8, 2"6$:26( ,$.j("Tn@l*.(XB<0F88,"bdf,$TB80j<(.>J,F,&  "t*8888888888  4\\0,,,,,,0\0`000`\\0`0000\00000`000\0000000000\\\000\000`600000000,,0,,`\0\\,\,0\,0\\000,,40000000000,,,0`0000`0```,0x0000000000000000`00000000000000,40`88\\\\\\000000\0000\0000\00\\\0000000000000,0,0\000,,400`4\\,0`\`0x,,,,,\\\0`\000000x\0\0000\0,\04,0\00,0,\,00`\0`* $@  jP0000000000 00000x \\\0`(2$0( D$0N\2<L` T$&"""cr" copywidths "roman ps" ! epMX5@hn Protext CPD file. Sep 21 1993 09:50:46e` Roman Sans serifSTYLE N "Roman" "Roman" 10 10 q STYLE O "Sans serif" "Sans serif" 10 10 q Z ZZ0Z `ZhZ ZZ ZhHZ|\ZZ4Z, ZtTZZZZ Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z   %(+/37;?CGJNQU@RxpPEGFH45WWUUxxSTST-- _ Z p {   >   M  4 C 9 /  H    k * f % # 0 = J a W p \ R b m x W R]L @~ K @@ KL T8L