4IBM _p >> FastCopy PRO << by Martin Backschat, Bergstr.16, D-8071 Hepberg // (c) 1991 ICP Verlag/TOS Magazin, Wendelsteinstr. 3, D-8011 Vaterstetten, Tel. 0810633954 @ `  @ `  @ ` @ ` ǀ ɠ  @ ` ׀ ٠  @` @`!Ao  !Oa!!O%a)-135a79;=ACAEaGIKMOQ!OUaY]aegikmoq!suwy{}!Aa!Aa!Aa!Aa!Aaǁ!Aaׁ١!Aa!Aa " B b  !"!B!b!!!!!"!""#B"%b"'")"+"-"/#1"#3B#5b#7#9#;#=#?$A"$CB$Eb$G$I$K$M$O%Q"%SB%Ub%W%Y%[%]%_&a"&cB&eb&g&i&k&m&o'q"'sB'ub'w'y'{'}'("(B(b((((()")B)b)))))*"*B*b*****+"+b++ @ `  @ `  @ ` @ ` ǀ ɠ  @ ` ׀ ٠  @` @`!Ao  !Oa!!O%a)-135a79;=ACAEaGIKMOQ!OUaY]aegikmoq!suwy{}!Aa!Aa!Aa!Aa!Aaǁ!Aaׁ١!Aa!Aa " B b  !"!B!b!!!!!"!""#B"%b"'")"+"-"/#1"#3B#5b#7#9#;#=#?$A"$CB$Eb$G$I$K$M$O%Q"%SB%Ub%W%Y%[%]%_&a"&cB&eb&g&i&k&m&o'q"'sB'ub'w'y'{'}'("(B(b((((()")B)b)))))*"*B*b*****+"+b++YGAG1 BAK !\XFILE GREEK !README ]8STARTUP ]TUTOR1 rv?TUTOR2 svQ>TUTOR3 sv0TUTOR4 svJPROTEXT CFG NCOMMAND HLP /`vDESKTOP INF WIDTHS PP "/DESKJET PPD zh DIABLO PPD zhQDJ500 PPD x |EPSON PPD ]W:EPSON24 PPD =xhEPSON24APPD vhFX1000 PPD ]W Q FX80 PPD g#r GQ3500 PPD ls' IBM24 PPD Lg+ IBM9 PPD -fg/ JUKI6100PPD 1{h2KXP1124 PPD fzh4KYOCERA PPD xh:LASERJETPPD %zh? LQ1000 PPD MgB.LQ2500 PPD GgHLQ3500 PPD gL{LX80 PPD ^WS NEC24 PPD @zhW PAINTJETPPD eg[QUENDATAPPD *{h_QUME11 PPD zh`WSIMPLE PPD n,bSIMPLEUKPPD 6{hcjSLM804D PPD 4dSLM804E PPD 8^WfSTAR10C PPD gh STARLC10PPD pgl STARLC24PPD fgp2STDDAISYPPD zhtxCONFIG PRG kvv8JPROTEXT PRG }5ԧPROTEXT RSC WIDTHS TST a`vIPLOMA !HFTA !YGAG1 BAK ` zHPTDNA ! REFRESH ! QHFTA BAK n!RHPTDNA BAK o! YGAG1 ! PROTEXT CONFIG FILE Ver C B .@ARNORENG.QIKA:\A:\>-------!-------!-------!-------!-------!-------!-------!-------!----R*8EXFILE DOCTXTASMBASBATC CVTERRH KEYLSTMAKPASPPDPRNSRCARNORENG.DCTARNORE2.DCTUSER.DCTUSER.DCT2d,(r LNlA Nb cp`B@(BAA5 RD:`r-pN0SDJ@f`rpN0SEJ@fB@ LN;@[@lN +1f4B@3@BBmN,pNZ0-Nj0-mgN` yD"0-Nd0-NBN&J +lf +hg2NOL<8Nu?/ 6E 6R@g`& j2H0*N0Nr*pN$BRB*`J0 jRR Rf8*F@Jf* AGENDA FOR HYGIENISTS' MEETING TO BE HELD ON TUESDAY, 12 OCTOBER 1993 AT 5.15pm 1 Minutes of previous meeting. 2 Matters arising. 3 Explanation of rolling appointment system. 4 As there are noperiosheetsorGHCs being usedhow are dentists and hygienists monitoring patients? 5 Can practice have dentomycin please? 6 Can reception make more use of cancellation lists for hygienists? 7 Pay. 4&y0` r@mrs@I705@0TCTD|mBD6<t`PzD<3@sP70zC`UEsPeTE>Ep0"KAPNN7Pp0"JAPN:5PXDTC|mBD y8`:2@1P|l1PTD|mL NuJ@`1!U@fNuH"y $A$<rHQRQ"y A*p rBDH6SCQRQ@QLNu yFGfe͋4Y+%ٻ\dF6~ DECEMBER 1993 No. of pt.s failed or cancelled Time lost in hrs/mins Wed. 1 Dec. _______________________________ _____________________ Thurs 2 Dec. _______________________________ _____________________ Fri. 3 Dec. _______________________________ _____________________ Sat. 4 Dec. _______________________________ _____________________ Mon. 6 Dec. _______________________________ _____________________ Tues. 7 Dec. _______________________________ _____________________ Wed. 8 Dec. _______________________________ _____________________ Thurs. 9 Dec. _______________________________ _____________________ Fri. 10 Dec. _______________________________ _____________________ Sat. 11 Dec. _______________________________ _____________________ Mon. 13 Dec. _______________________________ _____________________ Tues. 14 Dec. _______________________________ _____________________ Wed. 15 Dec. _______________________________ _____________________ Thurs.16 Dec. _______________________________ _____________________ Fri. 17 Dec. _______________________________ _____________________ Sat. 18 Dec. _______________________________ _____________________ Mon. 20 Dec. _______________________________ _____________________ Tues. 21 Dec. _______________________________ _____________________ Wed. 22 Dec. _______________________________ _____________________ Thurs.23 Dec. _______________________________ _____________________ Fri. 24 Dec. _______________________________ _____________________ Sat. 25 Dec. HAPPY CHRISTMAS Mon. 27 Dec. _______________________________ _____________________ Tues. 28 Dec. _______________________________ _____________________ Wed. 29 Dec. _______________________________ _____________________ Thurs.30 Dec. _______________________________ _____________________ Fri. 31 Dec. _______________________________ _____________________ HAPPY NEW YEAR \sU}g%y J݆!ӍF,}3WI}ܻø>P}9e͹;z>4I. l[;CSMn>Ґ&>pnVqAHF.ux]&F}@?]ڬUwwҿV:]EídL̎6xXKGlJUO2ѩlkM$۟kqhvq=wsh*/lɱL%+P5ޓw47L NoZ_r{Xi!ڐo#i"o}kXzKrv>)O ϔV+=%F>2d6ta&fxnMY;Y}cET,(yRUH}NuV%kB 8irC*zLݞOI}?xeId!EzƗkԮ|f/rf*:.{3赶%2 ;oMu|+:u$q[ YoBemyǂkLJȗ]T!J*apEi'&J:/(Um)#&3d 2Uʼ[g./Vs>sz5~_oc3 1L\gP{)<41uqOgƨR}P`"G('X`Ql˟,Egn =?{t* qE ǿq/:/ w{|3qmQvZ<[qKgWbEg_6qv (tȫvV}B~&ģB.; 7rUtn0}2tiF噲 {7*_#^251ij2 +0 3%Ik8&bڪ3׷f DECEMBER 1993 No. of pt.s failed or cancelled Time lost in hrs/mins Wed. 1 Dec. _______________________________ _____________________ Thurs 2 Dec. _______________________________ _____________________ Fri. 3 Dec. _______________________________ _____________________ Sat. 4 Dec. _______________________________ _____________________ Mon. 6 Dec. _______________________________ _____________________ Tues. 7 Dec. _______________________________ _____________________ Wed. 8 Dec. _______________________________ _____________________ Thurs. 9 Dec. _______________________________ _____________________ Fri. 10 Dec. _______________________________ _____________________ Sat. 11 Dec. _______________________________ _____________________ Mon. 13 Dec. _______________________________ _____________________ Tues. 14 Dec. _______________________________ _____________________ Wed. 15 Dec. _______________________________ _____________________ Thurs.16 Dec. _______________________________ _____________________ Fri. 17 Dec. _______________________________ _____________________ Sat. 18 Dec. _______________________________ _____________________ Mon. 20 Dec. _______________________________ _____________________ Tues. 21 Dec. _______________________________ _____________________ Wed. 22 Dec. _______________________________ _____________________ Thurs.23 Dec. _______________________________ _____________________ Fri. 24 Dec. _______________________________ _____________________ Sat. 25 Dec. HAPPY CHRISTMAS Mon. 27 Dec. _______________________________ _____________________ Tues. 28 Dec. _______________________________ _____________________ Wed. 29 Dec. _______________________________ _____________________ Thurs.30 Dec. _______________________________ _____________________ Fri. 31 Dec. _______________________________ _____________________ HAPPY NEW YEAR Sat. 6 Nov. _______________________________ _____________________ Mon. 8 Nov. _______________________________ _____________________ Tues. 9 Nov. _______________________________ _____________________ Wed. 10 Nov. _______________________________ _____________________ Thurs.11 Nov. _______________________________ _____________________ Fri. 12 Nov. _______________________________ _____________________ Sat. 13 Nov. _______________________________ _____________________ Mon. 15 Nov. _______________________________ _____________________ Tues. 16 Nov. _______________________________ _____________________ Wed. 17 Nov. _______________________________ _____________________ Thurs.18 Nov. _______________________________ _____________________ Fri. 19 Nov. _______________________________ _____________________ Sat. 20 Nov. _______________________________ _____________________ Mon. 22 Nov. _______________________________ _____________________ Tues. 23 Nov. _______________________________ _____________________ Wed. 24 Nov. _______________________________ _____________________ Thurs.25 Nov. _______________________________ _____________________ Fri. 26 Nov. _______________________________ _____________________ Sat. 27 Nov. _______________________________ _____________________ Mon. 29 Nov. _______________________________ _____________________ Tues. 30 Nov. _______________________________ _____________________ Thank you for completing this sheet. Would you please give it to Vicky.PĪÌ&iׅZ+P۸,_D2wM@A_a9Q(!UTƴفo3} 詬,dTvס@C]ʴ ڙ/I.)jD d!}t÷;V5S-Dae0LCS㺨a2⳶=<|;[ꙍ#:) {a#[u\#u쯧Qym2ϩ5󸕦bp@Ӎq$]i 8{ H)2?󟔒Wyf\eɤOO)b݉e8K{yebYMS7>qXQ> Fpt%j0ƙI0iwd{,}DN2lvZ~éCG/݊Γ#6 %VlgKi+Yщýj!sDZ 8?^gk&"I@2 Sk*L#\7֚{pNp;6eY`9%,XMm0n݉=$L h3*h\%l:MV N]쿍=^)\gQM];|uJ8rožrmK 2Fs-,E SZ.{kNYAm{Ur=9@Y wB2q߄c5G8bsho7]O+贩iEe{t}IBڨ )koz<\rbciE^ ץ]+.S;D[-[Vcᦔw !ʾ]QzƋ D-& ρMۛ7Z𝙱ka`e[/5 nýym쬰;5 jbWgޚeKm}Vδeb{ mxrKf_>T1Q/=H1 N&r}p}a|#FSF2uncUX&|{Ԗ M{׌%5+YD 秪_.!SnKxVl$tc^yKtű|QoՌ?Ps<\>y*5ksm+x*=U]ď++W!,в=6l:*YuVߧ,'/eHppy]ހwkdNCr~̖u=nB ]XlD6^cjM5__K7VA$|tЦb:w7"W+㽢_¦=֊*8վh.'W|qC}JUNb^0, -lh1-C( \disk\maastric\may1_92o\>ϴ}ijsTw?v`;_UK*k)aϮ.l^hH|Sv(p?xyWz/c"6_uPr 9Ěܡ juAYk.0}oyja R`v˄<ե{i(WU%R}$?tTO!㇪D6d]j1{$_gAL '`oh\ zXVW=\G,5aFn v71M&.A=&$_78:qV,qPNSߴѵX~);cw+2husyy!1Ro}x\m9&$bbFMJeNY[ D`O.Θlp9J7m śB2BU(`p\YuT9o,›A7T U/m$;pg%Ȏp_l6$$V$g%RED5eBpq$![$ "[+BL7 =  جfS%/<4A]$RMSDcN ڹ,fthhWkd)ֹR*%&˜E28?1XP7#2f GXbZW$4]/+oX~cZx.N1P<<7W沭D#%#B~3\tm9V(}(f-%o,%vle[wy(A:T"rj2*/w7>Hz)9]}uvIRt93y~9dp?1r3 3oޤ'RT#o!D#B&8P$OaN@=Ō|b=f/befҿ{r>нzpw _ؔG0v$x۞$}F2iI0W.By#SV=wNl_eNJ(*!ncw0oYϦ;mI;.SkqR\f^0oB\qdҽ1(&}slޝ.-yunsx"+?e'5'%]zkA+2;brw/6;MIJ?6zyo')Pm+ () k8m뜰_Jk:6?HրXb*Z:K,v1 :s [- l.m)[',kW'g; )V`re-~nYIX)5kW:Es^#J;kY's*L~.]\9m2(xY= K6X^B&:J[eLґSM㢀W^ϔ`_&o=N@D"VWLźo#"ҳ?i72e 4'8(WSf&eoJ&aăD`#s6 (Suҵ\P+YJѴĬbh55YZu { z꒰QܼY".eBbGC߼E-=^u8nWK$ddԭ-fwשgZY7WB{n앰Coc|%  (_ HbZZX+5)}[~Bˬ=Q,E # K318?ٸl "m_FZhǺDdבuSHx+"yGYuS+q 9Hds?>>"v8||54"9ɌOljkW;8qt'ޝCB&}-g O#EpYB ]Mh*EۑI=itkjrR,s>}4Rc2FY_%>bJdjyAdnc356Hԩqn*d44? IaNԻ:;jBN`>~Lr=>k[+_=_>> œ-{U[5$w W3BHp!:aǤN?u9T>u"y7SͰMg,h\ Y/} Kfyv;v G_xITmVǎw X2&D|x*|`tnt m=臛ճ-1">dM%&,ew:]z紗}1xe5)GKPoq( AʀpRNq!X=Y);SxmKֹXyBnzmW_UfۚrFRd[4?&$|.3ɉk"ٕ߮3*/v m|_31==m7<Nk߿+ 0[j. +՚ ^5@mwwN5?rhY#!E_M A۴>jѥO}_ Tu Yp3ɼv9z|!Iݩ`[)Ӑ7bTkchKJ6߂ÞnkSi=uQo3~uʒT?im߁'8.UtkCڤ;e6pы-C/%S7˪5lKWLox{G͹}`ݑ7@4}8TeCŝ:ov" Tmp5 -KXt*0dj]WܚeFnY]LlΪ_mHL7%ܿjkWc߱o+O~\Vk dx#H Bh#Qݠ @=eZ~X>:x>b1w3aRg4X񵁭Wp!E=y_P5Wp;v{=ǫ53;Ƅܙui%F6<" /12}yC~Π`Ȗ)gTq뱍ۙ9 C{bu_cygpXqYv}Ċo:1_A?zd,? OOR),nqgt}@J*__]Z2[UTL=] %P5u*ߤu>B|Gi^K]GgwmgSlZ9A'ռ 2L3 x*eOLGC\H[U/~>mz+tj4~b/_B&9׿ؚēmpVOqmK6I+ cf&lj}3'\ J(6n8qNa>JlS |=CiW`Iί>aٲ&k,YgS?~-AonHVݐH7GzLBBhz$ޑs #-m&vNo~xV2v r>G+%c\);-XlS'n?wPʊz5UOE-˨sFLv]8SVp'ri7nC7nmɬ#ٿ-7;5#h;nVH$G]L7‘9x?\S9+jfH$ _UX7m~LI>紙yr4L&@6v訛|rF(I3!5'LX@vcw~|[C:+> r.|UGD|qs9G 0 w Lg1DNRKsSe/[m*þ(no*׭AHy}V{^~ ^,7^gkWm%weHC>vI>U?7szĜ^>7/ZCqz9K g 'c' zz,fgC;iY;* 3_dcp/ ,*',B; ٍ"|=vƑoN x|m. k@(K=Ok ?ߨv8Jf6i<:`m!ռud(Ϧpa)lO-#rO.g+B4sGhk>з#M3.gs⽣&ig!Zf&uPREL܄45;4==9WOB4M-h6~kK *d±7b"L;c Ns35l']n~G(io';ܶQ7"vނMLնgmw]7wڍArPV9x4oHv-I3kR~^lQ0ONY mk,^;Kto)gN= Fh:7]Om`[[ݍ5޽CE4MZ*VPSqGS{*| ws%0/O<a<0o- J#Z~65ClRyC8q([Sjђg-#F)>~xG؎ 9<#b _^cs?g$8hyiV].B2*ҧzޟNdNsaAggOɓ,͢XjvfHL•x(Tt c?J} rmG ?} /zv|Ua(J5&H7''K{L[5܍b/a|\f)ܡ=Bl(eىwˆD,dǍ:@ At]qw[f/>W>̈ 7 "NOU u}ZF@Udb_4YCot;=E y]Hno'Uˎ91!gMĖTȼ)V["G?dfern`٣4npV``[nXf<0NI<QL(YqJw!nK߀WO0xyrؕ=>xofؿS2̝R>+nL,EN ݩܽ/_Ё-ur8C!~ٮ˴ֿ>n34<7 g,ZkZd/ @xpk5o8?*ZĔ%RV?,4ݼv6ouJNO5[?lϚdj=z"_e.xP(8`5.XjAT*Ð \pQً|%c/8M:V[sb6-nZft[Gl3ǟ4wHl~Qo{$ӕ5s|CXטy(ll¯1vns?r=|G-DHݕ@X ؘٽ?sVKnz&+Kce\~*z$.]xS3)YfսÅX;xŚQn#Qߖ9U?>}i/zh5ڝY;uCaoW~$C E0Eq@[aJ/ȑ4ߢ_M>._Ɂ&?WYmrpMNJjZQB+͘RJ(L4U :VOˣC*iFOY@Q<5j'W=FzWW˪d]݆"xO1UyQV]_ڎTRHD럖qϺ >Q$zgoJ6ש5(+ii {Ү-?=I!.q}{{EFE%2kӗ3g4ي{lHe\91oNuS0 .N؂F_#] -J6xpbPMz%dj ljqT^HVh"\'V->ӛlmY䞋ġm7ØqL}{LPA`Lws0E6/Sc{mʦx!tzr4“"}tn-:o}zT +{;C {>XeU}qϏ-E{=toQL>CmE853ޓ=z ~^(": OK_Ɏ'q:<*2'?C!W{hҵJ)߉Yzkٸz:'痢 \R}l%oLM3_ Dr"ĪώG>r=6 IGhodzvdٻSLdRуyfVhǥe%5OJR=r)xs8 q#|$sQmޕ)>+e6|enL[oQ \D표!c5 -/טSOmnp6VC =MM?T+n _k~D(܋e\::]vXȖpfOb lOeGdɾz/RIykTg؛ FXuaJY?NԈ*e~z2Rk A#Lཌྷ9D=R؍֗}=kltQ󔮯[v:. G&cuc ~#=fW j'8q_JRo%qtcE/a! vAߊqe?VY[~5[-lR9?ώ>@_XIA\ӑ# {~%q[ Ŝ~=@edQOG=+nIz@ւ_ xAk})&E3.BLďZ]ѾyXdvwoS+5G[(Ĺ'ƶ^̸+A-dJpu{t,[dP op`X\#ޡ~0#@3hw+h8v-o0/ ?2_}46vUċx>:7+oE>7h_"2"htHBVHw:GP?ЃX?8ȫ^|IY^h'm ģO% L^߶6c͆NL?E=pH*[ەq=˗hX։K+T_Q"PSvRaoqOh`oèy~ɋE6p7{=z0HžK\w8Ẩ+'?mF.Wzdžp<?_ P@ǭfSk2ͩݛk]a(w# _CU8MSN %qfCEC1) ݟq^ rG }IdW͢}e^v * kܱsdsd/uI{| dǚ^ GL4~zL -*;06v5>:_AO4^ę&/}ivR:5Ƴo~'RUEK~hs֤lud(7,[k,3C%"}s@ݾnzs`/;%t_eԢϧX R؍ d^[[je+;}kaۉ%qӚ4B1djm;yh=#8 :{ܦ^?SQҘ o;h<ӀY4,oD9oɸ'm"}nqj=K?h~ zAӴ|oc{A#y9wqoq#ߏ_凐 qaSLz+"AÃHI2R1agV/.I#ѷ+UjU{N"kY_oAzEltcXbNI}xa:\\Q\&w{M%M{7_ j=wɖA_ ~7P<5w?h|3_a(oz`ZHx>G4~nQu"kD.E䶒T4yyx$`vORn0{̫iiأUߟ1*A:8;5}_ tfEpտ\gs\w /'/w޹}Hc+E7_/[O_H^3,R˕9ksK"/K kaCBE&9v'&Z,qd5XU#ľ i^ۣm?ґч#l}^y0_ƽUޠܽa #2'87m,#I/z>[O*7B_)-435|w~x~>-ꜶzCFC"vP[.cZ"cʫ+%l,2¯ч`o~MCTow51^$t>.*'Tb6P TFow>ĞO;\^]2!58GM7#O6ѮT*Tʥ )/qN)m`z?I_Y1(*3A4zM5vrk[\iG:˞׫-MىkNBԵNI,z'B(uO'f{15y6_71JB T({%,5 fORYvf= r,@{\DI1c}m ҶZ?L%xn8]+}.hsۓRwL,Yvam'~.VZF g $i.+Zxwu No,`t{'w-g+`3X¹NY}Ϫ_T%Rw&u-g]e{T _6ߡ&[|bl4MIPtVh"y MLRfdxQfrQR]6/QegzCX2Q‘O&le3F"U`~NR;Ox4] A3_pvbjHⶌ\WG^5䝳DA8W8*f6q a]FKemn$'bϮQAb LJ2CFJ(3pV%W$PheMiE/ek>w0~>B @;t72f *DfOebF;, ,{-Q&sdI_]=ǩgV0C2hܽ_0•V['UrO]VzgQ54&3)]N42V嘖26mm4]k+pUi\laϙf3 {Mii(p[n_뮼-M?`! e51qA$Fr />@O1Nihmwo1ּ[[b=42SK*N`' 9E1}l4[Y/rN#]>ɳWb1ˑG[ *$S_O'.:KLO#weTM ږa>Ar%l_(ԜstP562>*j(p|d]D NC,0hw|VݗWYd7 ߏ3'1c/.ܟ_ELfwu.xcjz/| Ww^c(F _L]N>Ij '&o%3=3sJv[%kpk^-su[1K g#|l]QER$mG.txqӴh}ϟy_u^+5t]z kLRГ>{r1c05Bz{'E1ʴӤ,٦p}8'|iUSk ]J*+K: pC8L˦x< MAF.;OuӾTϚ[?|X's,eEGXWa)n.EnŶ{z鶝~e=6.3xo~+pԷP ru[@~N5?:7ffgw&"Ox2L4ꣁ?t~׿pkf V<0ґW ˸X& V=@s?s3hѨ =2s'Ȅ곫%:Ē*i VXף5=Pޫ%l&LȖo/ F7M<7ǔ 6mJ4GyY(~I^k\][[a٢4Dik:_Ix3HܳVrۜk%}Nf.ݾXt?#w/v_s p1 XM|O9-g>}yufz|qp,Y ތ\nSnbLtji5[ďZOIM$׶6Crӡ>3㯤v3?eES =O 1ݺݒ@9O8UEJZNDr Y6tiZF_dfHф(" 55߳lYjypo}#/[}OFuu|1H>;:tmhꀜOַ`O n}U.ʉBO ęGg}?~5<<ШəAgw<~x@sѪRCcT>@~'hRS2#85FfU^6@]3mVt.cg;"~ ]=SXsdfutn#1; 2uS:iiƠgpھr-hkOt8UW'>i7}WŤG_aqOa[s&vo6 9+g>x܈ "*LG&_ZVX5Pwbn[3οKJnK,ҍ&cyr5 > M-*m$n6$Ϫz3UeTej9!Oy7MdiPQI?'+-$]qKjhP'H:ט{ F#c{mW{f[y7ĥƦ$~>O睞ͮ_/m?Zý3bn2N2/Wm|9B,J 4d+}V}pԽ笄} 'K^!^~^" GYvo/dS{]6vjݜXZFl|Y\7A\$זuG:C/vc[SΤ)X%nź! +u`žoF8@>XOp+X٥=.?9KصW%Ն"}g0s^3])`}(΁~U.7)B9DsF}e ɣ?p4Œp"$,u|sV?zvnkG43!lȣ=Ώ4m};\5><=5U}#4^xz&s~V̋UG!n´O=w(k)}wT0m m=K2hHX+K _m =g{)ȏ@DYk;hh4OcONhjre 2 -Y 7R*>Vlr wz3K8EVB^3YէjDs$ ÙLZTV -{0\sc;aJ䔎y>,-T_iB^F -Mw~tiȻ!9rܙױvgR¢!!GE3_7sϵ`"/YЧBfq$2]KMq;}uGɵ\흸ր!48sOIUt}=ُYSzRlʕ{d*\o>7bg=:pOH꤆\I6i#ŒŽPJF ]Lzs/OFe|4R24J zX:OFW{o:O>y͜{DsC[mtG&Lض']=էGXN:73+T"(fg ,e6 :9l1m_ &cJ񋲍k'#T~ n7hqW[+(P13E/Z;̺;xy5Fem$nByw񬙈Oӫj W>yZ|w{ѢĸI13u~U9b%l¹Ll~୰'3z+J:I7r2NY`۠W=ƭ0|.<|!%IGljL {*T0>GSZC<-wDuOѕ <2<]t^r\%eFВuqoCHZ?~DVjUԺo|5ˡnNRvaO~ͨYϬFwm?MѪ7p%fo7^UZ_3w`2< 2uCJV|ׇ87g`+hJOmM ԝeHgx<~̕5Y/3CaʿXmna 'K?h8}bO\eήDCI6!]8|8?0qei6i2hw~N GvkYv{Ihgm -N#[-qdEI=W={BM6#mi}P<ކ!%&C%"-":z:o~ɟ+`m,,q&횁˛"n=g;&y[5i9}kҾhzHD1fs@g_C8DBkORmt \~!݌Is+تYvT'*j[ūM@+})Y8ܳ@pe:`<}oTdJ,Cc 9ۘ}'C f)ŋyY2ʦ3%> uEcY`{fQ[61 ߒy4f}KIz{~#C:?o@#R^)lBnrTK >agqLS鞬X}@_?vlCZYT1Zaa~GZiJLKV7 6G(,_;ovm#|S %JXh+@<)H8DJ(JϞlӖ$iQ yW`ŧ=wSsH-kGBʸ[߃oIqf/C,dɹ:9s1F{i^~]%Z]ƈ~:UY%6:*o.wsbF2CN){o>(bMo TWn';kY4t(x3l'Eg+PȌ]vW]SU2$^ ۤ?bmj1'%dڳr䏶gfVpRxU)ͺI5<,aR9W{x}J~w?VlJ܃2>y~p#: ӥoFu#T5wM2u/6k}=<缯ZF,z|C3i ӂ|ߺ_BI C^Ei23y|Ɖ,{u͕[zj|1BކhkoOϦfl.~OK/Z.?&؟},/Y[E2 ;jYf!ty4ݵmG-Qӟ^ӸLW2(ߘ,p}K#o=n]au+ "|铃W 9+gțOO{lv3Eѿ^}ǁr)Ko^6_ƟEw}sʣT9[?_K3xSXj0Sy>ʮT5#ɸdYϑYʅ[>ׂӧEc!Ցs m: \5wN w͙F#{="H{b ca3} ;T{ι4c|;.xgfI||uw7QqsiTY^up(o~*")-FJcgٱqД,џ2VS.s:/謄*}R$ @%s;x;ҙ Myk0`ḩ}d}p5 _wg2|0 ˲s}Gf*tgWNp2n/&#P$gI\OpQcgbkMK8lbi'ן^H4?7ňQ)Y\+|<P6oEJXEfMth^X_uM߬lm c,Ը?>ķlp]sBOlkMYJӛcNf^szsqŤ\!/݌Nv5{)0^|*rڗ>|Mlt?+ oC']r~PTv٪ۆK1ن9~6ό[_8#"/Sy֎]-ŨRQȅfkY&LcsN xu]uwu>y||>[a4?2Ϲ;?MQX_5N*Ej4㬬,, u|nV)RGlg"X$EX1NNȳV/{>tzkJ3 &3Dԉ ƓeEw(Q3mΖ5L6RsAA nr9KOPk+59n"/]rg5䭘mP%]Gat|[ﴷ\ ג+o'N-7;_}(G꣫K"gEnţn㙣~g{|;N&l9+iute`IZKbSѨc]:w6]woߛ l|OO_!p,|g7^`MUM:R=й_CU!h{Kf>V`$. |ΫzC?lR\ ^rA|n_wv_֤wQ1^p?1ٮ{z ;ZA䧵u_9U5x w+>aSZaw=>oE@7x#n1K:ئ e N :ZAcoWj&72,wrǭmS2,0 mٹ}/c濗'F>g) ʅh?}+m!72CǗi/m<% ϻz_1F2lh/y(G ީ_/T-%^/(x#1, ?WDa={ sXO3@٘ rF>+/w (<1'uuiر?\=X@o1mŠY[+p pc="_I˔0|>ϧ)6x;/rxYFWW^eEשyq2)(:%Kz/N;Iw}f~wgYѣyyGQπ"veVM'U5wl2_b\ xKPzRřźӟ' ? 6) f3sb> C沗[Ѡ/k"&U֔ ^ȟVmzJԨܗFY*츋좄Fѿ^_uWh//,P[zh:ّ|\NBt{ܥ.G05 6k(SqX+aFԧԴ`Ro^뿥H}K9|Z+N;>qd I}3 Žt$>9(d#Eh{MgwrM|q*B;DZO瞽/$_BYC;bCWg&yR ,@De SʛIOr#g`/z ' FM&?&WgS>8F+#oV458<^ͅ"_K3ZE&`/-]ߢ8Q[2h|uOJ}aJ9FeWg7)P`}y$RczУw0KMPwE^nѥru}˳-Wy_\ߓe*k] 1rceGkv@@*5c:S%"<u`wIR,jbU dە XzIIh_CfIʭaY'f<9o0~mAb}Sk? [>6i"4 ;*4G;^WQj }#b&4}O"v,saLwsbw} )^- M*Ы  <}w{k>YR4?"Pj= ,9*qJ^ ~V~̏e񧧥Pgc ܲZ08]8!瞕f$M`ʉ޳0e&JHm_Z0= opS|u4sG)|ZqSSF>_lʃ!}+WCvߋWZY_`qP9^SEn>݄E.Yw׼&uI(r]?SG*4bז^[zٮEN5;s̤O ֔e3CD D  FP$fSބ.:ȋxqYPlYBƆtyɳMsѾ!(zhs('[Mg_^RZ_@㶀 %=ۙE6ّS].0̬Lby_,k{vA ?7?`oz_:Y^~i\ \v$TVOӆû4.t٤\^7ᮽ/*eu_e%ϣZvDkF%6`D`{df?'(Qo$ =ll/6ӆ}2#sM4MkrAc}wyؐH)90Ld7#kk]?P˃}Ŕf|GU^{lc1 i6KyT\Z䭟Tgt9}Sm78:B:3^{vʒKjӮ#ǟoA. vGGzwL%LX㋇YJZˡi*p j-d''{7/xOi`A2B4ld۳\rk #w{lx5F`D-ăeOو_kPv[>Om2 \엟}w ˣou-T\R 9Eb]yZ>f5~M*di?h&"AazI *1Sw Le k}d+?gˆN?tzC:5\ nuSF{H51X*+"4]U4VQO9"=*AbRK׳Kry?bf_??_V/d"CY7M<mdc1ۧHYUew v׷:"}f7ETUD_|w2ޱWeIGl^ KzEI~8Vmya٦Nb}q;l~X3 NnʌmЧe8J>$0 VY !>iU??uؾj+kGnUS7,]jjVoQJ˖ƭvJ?bLx[Ŀ6 )J!ҝe=t 97CwȟZ<_Z,fGLEe?}&UHcOկɶ$"jLLQ^kG],ԁ֬ד,}:%Doϙ8h]ӷ`E۶).h4#,BDd_V%ՎM@`B俘X_9L$eSX nSԖ@[D]MѤ}>aT3}{=`k{ލtC*[Iڄ'vIae?AKS\W2̾"W8?^3X 9 "|WI&LJ5~;õ5l~Rd O"3m|+T5_̈2I]c!1w_|0 ?=ޒdߖ<䡈6nTsoaWdFI,5h&VXpiu8z(!59kwOBE娪9F4^vHAoнA3k('Z~P4U/@#ۦq{4C1[@0Ubx5ֱGI3ӇURR~C|(/+3ruRz!{e+'vb6(3G֓׏~5ln L #y4ܞy9 +*AݣVO>W>M~Ν W֜wo:QQJ1ٯxɁؼC/f٭^sx:{NIx-`/K_U['l¶,~7( ̾ &SeaeU@*8N#3)Rh]Is{C ^\$d!k=K Й<#"BBd뢏8d<ߴy*p;>t*$0cϢx=Vwh?y jE?B6,WO,WO0y¹?k0eߊ$ޔVVbO.LI8"}ʼy|LW#(u;> D;Q&\u!{.97Qv{'Kw(y-=+>cw{!:cO731@xi~Jeh`zGAmV]jGa \ZLaiZeyVWS|Ç ewb9i*&G?a}y]s~H@GKV́c7❐_PUZ_B_&͓{ ze=^MsոEk3+jWC+Fn_ly GwږYڍz| Vƿ~eѡW^<#]Ľ{t=_nl~w\WEM ??G;Х{̗V:7Vtk[ p`Vpf[r$Wq!dޡ_'oϯmm H*l4dFwoM 56nx-bbz_nuV g/ʹ%{?6\k˯}Gب֦H*X4p^ YұwWC__#~Д|*@ld( _L"B% tzaXᴆkj:&8z/N.\8'W?t 4UDž̹?"x<zi)eGφ_J⳥KoC܈E*2g˴kuCi~HJ6c׌x!^7_?zg!~Y%PW)k.JssP rWϢMn-=EJ17ǚңz~; FZC H ,=>l70ؠ%8 MR~s{BΚBSOT49?E<ԓX5-Tgޣ5**m9/lL g~t#ø|5_88l+--wE2o4<~$.@+ I6vffvDXhp8VDݥ*:ݷ85`PaUd9⍿ ;Wvo9#GܭC/\ռ&v.^:Ji u'+UnkU '__~Mٽ/4Ɣ.*W.^.TgWf`]m'Erp>ڙQm=ƽ0pM?%r^~dϿ0w*M0B14c)>jn6~  QO=؎1%]~iu}g%-K}!oYL>[D@G6sx"H45tFU7ѱ@S|PEea3d ۅf|Zzai`^e*dp*u/e&]SzaWl|~5O}ט+ϪEIp_`Lr?WSS "| |ż'LrSgw[J"~~CX_7aB~Jz2c1/< DZ͹otN/*kZmmK--_k8D z8Mλ<~JK-cuOuh++`̧zG/Zd/KlF~Q*^o rL>b+O W26dZB5"i\kF3A6K.J5-ſN'y@3?TKXB_gyomY+=a6Fy37n_0\mHDܚږR> T%~fUBک:T U7/ Y/l:c; f R(΢[u`un=u}dD8b *v-uզDW<:=BNc| Sx戦|gef!sDӴ<Vn\[H"[֓G/ܴՂʹjYY ZaWI\4q~3t0jeqck/.21m-ףe6c5#fb}2+j6.j^G;/M HS_|Lq1V9̅vtgףsn 1҃^mϷV~$J2 f&TbK֦uqP4/†[(2*t?30osF^/'?wiZ˵gҊp#J[-lZK\ZZu|:3?YPONfrAU8ۧI>H<º=L$Y}YMzZ֨PoZY!'ok Z~ů/ g)Ϛ^t"Vv+>TF?T،g'u4W zrh9f/\+T55?ΐKADULkة oo䡩bX=} ߧuSDKdr#5Ƴldcbxo1k?qVM6g67IR t1ʘ$dG/vҿ򁯒Lm`Pko)@Ҵݏ2qx` ޲VKO\h`$[+7]W*$܅{׫ag2k? Bݶ">Vw聛0:%/\>P)",V=T쒂H4 eimmYVT%/[4wK0iY  u;n+/u*G?9 e?tD'=" ,,/x|Fk 0E֝T5p!zv6 Lpe=y%οf'El;mek3X͋dJm/w!Ttej6,vg/.q ].Ab#YB6O'S"7=PIVQ}~ďPȢmeS_d a{OulޫXς|%ʄho5&:7~C( ?W*8Or:}bMȵ.t-=M Q^%t7,=eAn^]^lhkۣ4dzt0 Ht%X j%})_vuyQu{BM?̆I{M- P{7(v&sx`obkQo2IdoG^TX_8ҙ VqAv;5~uҋ|7F2KVF2v+x>NH10_ _ےܓ\w [PD gѶdG)* zx1%Q Lj0PLpǪQu[G#&7L?"$=)0ja˶C;~ѲtUtP0R:c\!>m 8(i\ gNEsx"v$&Z6ʠrOZjy[LיuDLb\\C?ۣ1$y;ّٚvS ^e[˻n_| ?`Uŝa 5#k]?甞YߔNmoG+'E8ٛ+leOY;K E톮F^ϙfZۗ'^<Dr/^=y^6y ʾ%iAvLa[T9*dʽv9z}uZ_xR%WcIh[uǫž.9山AOoɚvӞoD|5v 6Do56\+c=|>aIg_ں;N6#of@Tb<[QY_#É> GXsN^ Y0Ga7u_}C#\9o`*y+"v(Bm>fٍ0hBSSxtǃ8g 3"cM;񳢽 MK:.JwOUsIA-(,-96x>E/rn&[]v;A5f- oһ0iF^vy7Og[[fJǿ_>%Vpt]e!vzp뚸y56&<VOho?ǜҴMWLxP/";>];8i>u +r͟>B!Ϛѽ^ncj+ZoՋh?DʡXȳ[ ,3r>'n<P36\>?SQ5ъ^Wv;4HЗ$Xm6ǧ)b,ǜ?K- /g]6ɽDx䤕VYNߧ5 e9f|d C _(@u(,VSg] 5jb; ki;O]qxҿ \G%Bk\~ c!:#4-/"Zw\qgTuH[2` &zeJW;Wp'kzKh?So$~޲a_OAW/3w~WE=tNc#꙰e_x)E~(s;+c؈O= 8ا4!Noߙ=h;ED Gq(z+K>Pjd+KbXq:| )#ZC˻؜WQG0 _{U} ryxD,6Ī RWۃQ*keCHk9zjF^ v[ ݯwC* x_׃Yko1K "YF\ǣs?G3M.uUؔגz7%>I++ӄku* ;yp#Kwm^T3|At7yI|zIJX̎"Odu{X.^,VaGX|a^'j>SzA_Kٳ֧ۘmg6 YsڼV=YQ6r4t´I M͟*:n_MUyUVE*tHQnWʿz֣ҭ3Y>i^ |d[Z9ND Z[c38b?gpoMhM6@ SV/۬}9-,-Ex_ݫf׬P\^yeyC2YӺvSLq{q]c=_3D[NerBX΅P{F8^ ƣ:3nZܰkFrƁg>?k^:ۡn%in剖?%^mk|)}ǁpخ/N7»nHn{˝q2/ {(-Bo,ʄ%+( ae=6r6 ~ɻe=qx6W71҉1U"TO/M]ҏ\!vM<'h]>AN76;`! 8vOnVB} xo(~]Ze,E g^偁4[/hʄ v>k29ԫOG*a=66V\U:'yɋlL6?̅6?GKw׾kr&ܒF?ȇǤ[wܝ@5kgփF!Ꮋ…6XEn=|N_z_G }ck|:! /Q{nmtsJk+ѧb`qpK?e%jqU ktsZ)*P_.oVkol z-w\ިR1Hb:9|侽u,G.(>>klxK[tWt#O']y}!뵻KQ閸_xZK\궸V]㟄u c 4\ QSyYkxb^W"Ctߢoa^-o:\s b[j\ Wrt鼢 m[Lt-מ!y3 ϓa?~l RN[ϷH%cRW_ 79|sziqS 8g&sjňJ97:ȇZ#_[(^Vy;m#{zЁЈyr LhC&*,_KTqc$˻ ݁YuZz+Vl,We]w Y{G'm%Nf:;pXKF}Ckv%@S֘d)^Svu@խf\;kozBTiy9|"{IFT9iSRMʼnA퉶gU>xɄs:'~LWst@:ͤw#& h@V(I靥*O[^L7C](~k}V*3١d Fɭj'ދKWғr4[L߁?KZC/Z&RI9J8;WA|:C\NsQhO*wzv]0:9m * #FT(@.o-lh1- ]= \disk\maastric\readme.st=}>:ϗb`_]Yﮮn4#V6+O8e,ve1娧:II'DegD |ږ{[;0D&xk|H3{tnޫjP[2(V)DBxim9 1Thj?3(`@i7 漓(je_SP˯ P=x $vCD넯[!L$h: p7@Y8sb:~tGΠ}וIO/1Ϲ([UE*rm:(OM"B(**ƽdmK4^]?ucLFAG,@ 㫰HB7Ese>H߷Yt[~1<s?K溞]+P5`\\{1?A^{bsԔ.tֱ.u{_?6ݳlpb|qPѻ|gwk!7ha[xl`Y؄diapevӳ3 5S&L4^W`-#JDm"2\2FO|"#$OXtpZSMKK7um"L=rB{rya䎞rztN2@&J.Jj۷6b(=S]E_f K/5I*Ǔ!ԫsg`yny ̏g69e!0dr{Ӈh ]l߻,No#c̀<һj{X65`խ鿾wݗuMjϲ:t֪ڴ׿͝"c/);({sХhuclJR>XqT`LI=xd$,u ~ sII'Ŷ##٘wZM=MqǠ1]5n5gIQo8rX> zsl\ENoL?tɇ ~]"t.pٮU[",'6c\+[# \\a0̉'J*U1)gxS``0 mǏ+Jzw.zڥT1,vkEmr?W{r+g-lh1-( \disk\maastric\title1_uq{f377z׋Zե:\ۊvocv+i}>um-FARIE L.^bT:)"r?GO2/Yz`GB'aYi3Ȅn4s&b©X UIyOt]K v"ցL\~m65_agJ- ~Q5| cǑD9O^_o[:׊rb,nӎa:pyҐ~>k;odr2)CMM;^,:z%Wn;|䇯RO=JRםmd7^z eoLΞ`zwNLWUs,3 ] Ŏ sK:=mP\/D.|7θ4YzB|Fc;v&?(jR?y3!2Zq|IWifAz}5YRb TeD:#J',I)b*28֡zi|Sק&,Ql9VB5Hri 'mhb|D_ uLCbD]^;ĬQi*=~&iyg¸H9r7C-`T{tOݏq|+*_LES YH1ozW7F %?NpT1OO#i|Bvtͅ[ mҚ4B.N 0$'H3SI0>Pʺ!uX84kϴ~8q #"}cBV3h 9\~L{:'%an̓#^'? o3r9J2,kX'Fb0+>Ƀ¹H&暓iteoVRJ82_kዤkC2 /GL[5ѳTiuJ; aG+GB*ϞRrhFu/HqW{56f8CQGUb>JSZ@v lO6ޥhԒ^4.VXrH|'.Je.yELUM~x9"c`m'9(\fmܥڹv^3Ͻ+E}v~s4|'eaa_nIHh-d*F߇)~HįXcL fi Y?)L%LV aRl)(K+m})ɚhr65rD9\ ̓[mfcnrõny-xֹqc7ظ+ԟZRjfm.\OuW׈?Aʥ;ɋpRvni stiu휝Z3QՎwҪ^pO',Bg6a[jZAyP*pv`f킭}ʚgJYENlݕPTT{xRnuNhDŽGu |/a[xv1q4&Ch̏MF+b8/&4ߺ& 虗=NG4rl'OX;]㝺XL Z Tj8갓#ygzsBO/mKSMN-!42ˣ^g^#hEӹsxhFL`*ay٪4x|~~S|+-lh1-}( \disk\maastric\title22uq{f%[w\_{8V )tS^Y$*G gwk頹^?GO{8CMEDp[R> 4#=fEDZJ?wL}巴/cBx|e%{.#V׽>6^R ܃ZmG4 D|b}q9?k~l[u^uև\wLO\E NZqn- qmlU\2ȳv÷i~{lN T֔#/ 7p%2#\>lqfDS==fUfgכ~NGg)54[[%=(1շS,ta@k+$L9]׸Wpřt!EA< KF0 %:Hh/`I&"% ԊIX' 6az#g"1e>yf09ln'E*,E<U9҂Oj$>{p;H3?t OqMy?|,.O(oU>|V-*?yQYM=I̖ ~8ZS0"N۴h]>~ZdLJA@cbAA(q-ϔIlwS6=DlTQM,a#a慬( YA[@V3IJ_$8N;lbdM<6) & =>yީέ^iÿR e_J/-KUm9rjzEZ7J3ӇF9Q  ˔ ^Ө*B>7@{dS5m3/'IoQ>xV|+ATU*}Xeh ?6fѽXoK!2q8h­jKяk#^𪢝w@O|}HJ&)8(Y¿Uvw̖^4E= `j:BjUb6ɺ~ dQ3Β]>I c^poN!w\cSALV!?vj+\3[|>u[}u&xt{6Ҧ&hYdЈz_ϫv1Ѱ9x1(e Ssvpc/ Y;鎗&~ǃUqp3R|(8UnaBWa2bU||%CPvrt9}΂OX!>4awQ4L i/Pl<.p2/;尶ձPm5a]n{V.]3Yu\cs)`$L}x Km= &Ww !zo,?i#"u\CI8Uay*Uދ= QBn 9l&@fspUn[*Y L6KUWgT\m:\Wk3I\a:"\^`|m.^M ԰s :LI"uqï| af= H4Q u1ɚn~ *IW\ _s+Fn?"^b۲/ߒ8.InK7ho.mzFϲ~tAudgXuFpi2wk-/nڽW;…k]ߴtL7%;NBy\9oj{K.ݙ:y\voƩ JI)l9?pkS}ȼ1xųLZ?#?d˥F-u_\,Jg R?_c Wr|%p8!OV^d!$832ToRpW`Svv\@^ٱkjU.k_Foct 8kZYٚd/ ߸@ ]]GYMbG.eZsl+G1sqo~>WEG;8Vь|#~I৏ <]_öMm=r~n]űbesuG i أ̾h*pKjwmu5I7U7 >Y*LS.y #IN׆b7քWo9U,SE+_?-L/|1㖍8IXk:QmͲl]3QoA"~,bqL{cf|[jnۅ[̀_lܓbgIqY\gq6p$m3Ҵ=#4vYZycpDf>`io0r?$̷V܈l=ȥ?N &!^\+Rv<92t~/e.Ww#|t zx-? ^Һxp}w \̯';<1t-Cw>2gB=bK>Tme"O ]_ O-d$O<:Cn?"ڳ>8LNoNo*{{/fSM}YEJzdۨ-7a")U+=Aҏ^#w6,zXegPu{ɦ+˒Zڻ0yiv.;/+'9O7i[mN{m(:*EW~nOiPTyGqx2a̶i]Mv#M`fly׀twDM16|gqJzxs)߯䎦&zȟ]G $p=!r}~ӦMef]scФK[F+._^qL*uË.ֈۓ 3]rWܖM_8׼m j8vҎJ;8֧L~*Mv @15xM0֓^ɳS*4+xe}\3̧Qxޮs';аÈǽ ݼ>z\3f+MTߤwryʻaȽa_:m~ {И"co:ؐӱ?a `' Z=({IbLX SgtR83|9]kqgrc=I|iHdcQ g D^.?ab+a ެbؿ 暝i1?ȿLa+}Axtk Q2 Nt gt;;1ƞ/!!lջ ~+1 w#taK|o]z@~WWȾo{{w~i ~W_N_pUּOy?)"y\d-hokƥfU$%\cpuϋ;ָ^#]r҇u'=} YEdpnWV͢_yn|Qo Ms(FGA|ˡ:qGvEjuЮo\g,S)'ӶgeN^LG*1Q1YH3/AC?&T#ﺬ/kU'$ɋ7e Ve|`C`k]S߻P:ui13[{{ni״ߵyqnhex(B,ng,T}%^Z0{+n;f}'/96xPñ+l|NeQlU!XKOPIszhX/<s޺wj}{vZ%l %]mSjMH:ECe%z`K4qI {:9zB ԟ#x17En_OnĹqoU'"FʠiOVdM`t}a;C5/Njx5\njKzOyo|mԁa>2ht\\|pH?^^6 v[ĺTQlW׺l2wnf59[?<92o|&Y?5uvVZtT D(uBݏCRљvJ;»И3u,5=EJ#:imyݹoqv&zhzu{,lv1H=}1&-z:]l]}S 꿫b߿aAm1bl4_ ie@ֳxjc_[~T~e;Fz%"%EʯXk相US*ǸiK|Yr`2R1+7|jb=%$&9+^EzЅ/4`ؾnfh0,n?ƛv){u}08)@ :ox2]jh]}\1Oxl$>} v4tc^V>73&n&Go%So&lndp8O[xR^|!6ga8`uGQv ?b8.:KY`"zwYB)W n0T6fL`iSbXWv܄ſvqg?ٺ?=.򲿞G(F̳v!k;GI@C wGr%we!Qt ڴUWx_DMkk32~N%}#d3SQ{G|G@|*Yxyx<'1(0l9ho}_z8Nk%c;*w}F]k6U;;Og1ОՓL"̎&oJw GI^%-ͼ*|,7}Z2iR;.[o՞$QM-!RX&^YґՊ-Xjj "[Av)u,wbA<2(#^5\L !z`0۲ k镫n!x="JŵK_Nty5rw+ Ej[5D޵ʳ|&c&SnIot·`E!}!MZj;zv76;?Յ RZ-&$uT +4 j;|̟C:|".>xVt sT6gHA{hGMXψst ֟27\[=a}&4U}-pg3"Z(j,Kw>uOKBzfM!t?)]7L;YM!q0} ԫe7l7Z`8[>PnQDl%/(^OGsC; /dWC_+p-n_K{:Oׁ n _\}C38XWc#j#;r߻y&Yn=o0~p0`;s x)-ӘOJYM\A2UxT~zaԛ?A6a`خJw7ỷ8.W W,Ϭdo|com*eljd[#{>OT]74-E:͍av?!G1艺oՁBiVs{WzOâJ'1|t3(9f; Yۘ?7w,U@;8p) z;p~vq!P^Ъ]m}a|7ԭ۩L>kONPӤٌS^=3ۯ}0on(A{nEV>j(3ׅEbb>̷xhZ[X'B) X*}ܬql>ǷNYcc^= Gi1DQ')MDžtVMoSU#b֫<2,•n f_Q4m+r 7a掅"Qg 5s_/KhA:̜O 8qsϪ&6L]/G%FJ_?/K!ޒGF;3VtoS[WެO}|EʬEee0tf-%H"| }_z|<sP7E}#HMl&\J=a7{_oY_M.뇜ޔϿeU^~z/▕ Zz-Y@x/:'XJ֤);Vy\xKϴ[A\JC}ʸ~l]V&Rș?]ZzN&*Lmt9W[q0ζ15{bxRſg$þ.רl59-ҵ`VD 0r 7*=&Һn9 Ng2O(5-m>$q*Md>8) Ś;;?7~/}?`ƭƸ&iA6?Vұ}|.nmv?h3V`۰o/.5l]cY>6?iWTJw|t ǮlEwFub %>_X]7aΚO+ [nqE18>,63ZyCD9:FnyEQ4T>km&бjͤ ~Q~XB~ElO,h{n1OSXy3CV|]۾An p+ZN?te}9&g<u" \Y1W^/9-yXO]ׂMRgk:hUAThMO9(lkhG^-[*%޼)6?:*?_'C4J?%R}?aNQSg(N=D؜" uO`t(oi',Z9\{>*?jsLOō/Ȃ?=4X> ]/ش_ /(僞ܠtN<^4cl֥$E6,`䆛Ly\ )/+f>LjoC/YlPLq2zWR[au;)I V,= ,taUXWXi*uu]zpg+IXe"wS팍!'m":컛JQgȕ;/f_GZY\[G~xuM$d'Y9O;_UbV/V6 l\#)ˍ{K U5/BhN:IUgv_냉ŧmk%%2SmHbX%Ф"&01w[dOxؑ)f!q?F5ZC 1o+Z6O"Ǐg pۘ/y.{ޘ\@z桺UՏ(DYTyR1/j|MtXkDwmu?me\p_]zQ2Ly{u;ZyU݉։CSE\,y+XHE+~#c3eIM74IWVw"$;ϒ_i馀uD+]`bf179kv\j!YO>5GU@$h%y-m{5OgfGE_~wi{>zo܊(NRal8&ڳHM?zZDD^?spO_Ԓ֕pޏ=s\+Bq:+ў7; iOv`80-r^1@ήNmk{[Nߏ-9L-C<$FUi߸NĻjSG_ICj_=4#Xy#p^[{1; L}'LŒͭY}C1άzj=ƴ:-1d>fiAa԰Wcj&h>yïKȇx4FB+L1.#A 2y1 aj?Un\q?vMeEfI:0'fN2ɯXp39͞cb6Q6ȷI'ꅿ!?,3^Sg|/MU0P\F knGW /o\-tw[R󰿞fmGkj&VQ?ٞ`Uyv{\ L!u@o'^_Hx(8[Bx2u|jlr-c0O>`?Cw#USF8iTbYLd<p< :A[,ω97eT%_uT\opn&Py5[dzk}!#L7^+w3X(@m}?PEK5z?X-pKk;= ]V0f^ֺ8?¿ 00_<nmc7+'UY9)N.kC xtvܦoSC>'8'J~X:s8ͯ͠ dk[J{˥xΓ*>q܃[NQWeb-wuc ;tTiA 7Sk6u9?9Az8{ZgbIғ㿳}a̿*܊??v^}V5HtWNƑ٦Ej~6ݨ}K}ou7j[(7T>a;]E1z `Vc +.Ք;]**dDRUf dOf4{Ö́͡-#K Zq^U2^<*tiޛ[:m/Ubd9̢+ߚt-gRXSۭgC1TMܮ_ZH:ƻ-Rn7d1WJnn-^x;0MgIe`%RFe$T[H4h/%aA_PIs1JqQ\~FbKwq?XaRj=#E7/{PU_ˋRfBi&{H{XܻW#[ܵM;xObGr7*4OW+-jIf4TQjn3,)ze:|eͩԗ\j_6NHd-}GϳQ¡)J#@rELunhB[e=6cM f{&O`M;"﫯~H-/[~}.io7g˸ ,£?ݥ  .*QNp/ ψe #5 _e֓џ1;h %|.i/_? N+\ 6HZ^/:4>Z_d1dd7>,xM?!q2~b Ѵ6kQe#'&:փrGA?L9|5ΌG|aH@!څ~gڅϮ1!t |ȼMIcO<$2k kh}{,{(~cOTevU^IH!^g}}[a#=&>)Å'Mˉ0T0 wf9Mk`Zͧ]s8&'aJO,v^Hs 협>[?'bcMrl _5e<D)%ߘ}$G<@-\'& O3jo' /ÊS/Ոu[ݭwb6D_aTRsOW;l_ ɫM#(S혭-^>[-eI40UIms? Ӌ}j؝Q[z8s"J]GwҸ3&FmNC7Ze`Wk?o(PᱎXfwxJO 3 xdC=TO̒ NAmgFNg)?K $`qlR~R~'7njn-9`o^mFd[n5;> Ẍ,XQio>waLN4#U~㠭7{wӺ1ĦF $OfbjG <{5v1~~bOg "_(;RGvևcD"?˦U;S1zpzpRe}Iܟ^i-`7@+!lu׷iϖO/~!}o{D{cX>`ʶ``0)nUZ8H|h0t# nY; Hk?o}Vgoa-)Kvڗܿf3x=:Tߴ8QUO1~um<)N~*z1+;ȕmJex*{PEvі;FozU:w71T<N}VccxF:w5+]J3LW͕LDgŠ%S6a8Ӛr4 mj|;?w\̍)~ glC}X|[Mc)v|4~Twii7iRr5 +oXu錎(ywiV%r4gOp 1v_$ڭ 35m „Fdm[Ǯ 3[o,v%\a|:+z T7ުU3tVK;>gQp+5SmD_'JvSm}YWT(Qp][XѴǺS9!;$to7Z}؞z W@M8*ճq~L:J$ܿ'D?,@ݒOg[|Ayգ_mǭyz}69wWmkL,?&Jʺj2 gI GQ ɖ |DA{AEt=\):V$~-u"3gγ f !NVy^=)f0˿wJ郮\Μdũ᱆ V;[\X5%;:qO7ZʥuSu| iOJ~ZKE`O=sg7d}Z ?E򞥇?@̆fA ;k26+VM s`=@1^nҾŖ lx=r++qogױ=z\]{'iEv( [z{aoT='JSJ1dNsܗW|4=/k@p>%sp=$?zon'yDݓyR'[7 G+$I753-~+,̙S LJ,;"dW< K<[ɠ\Xo٘C_*`ns+A=c/gwWmqt:]1ɽ?>ψnZ`#M{p:n*ny}4SgRed`O"a8ze}ϖ<%G/\4Gd?Vv:ʠgv^"LoŨ| [¸;@Ӑ*D 9pC$QA p<K43у42LOo|=UhCJן;gυzp>%m_6 y7?>D0¾qVsx*v#ys|َCI\y-|PӍ{z?T}A`ƊRڍFt4u:ڛ],oV}L-4^(`fM-ZS0RQb$dȅ+q<&!lJWxy-)rWu1VOh>^e'JlNb)7NGCkjqs6ɛo"mBVoN~U=nׅNΕWaݧqWoe 5 'ݾtkX(͏/Ȫ1'\ ݆]kl}}OO|-g]49zq=ߩY@&pߟ>JWwI77t9=,'A7?ئ!=ŎojW^K;N *RJ%]Vތ9 FLGӏ4M]^bW9SԨ?38a!SM`4‘ƷtS=Ly.F5ﯫumY6x_mFe>Z=$tMd! >-8f>r)lnI0d"#oopT:(UܾA{7tl4syΰm'_L߬lN_< `HxyBUܴ-lScX;?2uϭkΙtcY-23YnZ4Ftx5ɠR#ǫ5vzwV<=&vi5≩}]{ᦃtG7M̏Lqw^}gΜVmmUqBm#w+-,>!qn>D~^*#-O>põJ ;vS$~?n:_eetF66.L˒} »C D[9 >Ev~bӛoIQnBڎFe#[e3=OJ[%${JoMnUESi&ds1StX`܋]_k]K`tǂyih۠L8?SJMVjylj3| ^rq9ws(HgI T#.|9rSnԆ%4;ǛG\vٰ^ d3CH8b).D6M#q.AoX^fܾk?bG`Ue#v٥Sl|kzv4"9\ {j'~-viOo :d=\Le.s#|~R2cH/)bU1*9od1vӉJqQ`]AG=5hU.4ANa@c~ۈϹTۣgw{{y+ I_ѽʂ$O'7 ~dm+}-O~_ `1y"{v9~gL #sP4`&g0%`X 2MMuoK4=I~FZrk'S<νVʛ -+n.1P׵;A;_:<_MvS,zzX?UBjm)Pwn/]Vvz1WJڻ㑦?\Xng?s.YrWJf,Sф/@בds_j57ȶ}sŮ* O_-"&ÿrtnz}r={XN.O}zQsȋ ɑz4=Z3*?;W/VR# wNz5vagg12ULm꺩5}+^JYg Ӝ{,9qrΥ/Mߧ'Jtz/C7gC>c<~ۂy~J^p2KicU߶}8fc,r0L)97f;&~]'Zl9PU1F෵ ΡI^U-;{y$>|$ȏ8.2`')k\9yXߓL_xlu|wmfyvlJԴ30tasw}kϗi&gi(GROpr A=H9Ƌ.H܍CSK|?L<4Y GesK,@ѫR?D>M2e$^:C+xEN Pi鵗WZMV|^AOyI>271'zq@ %9?N,vღELg6c\ /V<*wޟm`i؇ry{y|"{xokwY_Os/|Cֺ;z_ ONrʢ0>xant8C}:u.k#CHJ{q~RO{Zv~Oå_tǮXLa.cɇsz~v^,b6%w: oi9kwo\Ƥyg_GpWcleeX+J6*mR݅.|јT @+v2vwOgJF#3t ŌѼ;##<+](Tb .J.a`S[D9zZUtwH.]KNJkn`{G^뉘rq]C睽N~IMSZ+ײə2=RG ܫabW,iir4bSQ6'~`뽺iRM+n.B}㘳ښny=[CPD_@_*&OTmDyDt߁Llfȟ!l{?%Pm9g'1wthHt+XV})$?>}'|6`r#-WS";Y[ƴGaoRf|kpvx8Ku v]%Gls:+B ;a3lǮct7G5һ=gu\]I:?5  z ˫d*pG9HZz CgJ<9ңet_ad ur?^Xɐ"_DŽ 7>C/Lԩ٦'fWg?GYE{C~mEs͵HkƳ45ף@;h4ȶ>$hu .qB6êm4#"jPc-E0._Y>* v ]S >Ut 8|9cU<H7=NXӑQ-aKv[t Cfj2鵇Kp۹nMWCc@嶩4VAoGE-,>9يMj'f8rs1+8<{4Tm֙Gz6_;`}1SQ6^aƻۆ}Jh=p} LdW*b6\@ChlgwFq3޹!M[\dJ_tU޴OTg *ݕ$P+؟ϯ[G%b6AKijb,t_x=-vtc&_GJdFB~J~!/݂6k`+l ;ga|Xj}֚һa66dȸםeukgpGl3t0}":I vPhF{ù5^jfN.2#M\֞L= vS:So赈Iky AVjR}L_ɍw%zbjCÛl6ZiI?Vy&5%(Ozn(h᷃dK\8H8AZyrEy~h7+w_/I}_giBGjE_+;DE}9i2_ Dm?{WQ$b+/:WT߻_6B*. ȏ }g Iȇ1WtI1^Uҳ^ 7q2tx=/?,]2[3gtzJ\̒ }x(d#:[t5)˒ Ƣ[n1=jL"wiX$OpAX4ymS.?ku>H6y.w,<ݱԭk4FQD1֐#hX靻m@>6]vGL-֦Ce->A;y AZ~;~hܧoͤS:F;V73*jOj?Tg5>T}iܸpc-r]bk]~\:X1[Sק.IꖬH;tep5>pi6P}- >\0Ip)"?OE:Z.T8őY"O"#}rDU. =YO4}7Lf2st$'DJ<|ܩG]UPo[`1@X* >3&O񾅛 oG imz2=b?WG )؄펏菕+ PзR\rO%.rbw._j-KS2W{WOclcY_4SeTnaSc-^HX%~޳X:A|u+.zz};.TW2uC5 ,v2ő f[r/ʖ1弑VH҂ƜFD\t/,CE*. ݜJyVPZq? wz<2OKS^ &/GD-ǿ}ɇ'eXPuݿѿ 2CR\DϧoKNfy7ҌJ^HA[to^v] '_CO˞tg!CoȯGqB:l6 efX?$yhAb^5+ 4_/m)1m<^~+~ U/}MOJ1\)M%m\cI¢k;k2T>ȹV3{M[p)n@^ϵ~Q@mŎ-q-P_u;TC[ncb/uBL2ڻDc4E)vvŬvuM`VA39?R-4, vO@vZ'-ۡߨ}zUh|k$a4IpݡZϾ^ns\o^9BGGV[o*>W`(o7E~>S}('®re6VsN &yCl /߶vpE-S<4{~*d՜Oտ~0ӊu= 0Է$vAS ' ,~!ɷ̫?+:FQYYs%PSie͵u;LC}o{.?0խ kvͬXnҜ~g}}d ;OrIO}FPҙd,q?O-v!=ilu\e;0j7vlZV`1rf`4El K=gD =osp!Vb7x]n,PڏBف\ă6^M36y1$W=?8YTZ17۰U\ׅ@'t.˾ތKӷ?@?6<6P CR5U=@-t__ޮF$=H$I^̏%szo%9 ;/) \H?O6 / qY|"p _p \z&к=+]=9uj^_ ~JO-T,I!*{OUb=ՄYtˊ="&EO\#ƹoN;l_N!vSǮ»W|&"o|O}h!5 +`$AO}xB]s(+;'M8l }\i2U_.s0=|<CP_NtD[ߎglje䬿¨h;sk2rbJna k>h|-{ 6IOgJ6QI҉:$ɶXֽY+7߃οĕL#U,NcׄsرzqO0}oWCih4FzXfN =lvvvW3w?~DZ'&.>/w7f^byl09ňfúlC6Ӱ08KnSV$~aw~_:8n9`Xp_;eWsjфР  y:𓴎 h]Uh!x<k{]==T2nl k.8A~Sus0dT4G rf3<Mt̝ZI+z_EXU /Ib5Kݏ/Y..[y!!Z_̵k`PxRj۬8r7i˱~=3>>ѯDYc3=m44:lk a O!D_x"NL9x,:n*z3L{V3"=87A]` o!W wQKsiUJ 8`ĕ@ `Z"=pd #`3+,`,W2GxBiS7Tlno{=@3bL PLyv? An:WU.oFeL@vZ\C_rn#fVw0Y-47 Ύ { wl-6ɓ ̷uӞkckg3rs{B.OE3:S]\*HAF~aXCĎ؅> wSX8&BxmQ}{ۤ69_@%hqx'06jW足%v_e*Jkoz4+%m6:1j5V?'hb.b8w0Rk*10v͜ްN]~)>w57XGC)A;4Ҥac.3rW>Z ׭oAS}'_.Zl_C> H e3;u9;v&݁ :F-%$CJb)O"݉GqVč}gq~dKzNNg2+6['x2j4ZƚS,F|}b(&# 7%+P!jtࡼX(Si挎V^0[[g,~"}=V,KGoVO#]ce.d]9 }gGVq#l=s,ʚ^$QK..7v۞唜ƛ[v|e\ޛn9J?,Z֪Z>Ӽ2dk"BNP]>qˋ}T&90Wzi]f_m0#ԎRa& `S0?Br`_/= ; ܓCX?d$,K!!s)wCr!nN Ѭ(zl]8Q ؿϊ:`:T6hXo.Y ,hzcvvn@V,t&x<=[ v蕠.(l3q3X_ǝLρǍޣUQ>XGuI5JzXE=ã|DŽkkk>5S iT,U.p c\^N!giտW+ON_+#e^М[3xاsKE]RؒUW3Ґm#s̶IeKS٨7Źq%~{#ߺֶ\L)C̪̠n;3H#RrʩG 9's5 Iՙǽ0<69m7N\5QUP'WyY\[rz_ŴsX~rloXBՉy cv/7qu֧VOF"] y!ʪVhmo"3Uڅ֦ה+{ ~_J9P>31β|p"*N5};+7~B!v9N 15Ioͱ|9&}srƕ)C+&'΂𴋥ghy酚^oȊ ; ,vUv%gK3)͝&ejHYOh;oi#-ՇV3/d˕3U SZ'zU|[#(=7}~M+jK'O|X+?[h`"eK疙rPY}}ȵƟU\|^$s.Evu)oGv_9{ήÚf+p3\5 \{,J أ1sܗz~l~SKZ<4 ]=h(_1uS,-^|xָn_ szn[~dX߶?T^A,g־3kPHAA[B%'{re qN,!S PkUHykXm}loQ!uGdd/>O#v>YO4M<2)*}Ua9Zo? >_{J<]O$f >+BƍÎz.*bI 'ZB)\{}șfWk嚏nOD-i#;s=Pe$V=%/FrmW&Lb~_RaJsw3;]j$sO@Ӵ5٧v myĸ_ֿ[7:ͿnS}_ù9[l6{?:'fm k' rסHZ ~iJ;nZ܄eGqeX5ɧU9tcr;ds歄ML'K\YY]cCW8\>9sf ӱߌ&O FN?9ƅl'gDhsLO+՝P¬w\#p  ׇ3*>޿" sv7`Y|f~_A_8_/[d[N`*sBRgLz!~T)?5q! SշQ e 2f}DjԅKߝKˏƟ]~ocXN/9*N.WN3DܦZMe/mjF!=]k.֯*}wAҭ}|#~48);X;V"~g(XWX?E5~^?ͽ=a7Y> W\<:rI=vmY_U(пyUt;֗(7 XmTG;NF8asW_m_X`ɪJIӑ_ a WCΓ'r8G+ȼPPC#=922=ij@VjYhAsAeT:_Oh>%k)h=^"]`>UǏ|7>.ợsFhig?-|z*Y\8}V7~HMj+/~R^o2? [*>a>Ak2LJ<ƌK<1hg)hFqBee\Q0:/z#V,!;MOo/Y?=SN%QE;4wVΐSQEa9^ˑi]ʒRWB1ZdCiQZ}r_8t?1j ۛIVQ-j5KeIa}z4Mh_[*w}B?<6CC۸:+;G#:D/^bM=y]>0!$uHIc=:Ӄ?#3ׇm}j@o'Gݎ"0}J ?#&܄|}D}u2F)z.+tz/Z_z).N`KizYi?iKyE>L΢c8jE󻇛Y9(O4*HNB2~ī f72υ.,y9e/2Ǭ,/C]4KvW@y]kYVP@Xw͖kҖ~W<4B݃_|Pp Pއ\});-]['o\&#YI4zFIypY~n_^~O`p#wz?Ly]䷬^gۙ0TQvxIGS"#5CYXuǧnڷmBڥ!4C۴OM<:19E-l3Z?3㯌7f_>܎ WTQ_ 5Vj!%@ž ;P|ZO :%Y/>W7{,|+Fyb%9u06gCf=z&˞QuPdsWrRy,Ϡ'-u=cJ_mM[(;Q֘߁GtlX$X#_1aLY؏iʓ_/\rڞ'F<< ?28,U<3*Kx,v8B '&ĖmwSUb?S!0(T }8#ηP7H:ZW8` ?"a6˂4z>nx~|W #O\ 'ٿvaG8 ]{D$quG&$X8m[+Yk.Vᯔ6?oiNɥLJBL]~>l跘G "yX@1o OܚǑ[E:8͕&`S:\_0,/:G)yty#{=#۶`XfvEHffw(?mqKgs߹0;tGpo6Ou*qO͓ToE0>(|Af5a>f姭 sj[Wr\jZ}o@VQK*z0[WwڎkatEMMi/|鿬x<Մ0<30aO3sG[Ǜe:ڮ1Zˢ~O¶X?F'̡5z(?˾zmD[d>6L6?1z=þyEjߡ+ ^CʈcPa%E?,ɉ>[*nK9y Xq~h_37ihO/XwTxVr,z~>dfqQiqB/}+Q21һ)bjoje5a/̌c wGl,o6geT't6̞}o/IpCǞ{[d agxϻYo ĥܹ[dǔvwEϩ6i{XnoRKDd,pnl 5Mt?e=>鎒)OzWBLyq&3JSxʽ쾕о.rvh4gZ)gIfMR!y Gur =o;P]Gm35h>ؠ> IUhF讴+g#>A[]n߅A s2v_u܅d+csC<Z֙&Yç"~Z:u5|W{X.3%avdתmneEpjX{|-Je~8/>yZ nKnLAu_->'v=Wlg?Z? 6 vl\DS(uOtVA(u}w~*i߿n9`- ,U'a+/j3Ah7bmՎBe0eo467FPsK^Wx=+YT߾x_ (l? Y_:>;X LRZG &_n}|=Xp FJo-4nɀu]O1Ah+MX@A^fhߌYՒhC U5} o]k?jTml7;jtpz4)n(`:vU41!N\%R#]B쏀(R?TߚTN m &<9?X9yJ 0&uVz5w/$È/̱5L2}'{_N|aa@?F 8˖̯$aR%gޫë?r~WB\ueMej>Evt=Y6Su\MotOqR0wIe1@ dث ~kAZC kTY n9J'=+}WܩbJeg^9\BxL_M$1l%պn`gw>އ;㵱I+ XԿ–(wN67$qNN7.V|0DfoyS둳 &-uQ׻[+KEe\lN'죅PXq!__)o齄}l[4mh>\WU$G{UQR=IRJyXf$͏ﻷU 7Frn33 9Wy(C&5?%r|~?Ȇ eG^ S[g]m},c]0~MSsO5?jLFQN\ZTb)(/zEgv:dn&UU-(367Yn\ԫ{v/F?>aqf{˸oGhQa! 0%Ĝ{FOtu=6lb1M5qrؔ*oC5Z˽N;,8ޙr|m T9J&b 궡lo{Ơ>}5_Ofuw) 75y7w492nqo&z{9l"YUW밋TWUzi>=ϡk<g՗\N+5.V?f롖r8z]=X_~^y:EoBKTؑc%-e嚽Rϋؓ-ľS?z^Cb SOʗPM^g>ۈ8"_>_,7_iFz Rs墭A@B@Ǫ=T]q6r=ŝbhUzrEB_9aa-6?xLWAPC\LXleujS?U*ֿo6P;?[%ExZBW,Vӓ@3!ofw C70| ߃4c"}z_&-E{!{ӫr|Mv[.Bc- ]rLm7h:KvW_%e??=t}OL~|dL?c?ACR_zG%yߜk+@n{W3>ۤòՓ N5^tG8kE 7د3ANjT벵ʿ_y)}CW+oXtob⽌[n-߈3_ř{G0HYuwt^%8f۶S1ܕBx[Z!^o-OzIGo1fJŃ\˔;=[:S`5qj#ޗvVh/fJWnAk;`[.<E F d-" e'8n6 |*nZ~:z旂6(;4펨?T_]Ys&Y;cC}N960ti͸j&G0Y O9K\1_z~ [3 ' 7FC̻yh Z{jT#Bg/9)s׳I^\Lez.s&YLnjcjv;>%K.psHLvo~{U&S@`bQ.i)\x+Ŝm/f09n\څ70$Qԕkt>.#Ľ\;oϥ=G %_Fe~ۮޗ]LS}fMYRՔ _]-yٿbEL[]GP v2ïc]~6: /%Bem@FKrF>(:ؗe yqtğ֍1y,0G1;Տn*G+lM-s+ o vl.4yp6=jƬ{fI"*ٺ̐_q>;59L\$cûxvm^bWr2S4K>5lN&*Ϳ۹l&uջe'Uhes4$Hcw##ȁ߰Jn)}h7ܮ/ſYĞd7XE}/;%VyokPmzo&m#a56zSΚ{/&?77Fͣ)aNߔX4\ZįSs` Wm#TKDߵ?M%'tWjM[h/˲qJǿ{+I)J! -L\OprSB= 񙻯p%+u.cҩHH\|N4;Z4yV.hގSe46sКá5{Yom6oLE3_6G Ճxb? XIJ65,At`..'QN./.K?4ݟO[[к߱0ɧ _}RnWݢ 2mdpgv9Ϟu5]`\$,۫휮6%d Dy냈 Z{-T]L?>uk0xw9ѭVgU?$;[f]/[\G޷84S{+VT( WU}?&{k TFWc! [4n^jL cZ>nJ& $Bƭ_uپ+\_c5l*ZB_jWOQἵ_XjTG.vcÁjse*zcǻʔaTkv:]k/$:(<ǫ4A*e線"ܫmE%_j3g+]-4Do"8jWE5*'e~u?aTw'THX%ϔM,ΖY+?s=WEʸYMK %eFs5gx#RO>z h]gb*Q<\°Q|.>>kIj Jꑥ])w4VȬ%j$O:_ǿSͩ'#B=i|X&vK~H<9rUz!9bwq4A% ~kSOy"^_SjkzZzF 5EeE vsY-^^WRZAcw1fʦ5z]9E/$X78G9i75 *\̑}-{>tჰ7OR~:lؽWᛣVp/^'WJ V]0?ʥ2y)LB_uR7cR]Vusib;7Cg #j UѶ|*m1|!ʐcYg8ޅP5'3?OnE|o:.ҙ,R0xkw>a{Lef%$4֗H0wr {q>L*e^t[H*gC{}^|Fv U u,NQa-6}R>[X^j]|QT43:_PKn7m8{?1 > M΃^ؿϛwH>|?֙[ #e6:ǩUķB[C%K -t `?5}y5z1-W ?2zirmi&?w sbpu\c7=\9b{9K6X1^O|u#YiSo3ܱnxK^DZEk6 O bu*̀> (ĪޯP#]Wh&Xc2eKpE@Ҥ g'P%5U'Y"W1K[CzcaaU~ H̾lqN|X.jGh/)5$Ҿt4l\]ңTy7ɦ(S_Fa}.(ϮӾ(!~VKVTWޙ,O(w&X2 md;uC ;ޕREPÖ Ag0%S|}'njW 0:w0# b#5CUUZ|gA)ȞuF j(<:;K GL%)o7½7?.Kuّ;:;jX\@e@Bwb\9)S8Q^2K e័?NO'g$"}AP^ܜD 5 cYGђ)y゜GQY| p{#͝hUQ|}.cޘ#^*7RNkT=l5 }y%Pes-q:65vjLX|_xS[oHaX2k1[N FC*_h|%i.^k&[||}N,ekJy3)%AVXh/uXr)E!F, -qx w)`*afgɔ>hԧ]ۊ Pu/z]3fxLoqb2k; tv٤Z&fYިv,T}%<饍?Ƿl`' Z}Ʈ^Tii+!}_WY=@U/Iv$݌E0~ ~\}V1\֪M.݂|9DW9dDd֫=֟6>*DXTR$t ǔ>_8%Rۡus ՍfnQԱaZdWTRk|Xkscv/t%7q_Zigr}= K@-> Ă,>s?n,Mr+|8s֮%W_WVff6n>3;lyIŖ=┋#}<륨H{".vF[2Zয়h65W6 [Z7z<⼌;뜹8Xݾ`&΢ytY1o.W$gp/d>rl~K}ϗeNM0R~@}{'-AvˌAU/T\& ͥ0֭]o_T&y=7S6ر34&X繓-O. Vo<}my1vޟ2^{z>qrRE|BC$&aK^$N>;I&)X|VK۲u5 K6T teݘ46Ȱvksר@)=^Rfڑ;h/@ b+n@4funЛ.'7\H%b`ٹeI~Ĥ{%lJO%|Jyby劯#C2#auK+4?/y*)ĶG`~N_V85nϤU]Mz4I:ݾDKR\^3L3eRp~vWJP=Cڷ5[uX,)XC LuYv6;'RG¹z&WFnYWOZȫ_'j;Y'ei~nmsgW=Y%z1ld3q"vLiok(C>#z^V1UiXF؅c,FS7v>-^ϝ8wuU'\ן&Qj2/ /nUSKDeoJ(I$Y*n>7QqMz|*~6f 1k3cNǶt5[noafZhZɊ-;F݉u~+b~78mh2R/PuxYmW#}!MW.["Xqiy~xV 7W2рF,Ӛasqe@')_a@kja OOXU^U~i}&ۄa??<: j5t,x}K.Yjj]P&283g wQ!޼N3]Tߝ/80F|._hEGe߻bf뢒>pĐ}OXN5kknѯc GoQhYq-t1RK1 A4SV@M= x|G+=feRSpRҥtG;q`9og5& $8w ~kh{ve\ʷcۺ,ɤ~LpŅbMfH 5A~ 4,!=|Żdە4ź ^/)hcͲ墖J&2[*v[ QvL"t1 ]Dh$GUVrG7YK|>R}P/ ϧgЭ |<yZ;oGkٵR[~Rj{]=+g8bX}54_N}-7mBxSiۏ]6bC(m+i]mשn9lJ=nվ팾ToI+ joC7%JJNr8Nz|k\@n?v™ÛOx`QKjT~dD|exK"S8@\kh\rsFj̦Zd^Jdh?>hOؾO洱~_'Uì %`ߐ .DDtExr'F*>;luѺ8}]Q0Sy?ކ/>QP}&&:S";'ȿXUjՊ'?Bu2 UJYf}v.#{&GcHKEuo0p"R~=-gA1~(d0T$y݉K׳t5!i1z!_\?3Vdy%W\|f"h<2 ?Ty|%Jk;&8~k{؝E_d'r/˧A.S|:ўRCTJcc_X0޻ߜRՎΘ ɯƓfwO N Cbc&%4:~[ukZ׸p3bBKI #hn߫W +is:"' Z׽XVg>r*<22kWs/!6f-eBY0z˗"%FDHȝ(\L]SyqE`p#;Eԥtk%F9XH~8+U0Ȥ63 r$ܺPȯZ>@G>6),JyYBJ 1u^erjZw-ݡ>' Y]ߔK>'FWZ_/a|K_u~ɲb?9yyRs8dzxߋ_“PC>gJ*U"4T IyN(!˹vL\Gݚ c?J9G=>k?=(]qvƅE J)QJmjrʮ6‚` Nj$_S#? PkogyOiSᖽ% ^-{`T'm˭>.Lf>z?EY;1To ElZsaZ"Ƣs(P[y^gd_G&wR[h;cd:vAMtK~Z%\].tOiUR9%2ds)ZU\Է^3ot-1G76RHg/vMm+2Fi|+5E΋e'osdWL[zOOp_o x c|g g.VZ6X9: 1/^hdJT}#{hr C$WQx ۠zyTV3ssYyX57uCnxE}z.y7֒G稔@Y"jWrXtQTD}_w3{?c&T5z!bCuf˾'3~c)`+ JL._NvjEΈ@앫[6g1hY JJdwt_XVBʼ* N[XxDjTh,|Vߔ S># AXr  %ƟQbvĜUE'tz?+o;o6\c>;i\ʁ7x{`זkS%7f1_6X_׳x['Ȗi l&h +_}cGliǶW M%^ʹz[ x 74,3zC4=|}6Q.GvjAqe5ىLL3 ^/&Eg*H4]rE9k iVOݿzO۫Oi&2VF"'W %!Y6IPl39HZrzs+ ,E;Ulຽ/1Q`<7YZ9^No^v=Hjya7aSju~HYi 5HؐS8N,*~t݉rT?{e2bλPqw*/@y\=.eko7pNBW6-WkPm#̖zI> y (9clϴ`;!hyuRFNJXJRQB>=>[@TR#Q Ojl[S+_q;\q{zq9΅Bx>vȸ~|7R5Up"uKK0ζw uu|4Ō1ue2c[ --np]'w^JYȦ= 5DCrld'uxv\,1pߺ%Y,BrF!ɣ`eqB7m"w;[͏U46DYu~Mۙ:& m%tѝ}]:elx>Up4?xo/6kWׇ[k$C&{Tܡa1y;&<Ը _ڍw|;7 CrJ33AkQ̘*4^x `?Dz\^5 ^ʫ-{ rT߂K׾hMtqkv7WL^2K$W׳@)+5~;*3_KA)=JcdƼ6<_kkjl`yf{hʛJU!wkHٞTêKL$bB՟{:|6cTI[o>zj㏝ǩl2^Yϛ)-+2O'>,I܌@v)Rn~Xkm&y܃a$o#]P4Iuh $0˒djfjpNI${ cӖt{9xJms2d"s4$&SLrۼR4o̊x fאM6'oF! 7$̼5zɦV=\/~+OB], fY&9M: qٓfapQf|7!d/,| Fu'ejcF?,?JmzUៃauRO[bsbQo F7舅*R+GѵoZǦ}zZc~ν21\XJ'Y0Oo5e瓇%E썖1 J7mgc,Y{rVF|(i/QMXπ2=/:>&{g#>{^<ܫ~rȠIogK#tט ]jh&n᝴)d?aE'bu8|՗'ydWd8D=.I7\?:^}J8#=lvCCb֪֙E痤F1~zנ|輧rx};dkm4I'$e^b_^t 7?z̜䷾yܷ\ooe__4Q䪘JD7xuQӒO =]*Co:^T~DV9Uy.kc7@smg%m('M{Ηokm}2ze4&EZ.?.e̿D3}_lEu\˖1AUCggM 2Cylo٧Q_o0G:E*{^ MiG+{OG>"TM^ϧܠcQeA"?Q0W{·棬V}k ^y6˓w+W (m9W-s"'[TKk_ǟI$4O]Nǿϙ6?P҅/;ovoy*'h^gardE6_gQ"xc!̤>#Xr `ZmZd#RԦv3MH@Sj6 ~%x^!V8hV|p浆*|Ejɇ㻾O7ּE⭶]C}ЦoAטUGpLt ǭz-b;3 y0?lY;JY^5~u=4sѹ%wqH!sxrryS4ko?'e7?(NJ-(%떍z6w[ks+k-(LݰӠ{ &PBboڎfk{ey%X*VUGZАy uvdݷܡq >M'5'p34wa[-ꀉ\~{Ħ=+vmg'VN4Ҫ!F\#;ZZI;Jx7ĩ=40E1R]y.mSMm`G"l/.]Ugjvc5VKGQ^< O;C|sƾ \F5;BvTFV9eR(74wF?=eέ4zjqS?7b5Rp1\Zx~֛# ~ua=7L;}X_z˫qZl<:ЧUϹS~#CKf(_W07XVevi0ly`S9yԭe+JS| k7I`}QV;G;I'3;`8O*M.+-lh1-%mM( \disk\maastric\title3uq{f%s[߶qY,ӫKN[vydyvRy58_\_^jzGBG:ڊ6";{@R}\?_4~ t8"*QA~HZםX2"lҁ~\rtB;#wJ"P!G0{fw2 ?IO蘭~EAd)WrI3w\@XAq!} W֍-R>\ݶ߁i:jDJ|?(K 䳸|<- AK.hVc#$f[2>cbvVm:"U PsAϪE}Bh/ؖG}i hsUVV{.ozcr|WJT ^Pu3dS"#:g R5;StơBV 竇VGQ1d(5f#X hx7Jv"6`ES3W Q&9Tޥb4gΩkH 2zS|~)H"vne]3q%ТF @47BmeGLin7Yd?~DzV-deVeDjIv>6F$]aAׅ)k>L[%"/5Hdng=eUxG-o/)٭V*d |.ڧr:Q|P,, av\7`0z[@nγ\26̖{;:&Ko1'}Y"ΩJֺ홏X|[gy+ /Dm:Uc֪ܩ*>G]<Hcx`m9ƽ [ IWf+-%ȓ;nnWqU]ds6jr|7QWqG_=>q93%m%(sSgoq{k$ S1ŧǷICUtv ,?T|o:6&; fKk>mArdx I0tP1@ot$ٽxP'Scoj=YS3ʟW]Vʟ'Dy۲oԗ{UY֞,D+`1J:>3]Y Yq;NϝO@;VpBeM h4G:RUW>3Fz>z{~gWޗfj04mu~,d=xW~m)œ'y6CL9?FbAºh[(S^ ("+%W,f.Il3oOMX(e=[/r=_ \0+tm+~ԹyVWOsL oi(/5 [?8w5f+0#'ge^~4ua86SUytoV귳-9飁yw9Y޶ɗ168̹_n'9ۘ73x̔ =Q3O?>8jhb)=&q'^?f?]PMu&%ʯȟ7LC}a:^KmvXI几KPD~Js%LZ<ޢH,:umޛD .5^ף[^:ln3u ]$i6\Kύ3Wi]PL}^?o]~ҟ"l۴~smݰ?45a=,<)7f_ݢ׀CSY;8OJ LU_Ve5#A`[[W$yCd K)vʫzٻ{%R [-Woȭ{= V.I:6V4%oJ'Yq6%oa$Aĺ+Q|ڿSqhIq2҃p \Wכb{/}zK.>J}jbnT:M!oc'M&|we2ˡάbE8?܄z} RWULgtq$8k{wg_la\y˛"ne~eT_3SPկܟTSfU gJ$Հ|gu5GV(x1D ˅o"ߙ헜xfob;[ȜXN Z=P׵*_f"Yl `OzA>wo$p`ҭy:#7:Zό俏*pqU |[q?kjT*k?_eC Ȧ?ɱ|lw{霏@XoR$>j9@WuMvQr޼Sdek lcBm:Ӊ_{w'#gz`9:ҵZ?l-[k^7~X}\Ă/տ|;.0sx6 ؾ{7~>n>3gTȢ8땻 {OѾSD%uc4{]ܸ 4?ɢW\(q~:Ad~<+j?}֍pP~ۼ:Y]i,n'_vYgmb-ųˇzsK}45),T}9ގR7mvհ1(%[ )7kt>*ApV)^ԯ?x W6.Fv//3M13FZ݋_ujmyC.h){ٱ/ #2s>С7kUbb.+-šA:b\qY?G(" -G/[G/eY#kՁޞ5!"k|бy Ak KQSA`?qc+PX1WѾ8pk:`}}!W=e14ϽsJOOr;ڼ ok^txؑ#[ÚtvA1gm_щQ6ǵ?ev[kGĪ`l+P] 7w.SRk0/eW@g@L4$ sa0vъđ^W[^}V/?5ͼnR:%Cʾ< OJC}8ϣv`fC*TʌJm'K.xᲾ˧nj&徂7e}$V߷V O!;ڌg®gDAKr&~UQy*Α/kMzi- ?7ͱVhG>'66@|/.VB <*t`Y/4ʐ6qnl7N {/`濰տLx/s}t *FDزwکc 4=&o 0 B9/y|v0`3̴iOP7Eq~vg.[l5tmTX]7*;b;j]A}C!9՝Ӫ6n(mwV_O9hEtĶog-W&vzn%^zcyԈ/b?dĜJj6 7y%nW$Rc[m$Po:߭Uk-hV.*K欽_/wz C֭!i{xy؉f<*Xb3ټWe@1 EvcKrl욋"0%glcqc+崭1xb7m*uلviO*OR2]^=~(*Ü/K,kir?-)?1i2{IA:^[|2aKbevY.Mc<{O? ɾo{Vcoߩr'W;& <:4BuĬ9$Vz^>?,ZGO} ֤z ]$_nז:]ͤcŹv K 6|o=0Z0f/iSMJYZz'Ogϣ3QxQ]`aJUT{%"=•Lcyu=\ֹsQM.Yܬ; @h^Gf*bC>c8];b嘢 V#ZXN2 6y i zߡcg 4QqnVO0a=Ys{Z">[Hd!~ǝX]QPg݅=(0t% 6F"!6>w)KfWߞ<6>Z%oUz!)q32\Dݶ?'0ǝ)lZf>Uޯɝ0,sW^x~n=!0Dn9m7ֳ&/Ϛ>QPp}ƨBqbo:T K.rnV/q̔tnֿ,7ܝg 7osϵސ͆miwmK؛UTRpchԱ+˵ \r(hvD~[:ËoonE.}toE(^qtpZR&W"߻jl j7KĿYI/* N2ap9}0t{!_e[ڻ&2@|:6olш/wx8__#bV$Zev fXIs19ci[FQ?n+z}6dvNlW1Cٵ΅~2'5j80A;nG;V'!#:IqG/x7tFjd(0Sϯ}TtG?άߪ 7*9|ǁbts ʳ mg+7ɯ|4`٢,i4d8IWHPk1t5d\Mr>6u'Poh3Q-C&^쇏c$Wxe[pC!a)w;\=Ij.I%i0 &sB(8%v+r"l&{ /YGO19knlr:=yC$|y+= S?[!Q]"?To=0OѤ'v1&G05] ,?c^%}P%zIc m7-Ƀn5 g>^ -x_l2tvyw__ Fv_ͫX#8ӎ[<ysKU;ȁ[q_-H׍sAP|]/CfidxQfzW^g5fgh&̧=<ǡVpsVMM(gc w BK|1 #c}@哄՛2diLf^"$^̈T?9\~~g߯R-[Mܼ_\QCuG,,2o~j]e(1yc*_ma=&~{ʙ 佟'Alqfpgg iox<~+gO?2c:zsa 9>BmZvŦ,E k~6ɸ9ӬU:o l. mlg:U㲮^&8fS:uiȋn&W_cRޭ|;64~f\8%,n@ZP:NJ'l_5xP:n].>.C&:)/2ZϻE?qTE|f7IWZImoKZJVOL/|9VE{=´3(mH2bMwu[oqë9},Ψ# oS!t(Tl8sx 5C?YJ%c[,eTok/I9 b4[2]UHb AVüOB􎍬Yb{ǟ2],C؍[+:"w,4{loޓxDbx'1y֧GKĩز4\JQ-[I2-s Qex"&Zw岒3 q_-bbPcŝS:~fG8w[~QSO讯O9q=_7L:hd:tWWV^=Tn9?1vv۲s&"NH9*PȅTBs8+rT7>܈/z*H1S-=Ow۔B s͙buDx_o3F*\4 MO%!ɜr]O]S[U?A~eg 6=o7h!qyFI1: NjOk}\m<{/H%sY<!že qҖ:$lT—%)[\_

O sOryaqAyDu5W?5kjL+bEs-um_jOOƁ+ Y;P>U"W߾a#7X*| 񻤈|wה&UgTԱN zP= VE08~9ۓs`_۩Ui"8,o65C}LYj]F?:o, 2ĽEyyC\;&!0lR*~zVq?K_,Hu]Z 퉤CY>`~~^FzqN+iΞ؜[3P=:EmX\ ܋1MVvỈ6r־v44NEdYz[jRNeShq3@҉.ձ'mXJImH\Z>>du pQW/!k ۢ͢xށhU?~I oJ_q-8TQ>7][zT|chD2JM}+:Ұs?OExPpF>Se9uV;3@k(UP8y9AC$<7\MJB^^fc0P.D)til_Xaiv+u/ hOI28Џ OQdo n<$ד *+p&<2+*ܷF3׵h Q;v{Sc23ˊUm`Jar<޷ ^L= w hUkEp-D3/*˱^V>2>ZYaD.֦8q`V\&1_jIx/4U]Xdho?=ceC̪&v,>僕8^@.2/Ǣb 9f-jeaOomeV2Y|ؗj&ו$S5`C ?kXa G,>;Jj+\۩;{w..s}ɛɬ~ZntXZg55pk]ho[>( c}^rӽ--NH S9geFh(;.3~*-M.;0xmEzH {P J>|IÒPk*&Ը[ȇdڏl9{dqztȗ{ z:P%{3ҙO%;8t6^FAnت0f|M8{-b)\oj,5KDs}]8HMd+~F(hzqPU;2,c1k'87SpT͖Mdƚ?D$J+~aIM POG@Hh)8/f[N(yC:&l_aE[9#plUK'd%#3{ ynDdism61ժ_.vm"Ș8hRrP Mfl) r'q.W85g)jƪ PVM샱,~kw)i+ˀeq>j'h'u|pk#1Mj ٚ:;}c$>Md-cۭ+]oZ:L];ex29%QƹˆJB3p9q{ީoX"K1M V8Wڠ+_ M!4XU:Լ9R޻WM=ɚt-ݪ!}i߸9*+#ut??Lk:959 :Rks|M6`qdO'~W({߭9sS}{Ʊ|ile#+`T[l- IֽZ>$2\QoWxf&]\lQcz%I(Z<ՙN!ou/Uo|čLtE1>1m*Ꙓ9K* #~W8sJfv}\}*YezKlVȰn"yNE;gq_Y;yyցpJM^uEjSyMW*AW agV1]4U wR TMYU}{ٌSb&o}i% Ӆλr0JuF!̬s_ntt Uz"uPf蚳"Ļ76Ki 7rʛPMStx٬2'ҁ߹ݣ3j-W̶)홞kV/bU?zz7ny߃ow|i 28x.Gz䪛e rb$ݞMo˒uxQVw.Cxkǧ|m]oGWPw](Y PNc%:~'89 =١#JyNV8J申K/~;=IZ C;d٣@\ۇזfIZ/m_8oZ6T7lDXBhLQ̷̣9:Mq}e78ۏA<J2R]q =E-qۯ\D} &UFXpV ã2zvz Zx[ޞ 쀗}ӛn;$v,8mmp]"fQW ]YbOAMGf m~Yz~R~06?2kQ۲Y-_%'2\:Y2]hL.Dҙl4j)4ʋ-(5M=OjA%-we& "U(v4*գ:8k>C],3d{xW$]j(",ƹ殸Qà4pl upL\tYsMUkg*bmv@_5Ɇʂ&Z-ԢX#]XkV{7z7Y{u Ik;ܻ]*طKLmO*mz]2U_a^^OebT5e,QQ ^{gbRބ5HGZ\b(K|F3[q"U2o(E=޷QW dKB^Io䐁59ݻ92_s:JO" 6O/=r9YSon?Uw.yX^MQBg$Uߔwju z,n˲6]m[HBӼ {kRݺ>*)$#FOsQQ%lkZ+lrw$aM=B$ U6B!k.P8o&tkW_"mm: S`TIrob/SjOo$_UZ\2,AݼTULr Km+km 3~2x.3Ȱ<hk۷QsM5pb'*+kgo2tkv%9qWfO6owKcHQLM7PIr)Gn2fA4~(KCtu,a|VO΍rKjS MY$~'<6&yC|O{LT1OTz7 ͒ܠKuH6tZCݙw7G)9~pP&Aϋ׭}OJ1. #&Cömc7G׾exhqKmY&6@DW%bf ;nd}T_:>wiW/ SGf 渥i{bIG WZW Oً-?.hƐA4bv1`Vtss?׭_WCA7 s뼺픢]^Npv? -/B0.ܬZ݊}ĸD+ڝLFt[cKˢ&m}~l{;H !3[}8/Tt?[} KP_l֯K+:AR<3_`9+-߹b}7uoJ*Q:3w9 M{?Vo{mWȾm>6^3VpܔGXe+[ZJ(v֣}4Ea q>O޲T mq/گ~16s>lG=mkw:ƏbTlsF }6fkBMF ^4_'qf<{4K3WmH1~2(XӦrI.Q687 :bFn/Z-=I惻B~6I\ 1í(ߐiZCI%z!:,>le~G}N3gPz H_(XcNӬ+m^yB  u|4dGmv yJm7EUx}@鎥O"GPvER<__wVskvrpXu(ȡsmG2A ́O03.?hcG;Mm8z#w)wn*ڶQvX{ N[25r|Lס `'wWUfk3}`j}r2 ]9Z̮8%K߾o2MT.m;?+i'8#@>|Ȧ^bZ7]̽TL\7C+2ϓ-~yN>O! Լ}[n{LMwurLO[VhL~G;s2z6EJXR5l ڳ*̙Hm=]*`q` qZF]y:/OLO%*Wd)+>'c(s"-'HPl:grޝ|wM8JOc⾛m!67͋ۿ6e+F$p7Y~J^e\"V4^|_)D^~u\<%,@7IP6N>YEiw–_%"nLӅ՘jYԗ_jO3<g ?˞DSǒI9ЙSH_rg-Zp ×Hy)5ʥ:՝(pa u#!Iܩ+k4K|mgݩzzfcE=.k{tۃ8^x7|SQ`QucQiL<$1T=3 D>\ϦBP[RKes;Y\p7!١ogns&_qd3yfagπ Y?'ͻޟPb+B_h%xxrϊI0}YWz۶OP߾CTõT?~SǕEI}a'oQt=&cg(NVy4΍5wNL($gʻ1"ā\ +_4!Dp^ R^EkD?K ]Ry Z{<|L-RC{XIH?7(b=)E^i(V, . =!cR?'446R,׶&/}06n }ƾ Gem'>foS庝9|g9࿭a-Yo[KYQPto.6S 0 czjUjU6:oivO(xw =lQ:@- ?`"ڔ\mx?g$^?ƃ.UZBYv*KV#lmC| lj_umұ4eGʙKB~?@ӹ3W&&K8 w|cF'Kyɒ >A*`rHyN,]fW QSsڢ ũ8Oe,0͆K >PJ7߳cbcA/M}r ]_'?o!:Vj+l U{a77)Ow׆b*u vÈvAxZ)ShkF|~3[ۡˀKd|wsIH~N/{~| ~7SitlϽYWzI3zާ<ۑpO'2䩟ui'}y0{u :;R``!O1Ӻ^F*-[*dַbt'W^ y"o"ȟk3a/ l\q5n/f¸?B5ېDU Hm}36=eZl+۩֏MRہg)mS^yW*mW] h~ga];qoΐXPs[=;} {7`Lun_" Ox_dE:&z@eW#gxh | yq[&^.TiT [HO(Eٱ;/ >ߦn!n#6nϙIUeI?۽g0yyAY(} ;_+h/8x U˫rIY.9_ݍ߾i7m_V;KS׎TXwYX7t;s /c*SDtJi͹}p' T^ЬV3(ݝnu7T?dM]s≶:@^3v>4u[ylD.nZ9dd~gJϵ˕,_,_F_ yM ߜ o%y]p K@Vުlh?m Qݯ=<-&Ʉ ]gX^.ree]3O1!E&IVCr^с&5؏Y G`Mʙt' L幦|wt\KKzL`c֮}*Hs4'ǡ;c3DoO?-~ᣀa@Y\b׹[MT{' kZPPpsbF$1F+=Y3|HwW{߿lW(,~3R?+5zq^;Б˜ j C#m h>߄`N*>2Q_(pKr ]_{ :ˆ:F]!IU|j cWƛ*[ n@_[(|f-h(di: C`3Ѝ"Hξ,)򃡹PX>D{zs}>]fWv>  n\L5#CxnӻËANP["UyqIrUmo]sj3QNQF/H֤qQ*`I`YS1~Sɖ`1\_ [}ekP5AI(YcP^hQCeMU4!ck-*VF%Rneb)ݽ$1ux)Mv{W@p䐠DF0?8B~\,+P5S@WĈjΜ$PmEc iȳ]18PKx5{ߺxˮya!#1B^yvi1GK__ZCX@Ckp1 v{l) B!g=:^RVcX%K @mgx +rs9{=[T6}̀triȽY )[|iUbɕUk;㿞A#~}v-Ym?TYg!  "ݶ%b.e\arf)d+kwXg!s/ȑӮ6@DD0OhUXMu^Θ!jlgU8~9RɊjpܜN'@`*?Sˇ1ocp8u$KJMxS'sb'40Qt1KNGkj[:@FQy,}rKKWy3TnR:">8 ң~IWVo8A{&&<\Ex١ޯ_0hOuuvw 0=`b7oT֮UP|ye Zа@ 7+3VuɄ,MYn5H=ʄ;7F} %R] ;zIʯozr8^rެԶwuc|1}Fͤ`b4z1rhXܜ&3m{ H/>B\hsP5y;Ҳ MIN?6Jzݜ zڏȭi/,9kwKG{;eE^D/QŸyy4S }`ӺHa@F4?Mn^ ͞j\\,)\; /dDНQ)|jT&/.7}nk_#qnwh;cΈ]$c9)uW 2{;;~yāݜ1jcE=y)ܶgKܘȑ{^"a97bEfV~{nmc|p#M9\~g=. 7,|f)#nc-.}[#w%U1=)'ڊi ڱm~ݠ0Si<دa2Z*6mp}3~oHịݕ[*컼{69r"۸iVZ;r m]ofJϾzu)1|RР|R ԹJRseۡ+]Uqy˅vNuMeU#8Gpm~U$L&Y\]2,x5Z6v |MMB&bWzQqlۍ7)3ywJ`{r"r~&ǛyW  #$_-q3^F4f 1G8_ʍu92ޒbv_iRL֥=> hWsxzbg߹EE7k"Wx^:6'oתskCjWЎk7NIty\R#`IeP_dWyC`όQw /*sr^ȚwFn - aك| kӒQx;p)VKf s@n&bdڶ;\~]z ÉJzL5@A cV9ll:&Z$,l"5E_45v)ٷύ=7q43uۼiCZ?B`/+5zI|3 ,oGCр8 -s 55̱)u3W1C/ۋyjs?'n<;G5}zAXd71:hҺ!IN?C!Y>93zm\hxG2K|xBjOqU,pv_} ¸SO'Jv6MZ Ru&$ ҳFn>o2{@.3xCWoٕu2wXZw&5.x( ԣ\sʮ SyӗW^If$a@87~/+Q=q3&lp<F{Fڄ./e C?@-c- .JH?⛧͝-G|nnr|*kazϛNe˻A>Y+\[BbCGUz,E*z|Wx [_JO]HVmBwv>@wA7a0߿ojNKvrr0XUdFCӂFۜǐN&*7O[@2pweaZ1B%k `ؔ/l~XX]7[* L곸bl:Eρ {3zQ&mwBu(4%Sg LJZ[l]C|sOz='0b:l&5 ';qv}{ܧH@5b[2[@qTaolж󣴶oubP;<Ԧoߟ-F&uA1rK<yX*P〘5$`j=Ui\(*qZ~!Dڃ9̖v /I=:^z7(сWqȧ Fzx &Ml8R⋱ke!PUJguΰ̤i4\[5J::3vR*8$t>.%EUILւ^Ll(וsn`i% Qi2/[$Y|1AYVSe6`8SVk6Vɒ++X-lh1- M( \disk\maastric\title6uq{g3wx;n{W6lks{yͱ=9lu(ҞB9QO[.)젦fFxt/1&`i2K",O{@>Ld'%ʿ;ֱS<9 d>BtiƉ# =Eg[ $ju(P*ŵ_Vj`㟈gM|L7kDH9y+#\LAE_hyYJnm2NβaG#bc mWc20H:e Q, V&EAe5b3I|X4?7A.”*׃J\gQfcQ6FVIU"CPZ֎ɝP5bD,+ Pd5\3O}qiU Mp >Lmh<" 4,v8 g REhrc{5[cs]G!`m".~7O??_v("w6ȟo\K+?Uy*?՞}u& ctRť[sR״iWCsYѳ-fJatUqi~-盺 ˸v+ij'w嶁0sHq'J{=uJ%ԫM2uoϷ): rӇtYhJrF&nxkelۧ?7\U,H{lFISrbF`h˓B.k^@!@HT/K)y%Ez\zX M[&s*ӣQf&"/!Ϡ :*E]3B5כuhCbSB_8{ǜ67LwQCq ;_ܭyʠ*(eY2{z Bs]8ƾt`.n_ɁWt~vN i)^4P/;y"Sz+\Y<l溺ٷu{6w6\ itlŠSzgC/}NN8:6.Pm NҶ4x{;3K0-oCyFJS e6yXbG3wo}RҖ쭺n:8}w>n'ŬjzZ/lGՉe',xrTIG_%%ۋio?X`2Uw쎴;rٝi;]%kAj,OSaqU_F0ZH 02]Brwnځ=?M63ۭImsކyAow[>oyR! 0B} ${8[ ]!g}戏[̳r5)ۓַ@ۡ)7bcA5;_6k-J{hڜc.M̃cL:/ôs{܉I#hpky񤝈ψ8*V)tǠ+|W~nhy1*>` *-VD_ɯ'_ÚPSçE_/:ИB MXo I &l̮ם:\F]g'.pRST'?;`i$mKP~LeY.,/u.>|oK:Ttn@[%zErobgAy7MGO/fUK/QsK|?wճog A-jmSrE 6lO2V}*Znʵgd~ұn'J.AxF+sK/jkSN-u;peavM lŪ08ڟazRqR;Uė = Xb+ vޑ܇}cʛ `|4v,ӽİBVU7[=*Q%g_ٵ'#|8D+c-lh1-'k( \disk\maastric\title7uq{gg-ҿ;ݼ ]TPsoZ|`6> Nҍx# `[ dF΂@/Jt /-ŋ?1 I= " )/[S7-^(Wea2,EB.?*&%3 e%!6aT è Y0ݙBc)ǭhe8Kv|_V6` PA<V<+u,{7/r^!uZ1_{Srx 8_P^=oU8+wWiÅ>'xӹxvIQuP_3 oeVf>`\iJCXBh1<"hI5ޕ0n1V]O%(Jpƈhr%qr!ag l83 -ܳ\XYe .Y;{"05rdI]Rgu#X̓R@O(E5~g&&ONw c`gfۦmmH+S rr6- й6Όkk(Qv:b"J2LH*d ^ Ş^ tߢ^X PѠ꾢VҎWy]s[(&]#d tҵ!"-_x+)QGO`̥Ua FƸ7hl r:@@],=~~.~Ip$~[٧LDmS+MdL7&Gps`%Wf}um'kw `GV79Xmd㿀Sd؈3>d lX5e\xav1jNQ[rqRST LrzĤ$zY-M#lGtB+.]G}{poR)f!?+O{Ontb3;f}@i7~˭, ʛʻ/0/?>'v}~K{)$Y{Ga1q]nKR S{BLv[gN i^Xo, Cnl(M͐n,lNOAb:gn E-6χ,4(!\'Sy ұl~laW}e t ].vt%?0·EImV&t)m{ ic72uKszoa!lwssY0x_Ev,҉%rֵ)ђ+t^x-{~1Ȍus^TkMLNruy'sB׭[Z(EPCQvħY4MN "Ksڟ8S% +Z!S _G+DZɿʢwCKb/Dk 7@;*,Ip{!3u^lu~o̬*B-2{F'̻c$l& rB>WGzxM-QD&ډé '_'aZ5xWl[qZ0sܰG}qgY˙Ѷ:('%F+_۲m_l5vTM&(zd6V3LG6| eYx}Ta&2sY/%%GූNm'؅Yi w6u|b4<fр"," l`p,F,BH<,"   echo off doc ps startup echo off key a key sa A key b key sb B key d key e key se E key f key sf key g key sg key i i key si I key k k key sk K key m key sm M key o o key so O key p key s key ss key t key st T key u key v key sv echo on PROTEXT v4.37 (ST Format cover disk) The version of Protext supplied on this cover disk is the latest release of the full v4.3 program. You may upgrade to the complete Protext 4.3 package by sending the disk and 20 to Arnor at the address below. We will then send you the printed user guide and disks containing the spell checking dictionaries, the file conversion program and a RAM disk utility. Alternatively you may upgrade to Protext v5.5 for 55. For further details please contact Arnor. Arnor 611 Lincoln Road Peterborough PE1 3HA Tel: 0733 68909 Fax: 0733 67299 Arnor Ltd., September 1992 >ex echo on >if sys_date[w-1] < "1990" >ex date >ex time >el >dm Date and Time OK >ei --------------------------------------------- P R O T E X T T U T O R I A L F I L E S --------------------------------------------- T U T O R 1. CURSOR MOVEMENT. PROTEXT is supplied with a number of tutorial files for the purpose of providing a quick and easy method of learning the most commonly used commands. Each tutorial covers a particular aspect of word processing. ***** TO CONTINUE WITH THE TUTORIAL - PRESS ESC KEY ***** For the time being, when you reach the bottom of the screen and wish to read more of the tutorial, just press the down cursor key. The cursor keys are the four keys marked with arrows on the right hand side of the keyboard. Once you have worked your way through the tutorial files you should be ready to carry out all the commonly used functions of word processing. Only the most frequently used commands and processes are covered in the tutorials, but as experience is gained or when you want to make use of the more advanced features of PROTEXT, the manual gives full details of all the commands and how to use them. Throughout these tutorials a consistent form is used to describe which keys to press when carrying out 'editing' commands. Examples:- CTRL-A -means hold down the CTRL key and press the key marked A CTRL-( -means hold down the CTRL key and press the key marked ( There is NO need to press the SHIFT key as well. SHIFT- -means SHIFT and the right cursor key. CTRL-@ 1 -means press CTRL and the key marked @, release and press the key marked 1 On occasions you will be asked to use certain commands which will take you to other parts of the text. What to do next will be described in a box similar to the one below:- ----------------------------- | This is an example only. | | Do not Press CTRL- yet | ----------------------------- This first tutor will teach you the quick and easy ways to move around a document. One of the main features of a word processor should be the ability to move the cursor around with the minimum of effort and PROTEXT is particularly quick and flexible in this respect, so it is worth taking a short while to get to know all these commands before progressing on to greater things. PROTEXT has two different HELP options, one for command mode and the other for edit mode. The edit mode HELP is an 'intelligent' one, to the extent that it can provide information which is relevant to the type of line of text the cursor is on at the time help is called. Alternatively you can just call up help and look through all the commands. To call help from edit mode, which is the mode you are in now, simply press CTRL-H when the cursor is on a normal line of text. Pressing CTRL-H again will display the next page of help and so on. To scroll back through the help, you should press SHIFT-CTRL-H. Help can be turned off at any time with CTRL-V H. If you press CTRL-H when the cursor is on one of the 'stored command' lines (these are lines which start with a 'greater than' symbol) you will be provided with help about stored commands. Command mode Help is obtained by typing 'HELP' when in command mode. This will call up a menu giving a number of categories of help which are available. Typing 'HELP' followed by the name of any command will give a brief explanation of that command. The cursor keys when used on their own will move the cursor around one character at a time. You have already used the down cursor to scroll the screen, so that you could continue reading. Now try using the  cursor key and you will find that the text stays where it is and the cursor moves up one line for every time you press the key. After a few lines, use the  cursor to bring the cursor back to this line. If you now try using the  cursor key you will find that it will move along to the beginning of the line. Similarly with  cursor, only this time you will find that it goes past the end of the line of text ---------------------------------- and if you keep pressing for long enough you will find that the | Hold down  cursor to return | screen will scroll sideways. Try using the  cursor key now until ---------------------------------- the screen scrolls sideways. The reason that the screen scrolls across is because PROTEXT can handle documents of unlimited width and when the text is wider than the screen, it is scrolled across so that you can see what you are typing. Normally this will happen completely automatically, but unless you are creating a document that is wider than the screen, which is most unusual, you will not come across it very often. PROTEXT also allows you to move across the screen more quickly, either by jumping a word at a time, or from one end of the line to the other. Press SHIFT- now and you will find that the cursor now hops from the start of one word to the start of the next. When it reaches the last word on a line, it will continue on the next line. If you now use SHIFT- it will hop backwards through the text, always with the cursor on the first character of a word. If you now press CTRL- you will find that the cursor will hop immediately to the end of the line and pressing CTRL- will return the cursor to the beginning of the line. Either of these commands can be used from any position on the line as a quick means of getting to the start or end of a line. So far the only way that you have moved up and down through the document has been by pressing the  and  cursors. If you now try pressing SHIFT- you will find that the text moves up the screen in a similar way to before, but with one big difference. The flashing cursor remains on the line that it was on when you started pressing SHIFT-. You will find this particularly useful when you try editing text at the bottom of the screen as it lets you move the text up so that you can read the following text, but without losing your place in the text. SHIFT- does exactly the same thing, but in the other direction. There are also several commands which allow you to jump up and down through the text more quickly. The first of these use the  and  cursor keys in conjunction with the CTRL key. If you now press CTRL- twice you will find that the text jumps a little less than a full screen with each press. This provides a very convenient way to quickly scan through the contents of a document and because something less than a complete screen is scrolled each time it is easy to maintain continuity of reading. PROTEXT also has two commands which let you jump straight to the beginning or the end of the text in memory. Notice that we said 'text in memory'. With smaller documents this will be the beginning and end of the document, but with larger documents which are too big to be held completely in memory, repeating the command a second time will let you jump to the beginning and end of the complete document, no matter what size it is. Before using the commands to jump to the beginning and end of the text, you will need to know about another command that will enable you to find this part of the tutor after you have experimented with jumping from one end to the other. This command lets you position markers in the text which you can jump back to at a later stage. These markers are positioned in the text by typing CTRL-@. Just press CTRL and the key with the '@' on it and you will notice that the top status line has changed and contains a message telling you to press a number between 0 and 9, or some other symbols. Press the '0' key on the top of the keyboard for now, to select marker 0. The status line will return to normal, but now, instead of containing the message 'No markers set', it will contain the message 'Markers 0' as an indication that marker 0 is in use. You will also find that the character '0' will be positioned in the text at the cursor position, but in inverse. You can leave these markers in the text for as long as you want and they will be ignored when printing takes place, but if you want to remove one, it is simply done by positioning the cursor on the marker and pressing the DELETE key. ------------------------------------------------------------------ | If you reached here by the use of CTRL-, then use CTRL- twice | | to return to the previous position. Otherwise ignore. | ------------------------------------------------------------------ Position the cursor at the end of the NEXT paragraph now and set marker 9 by the method described above, and then continue reading the tutor. Having now marked your place in the text with a marker, it is time to try out the commands for jumping to the beginning and end of the text in memory. CTRL and either the opening or closing square brackets, which are on keys to the left of the RETURN key, are used for this. To jump to the beginning of the text in memory you should press CTRL-[ and to the end of the text CTRL-]. Try jumping to the start first, then to the end of the text. You should now have returned to here from the end of the document by using the marker command. You will have discovered that to return to a marker you simply follow the same procedure that you used to first set the marker. If no marker is set, then one will be set. If a marker is set, then the cursor will jump to its location. There are numerous uses for the place markers, one of which you have already seen. Another use is to put place markers in the text in positions which you might have to refer to frequently during the course of creating a piece of text. If the document you are working on is very large, it may not be possible to fit it all in memory at once, in which case PROTEXT will automatically load and save the text as you progress through the document. You will be unaware of this happening most of the time and one of the few occasions you will notice it is when you have used the CTRL-[ or CTRL-] commands which will only take you to the start or end of the text in memory. To get to the start or end of the complete document you should press CTRL-[ or CTRL-] a second time. There are also two commands which let you jump a paragraph at a time. CTRL-< (The 'smaller than' symbol) will move you back one paragraph to the start of a paragraph, whilst CTRL-> ('greater than' symbol) will take you to the start of the next paragraph. Try them now and come back to this paragraph. You will probably have discovered that repeated pressing of one or the other will step you forwards or backwards any number of paragraphs. It is also possible to step through the text a page at a time. A page means a page as it will be printed, not a screen page. If you look at the top of the screen you will find the message 'Page n Line nn'. PROTEXT always keeps a note of which page you are on and also which line and column the cursor is on. Before going any further, set another place marker, any one that is not already in use (you can easily tell which are in use by looking at the status line). The commands to move a page at a time are CTRL-( and CTRL-) and in a similar fashion to the way that the other brackets have been used, the opening bracket will take you back to the start of the page and the closing bracket will take you forwards to the start of the next page. Watch the Page number on the status line as you use these commands. Try them now and when you have finished, use the place marker you set to return to here. Most of the main commands for moving around the text have now been described, but there are one or two more which have special purposes. CTRL-L will always take the cursor back to its previous position if one of the 'jump' commands has been used to move to another part of the text, so that if you press the wrong key by accident and jump to the wrong place, you can always get back to the right place quite easily. Try pressing CTRL-< and then CTRL-L. Moving the cursor around on a line, or one line at a time will not have any effect and pressing CTRL-L will still return you to the place in the text from which you originally jumped. Finally there is a command which lets you jump straight to a specific page, line, or column. If you press CTRL-G you will find a message appear on the status line at the top of the screen requesting you to enter P, L, or C and number. Entering P and a number will cause the cursor to jump straight to the start of the specified page, whilst prefixing the number with C will take the cursor across the screen to the relevant column number. Using L as the prefix, or omitting the prefix altogether will send the cursor to the line number. You should note that the line number is the actual line number in the text, which will not be the same as the line number displayed at the top of the screen, on the status line, if 'page mode is selected. Page mode can be turned off at any time by pressing CTRL-P, which results in the true line number being displayed on the status line and back on again by a repeat press of CTRL-P. Set another place marker and try the CTRL-G option now and then return to here using the place marker when you have finished. All the above commands are standard PROTEXT commands, which may be found with only minor differences in all versions of PROTEXT, on whatever machine, but most of the special keys have been configured to function in a similar way to normal and may be used as an alternative to the standard PROTEXT commands. It is recommended that the PROTEXT commands are learnt, as it will then be easy to use versions of PROTEXT running on other machines. The 'special' key functions, are listed below, together with their equivalent PROTEXT commands:- ST KEY PROTEXT COMMAND FUNCTION Home CTRL- Go to start of line CTRL-Home CTRL-[ CTRL-[ Go to start of file Help CTRL-H Call up help facility Undo CTRL-U Undelete Insert CTRL-TAB Insert/overwrite mode That completes the first of the tutorial files and whilst you haven't yet found out how to enter and edit text, you should now be able to move around a text file quickly and easily, which will make progress in the remaining tutorials a lot quicker. To go on to the next tutorial, return to command mode by pressing ESC and then type:- LOAD TUTOR2 and press the RETURN key ----------------------------------------------------------------- | If you reached here by using the CTRL-] command then to return | | to your place in the text you should type CTRL-@ and press the | | '9' key which will take you back to the place marker. | | Try it now. CTRL-@ and then 9. | ----------------------------------------------------------------- --------------------------------------------- P R O T E X T T U T O R I A L F I L E S --------------------------------------------- T U T O R 2. TEXT ENTRY AND EDITING. PROTEXT is supplied with a number of tutorial files for the purpose of providing a quick and easy method of learning the most commonly used commands. Each file covers a particular aspect of word processing. ***** PRESS ESC KEY TO CONTINUE WITH THE TUTORIAL ***** >---!--!-------!-------!-------!-------!-------!-------!-------!----R In this tutorial you should learn the different methods by which text can be entered, corrected and moved around. Before continuing, you will notice a strange line of dashes and exclamation marks near the top of the screen and another one just above this paragraph. You don't need to worry about them for the moment, as they will be explained in detail later in the tutorial. For now you can just accept that they are 'ruler lines'. Throughout this tutorial you will be encouraged to insert, remove and generally chop up the contents of this document. There is no need to worry about damaging the document, as the original will still be on the disc and unless you save the modified one back onto the disc (which you shouldn't), no permanent damage will result, so experiment as much as you like. PROTEXT has two distinct modes of operation, 'Command mode' and 'Edit mode'. Edit mode is the mode in which all entry of text is carried out, whilst command mode is where all instructions relating to printing of documents, saving and loading of files and many other operations are carried out. You have already encountered both modes, perhaps without realising it. When PROTEXT is first loaded it is in command mode, which is indicated by the 'banner' line about two thirds of the way down the screen, which gives details of the version number of PROTEXT that you are using as well as the selected printer driver and directory. When you entered the command 'LOAD TUTOR2' you were in command mode. The ESC key is used to 'toggle' between command and edit modes whenever you want. Pressing ESC will always switch you into the other mode. When in edit mode, you will see that the command mode banner line disappears, leaving only the status lines at the top of the screen and the text (if any) on the remainder of the screen. This is the first of several toggle commands that you will come across during the course of the tutorials. PROTEXT has two methods of entering text. These are 'Insert' and 'Overwrite' modes. By default, when you enter PROTEXT edit mode, you will be in insert mode. This means that when you type in any letters or numbers, the cursor will push any existing text ahead of it, rather than 'rub it out', or overwrite it. Position the cursor in the middle of this line and type in some more letters. You will notice that the remainder of the line, to the right of the cursor, will be pushed further to the right as the new letters are inserted. If you look at the top of the screen you will find the message, 'Insert', on the status line. If you now hold down the CTRL key and press the TAB key, the message will change to 'Overwrite'. Alternatively, the INSERT letters in the middle of a line and you will see that this time the new letters will replace the existing ones. It is still possible to insert extra characters whilst in overwrite mode and this is achieved by pressing CTRL-SPACE, which has the effect of moving the text under and to the right of the cursor across one column, leaving you room to enter the letter you want to add. CTRL-TAB is a 'toggled' command, which means that pressing it again will restore it to the original setting. Overwrite is useful for correcting or changing the occasional word and for other more specialised uses, but for the moment go back into insert mode, which is the most commonly used method of entering text. One of the big advantages of a word processor is that it is very easy to insert, alter and remove words and letters. For now we shall concentrate on entering and removing single letters. In the blank line below this paragraph try entering three or four lines of text. Copy part of this paragraph if you can't find anything more interesting! Just type the letters as you see them, using the space bar to insert a space between each word, but do NOT press RETURN when you get to the end of the line. To obtain a capital letter you should hold down one of the SHIFT keys whilst pressing the appropriate letter key. Similarly, to obtain one of the characters marked on the upper part of some of the keys, you should also press SHIFT. If you want to type a considerable number of upper case letters, it is more convenient to press the CAPS LOCK key, which will result in all further letters being treated as upper case letters. Pressing CAPS LOCK a second time will toggle the keys back to lower case. Don't worry for now about the odd spelling mistake as we shall correct them in a minute. When you get to the end of a line, don't press RETURN, as you would with a typewriter, simply keep on typing and you will notice that if you were in the middle of a word when you got to the end of the line, PROTEXT will automatically move the part complete word to the start of the next line and continue entering letters as fast as you type them. You will also see that PROTEXT automatically inserts a new line when it gets to the end of a line, so that any existing text is pushed down to make room. This process of not splitting words is called 'word wrap' and is another feature of a good word processor. If you look at the top of the screen again, you will see the message 'Word-Wrap' on the status line. Press CTRL-W and the message on the status line will change to 'W-W Off'. Try typing in some more words and see what happens. This time the cursor keeps moving across the screen, completely ignores the right hand margin and carries on until the screen scrolls. You would not normally use this method of entering text, though it can be useful on occasions. For now, press CTRL-W again to switch Word wrap back on. The only time that you have to press the RETURN key is when you reach the end of a paragraph. Pressing RETURN has the effect of ending the paragraph and moving the cursor down to the next line. If you are in insert mode, which is normal, a new line will be inserted into the document and the cursor will move onto it. If you are in overwrite mode however, the cursor will move down to the next line, but no new line will be inserted. If you made any typing mistakes whilst entering the paragraph of text, it would be a good idea to correct them now. Simply move the cursor back to where the mistake is and position it over the character you want to change, then press the DELETE key. The incorrect letter will disappear and the remainder of the text on that line will move across to fill the space. You can then type in the correct letter if necessary and the text will move back to the right to make room for it. If you need to remove more than one letter, then position the cursor over the first incorrect character and press DELETE as often as necessary. If the mistake had been noticed when you were typing it, you could have corrected it at the time, simply by pressing BACKSPACE, which has the effect of deleting the last character typed. Try deleting a few characters and see the different effect of the DELETE and BACKSPACE keys. DELETE always deletes the character under the cursor, whilst BACKSPACE deletes the character to the left of the cursor. In both cases the space is closed up. The effect of this is that DELETE deletes letters to the end of a line and BACKSPACE deletes characters towards the start of a line. One very common mistake is to get two letters the wrong way round in a word, such as 'teh' instead of 'the' and PROTEXT has a command to take care of this without the need to delete and replace letters. Position the cursor on the first of the transposed letters and then press CTRL-A. It will work equally well with a space and a letter, such as 'whol e', which is another common typing error. This is a good time to introduce another command, which really belongs in the tutorial on formatting text, but as you will inevitably be disrupting the appearance of your text during the course of this tutor, we shall explain it now. Pressing CTRL-F will reformat a paragraph from the cursor position to the end of a paragraph. Positioning the cursor at the start of a paragraph and pressing CTRL-F will reformat the whole paragraph. Pressing SHIFT- CTRL-F will automatically reformat the whole of the paragraph the cursor is in. Try deleting a few characters, or words, from this paragraph and then reformatting it. Sometimes you will find that you want to delete more than an odd letter and PROTEXT provides a number of commands which permit you to delete part words, words, lines and whole blocks of text. SHIFT-DELETE and SHIFT-BACKSPACE let you delete a word or part of a word. If you position the cursor on the first letter of a word and then press SHIFT-DELETE, you will find the complete word disappears. Similarly if you position the cursor on the first space after a word and press SHIFT-BACKSPACE, the previous word will disappear. In both cases the gap will be closed up by the remaining text moving across to the left to fill the space. To delete the last part of a word, position the cursor on the first letter you want to be deleted and use SHIFT-DELETE. To delete the first part of a word, position the cursor on the first letter you want to remain and press SHIFT- BACKSPACE. As you have probably noticed by now, PROTEXT follows a general principle (though for practical reasons this is not 100% true) that using a command on its own, such as the cursor keys and the DELETE keys has a small effect on what happens, whilst using it with SHIFT has a slightly greater effect, so it will probably come as no surprise to find that PROTEXT has commands which will also delete part or all of a line. CTRL-E and CTRL-BACKSPACE have the effect of deleting the text from the cursor to the end and the start of the line respectively. Try it on a line or two of the above text, to see the effect. You will notice that if you delete all the text from a line, either by pressing one key after the other, or because there wasn't any more text on the line, it doesn't delete the line itself from the document, merely the text from the line. If you want to actually remove a line from the document, whether it be an empty one, or one containing text, CTRL-keypad* is the command to use. This will remove the complete line from the document and cause the remainder of the text to move up a line to fill the space. Some of the above commands are fairly severe in their effect on the text, so PROTEXT provides a command which can help to undo any mistakes you may have made. CTRL-U is the 'undelete' command and has the effect of restoring the last piece of text deleted by the last use of any of the delete commands. Note that it can only restore the last bit of text deleted and that any subsequent use of the deleting keys will cause previously deleted text to be forgotten. There is one final delete command, which is SHIFT-CTRL-BACKSPACE which has the effect of clearing the complete document from memory. This command will prompt you for confirmation that you want to erase the complete file before doing so. It has exactly the same effect as the CLEAR command in command mode. So far you have learnt several ways to delete text from lines and even to delete whole lines, so perhaps this is a good time to learn how to insert new lines into the text. If you just want to insert an empty line at the end of a paragraph, then all that is required is to press the RETURN key a second time. As many lines as wanted can be inserted in this way, when in insert mode. If in overwrite mode however, pressing RETURN will only make the cursor move down a line. PROTEXT provides a command, CTRL-I, which moves all the text from the line that the cursor is on, down a line and inserts a blank line into the text where the cursor is. You will quite frequently find that you want to split lines into two and join two lines together. There are two different ways to do this, depending on whether you are in insert or overwrite mode. If Insert mode is in use, which it will normally be, positioning the cursor where the line is to be split and pressing RETURN results in the cursor and the remainder of the text being moved down onto a new line beneath. If you want to join two consecutive lines together, you can do this easily, either by moving the cursor to the end of the first line and pressing DELETE, or by moving the cursor to the start of the second line and pressing BACKSPACE. If overwrite is in operation, pressing RETURN does not split the line, but merely moves the cursor down to the start of the next line, so two commands are provided to enable lines to be split and joined. CTRL-* (the * on the 8 key) will split a line at the cursor position and CTRL-+ (on the = key) will join lines together. Any leading spaces that would have appeared at the start of the new line will be discarded. Finally there are a couple of commands which are for the purpose of changing the case of letters. If you press CTRL-/ when the cursor is over a lower case letter it will change into an upper case letter. Keeping the keys pressed results in the cursor moving along the line of text changing any lower case letters into upper case. You do not need to worry about numbers and punctuation marks etc., as these are just passed over. The reverse of this command is CTRL-\, which turns all upper case letters into lower case. Both of these commands can prove to be very useful if, after creating a piece of text, you decide that certain parts, perhaps a heading, should be in upper case or vice versa. So far most of the frequently used editing commands have been covered, though there are a number of others which are detailed in the manual. One form of editing which hasn't been covered at all yet is the subject of moving, copying and deleting blocks of text. This is such a powerful and versatile feature of PROTEXT that it has a tutorial all to itself, so if you wish to continue to the next tutor file, press ESC to go into command mode and type:- LOAD TUTOR3 --------------------------------------------- P R O T E X T T U T O R I A L F I L E S --------------------------------------------- T U T O R 3. CUT AND PASTE EDITING and FIND AND REPLACE. PROTEXT is supplied with a number of tutorial files for the purpose of providing a quick and easy method of learning the most commonly used commands. Each file covers a particular aspect of word processing. ***** PRESS ESC KEY TO CONTINUE WITH THE TUTORIAL ***** >---!--!-------!-------!-------!-------!-------!-------!-------!----R Cut and Paste Editing is one of the names given to the functions which enable you to move, copy or delete areas of text. PROTEXT is particularly flexible in this respect. The procedure is initially the same whether a block of text is to be moved, copied or deleted, in that you must set two markers, one at the start of the block of text and the other at the end. It does not matter which is set first, as PROTEXT automatically adjusts the markers so they are the correct way round. Move the cursor to the start of the first line of the preceding paragraph and press CTRL-Z. You will see that the block marker is represented on the screen as an inverse video square bracket. The first one set will always be an opening square bracket. Now move the cursor down to the start of the first line of this paragraph and press CTRL-Z a second time. This time an inverse video closing square bracket will mark the text. You have now marked a block of text consisting of all the text between the two block markers. You will see that on the Status line which previously said 'No markers set', there will now be two square brackets to indicate that both block markers are set. If you find that you have positioned a marker in the wrong position it can easily be removed by positioning the cursor over it and pressing CTRL-Z yet again, or by using the appropriate DEL key. Alternatively any block markers which are set can be cancelled by pressing CTRL-K. If both markers are already set when you try to set a marker, a beep will sound and a message appear on the status line to inform you. You must press the ESC key to return to edit mode. If you know you do not want the old markers then CTRL-K can be used to delete them before setting the new ones. On the other hand, you might want to have a look at them before removing them and PROTEXT provides a command to enable you to quickly find them, without having to look through the text. In an earlier tutorial you learnt how to set place markers in the text and how to find them by pressing CTRL-@ and then the place marker number. In a similar way, we can use CTRL-@ with either the opening or closing bracket to jump straight to whichever bracket was chosen. Press CTRL-@, release and then press the square bracket key and the cursor will position itself on the block marker. Having selected the block you can then decide whether to move, copy or delete it. We shall describe the copy command first. Move the cursor down and position it at the start of this paragraph and press CTRL-INSERT. You will find that the block of text has been copied down to the cursor position. You will also find that the block markers have moved with the block. If you look back in the text, you will find that the original piece of text is still there. You could have moved the block of text instead of copying it and to show how this works we shall now move the block down from where we copied it, to immediately after this paragraph. Move the cursor down to the start of the next paragraph and this time press CTRL-M to move the text. If you look this time, the block of text will be at the end of this paragraph, complete with markers, but if you look at the start of this paragraph, the text will no longer be there. It has been moved, rather than copied.  As the block markers are still set it is a good time to look at the third of the block commands, the 'delete block' command. Just press CTRL-DELETE, and a message at the top of the screen will request confirmation that you want to delete the block, before doing so. Blocks of text may be any size and anywhere in the document. In the examples shown above, complete lines were moved. This was done deliberately, as this is one of the most common uses of the block commands, but a block can start and end anywhere and could be as short as one letter, though this would be rather pointless. Moving a few words around a sentence or paragraph is a fairly common use as well. Try moving a few words around in a sentence. One thing which should be noted is that the cursor must not be inside the marked block when the move or copy commands are used, as it is not possible to copy or move a block into itself. If you do attempt to do so, PROTEXT will display an error message on the status line. CTRL-Y is a command which, though not solely connected with the process of cut and paste editing, is frequently used with it. CTRL-Y is used to switch between two documents in memory. Full details of 'Two file editing' are provided in the manual, but just to give you an idea of the possibilities, mark this complete paragraph with the block markers, but this time, instead of using one of the copy, move or delete commands, press CTRL-Y, followed by CTRL-O (letter O, not zero). You should now find that you are in a new document containing only the marked block of text. Look at the status line and you will see the message 'No File', indicating that it is a new document. If you now press CTRL-Y again, PROTEXT will switch back to the original document, which will still contain the original block of text. CTRL-Y toggles between the two documents, whilst CTRL-O is the command to copy the contents of a block into the other document. The block of text is always copied over to the position of the cursor in the second document. The original block of text will still have the block markers round it, so it is easy to press CTRL-DELETE to remove the original text if required. The above operation, as you have seen, provides a most convenient way to transfer sections of one document to another and is much quicker than saving blocks of text and merging them into the other document. The second document is an entirely normal document and any of the command mode and editing commands can be used. You will also have noticed that when you switch between documents, the cursor position is remembered, together with all the settings of the various block and place markers, justification etc. The second part of this tutorial is concerned with a brief description of the FIND and REPLACE functions provided by PROTEXT. These are two of the few editing commands which are largely carried out from command mode. Because FIND and REPLACE are used from command mode, a tutorial file is not the ideal way to learn how to use them, so we recommend that you consult the chapter in the manual which gives full details of their operation. The following few paragraphs give a brief look at the options and how to use them. Both options work in a similar way, the difference being that FIND merely searches for a chosen 'string' of characters, whilst REPLACE will both find them and replace them with a substitute string. A string of characters is a collection of letters, numbers or punctuation marks that can be found in consecutive positions in the document. Included in the string may be printer control codes, tabs and returns. The easiest way to find out how to use the Find and Replace options is to try them. Before using ESC to go into command mode, move the text up the screen so that the following paragraph is at the top of the screen and will be visible even in command mode. Set a place marker in the text so that you can easily return here afterwards. Press ESC now to leave edit mode and then continue reading the next paragraph. From command mode type FIND and press RETURN. You will then be prompted with 'FIND string' and should now enter the word or characters that you want to find. In this example we shall look for the word 'string', so type that in and press RETURN. Next you will be asked to select 'Options (A,B,C,G,W,n)'. This time we will not select any options, so just press RETURN when you have read the remainder of this paragraph. PROTEXT will return to edit mode and start searching. When it finds the first occurrence of the word 'string', it will position the cursor on the first character of the word, in this case 's'. At this point you can resume editing if you want, or if you press CTRL and the ) key on the keypad at the right of the keyboard, PROTEXT will continue the search. If you had chosen to do some editing, you could still have continued the search whenever you wanted, by pressing the CTRL-keypad ) key. When all occurrences have been found, return to here by using the marker you set earlier. Instead of pressing CTRL-keypad ) to continue the search, the keypad ( key could have been used and would have caused the search to be resumed in the reverse direction from before. This allows you to back track if needs be. By default, with no options selected, PROTEXT will carry out a search of the document from the cursor position, forwards, ignoring the case of all letters and finding all occurrences, even when they are part of a longer word. PROTEXT is very flexible in the variety of different ways that you can search for a string. It is possible to specify a number of options which will decide what form the search will take. Full details are given in the manual of what the various options do, but briefly, they permit you to do a global search of the whole document (G), search backwards (B), search for whole words only (W), search only for words with all characters in the same case as the search string (C), search for the nth occurrence of a string (any number between 1 and 255) and finally there is an automatic option (A), which can be used to return the total number of occurrences of the string. REPLACE is very similar to FIND, the only difference being that you are also requested to give a string to replace the original with. As before, PROTEXT will position the cursor on the first occurrence of the string, but this time a message will appear at the top of the screen, on the status line, asking you to confirm 'Replace Y/N?'. If you select the N option the search will continue, leaving the original string unchanged. Selecting Y will replace the string with the new one and continue the search. Alternatively, if you press ESC when the 'Replace Y/N?' is displayed, the search is abandoned and you can continue with further editing. If you later decide to continue the search, then pressing CTRL-Keypad) or CTRL-Keypad( will resume the search from the cursor position. Try using REPLACE to replace all occurrences of the word 'string' with 'STRING', asking for confirmation each time. The '(A)utomatic' option will change all occurrences without requesting confirmation and will give a count of the total number of replacements made. If you wish to continue with the tutorial files, you should now return to command mode and enter:- LOAD TUTOR4 --------------------------------------------- P R O T E X T T U T O R I A L F I L E S --------------------------------------------- T U T O R 4. RULERS, TABS, MARGINS AND FORMATTING. PROTEXT is supplied with a number of tutorial files for the purpose of providing a quick and easy method of learning the most commonly used commands. Each file covers a particular aspect of word processing. ***** PRESS ESC KEY TO CONTINUE WITH THE TUTORIAL ***** >---!----------------------------------------------------------------R Formatting is the process which determines the layout and final appearance of a document and takes two distinct forms. Automatic formatting occurs naturally during the course of the creation of a document and is determined by the settings of a number of parameters, whilst manual re-formatting is the process of rearranging the text into another layout, correcting mis-alignment of text caused by insertion or deletion of areas of text, or by altering rulers after text has been entered. Automatic formatting is controlled by a number of things, the first of which are 'Rulers'. You have already seen a number of rulers in the tutorials. There is one immediately after the 'PRESS ESC KEY' message above. A ruler is a special line that marks out the margins and tabs. Margins are the left and right hand limits of the text, whilst tabs are markers used to position text in set columns on the screen and are particularly useful for lining up columns of words or numbers. Tabs work in a very similar fashion to those of a typewriter, but in a much more flexible fashion. You will notice that at the top of screen, just under the Status lines, there is another ruler. This is the 'active ruler' and at all times is the one applicable to the line of text that the cursor is on. You can have any number of ruler lines in the text and each ruler applies to the text from the line beneath the ruler to the next ruler line (or the end of the text if there are no more ruler lines). When the cursor is moved down past a ruler line, the new ruler will immediately replace the previous ruler at the top of the screen. PROTEXT considers the first ruler that will be used when printing takes place, to be the 'default document ruler'. In the event that the document does not contain a ruler PROTEXT provides a default ruler, which is the one you will see at the top of the screen when you first load PROTEXT. Try moving the cursor up and down past the following two ruler lines, watching the 'active' ruler line. >---L----!------!------------------------R This is just to provide an example of the effect of moving the cursor past ruler lines. >---!---------!------------------------------------------------------R When you load PROTEXT initially, you will see the default ruler displayed at the top of the screen, beneath the status lines. Each '!' on the ruler marks a tab position and the 'L' and 'R' indicate the left and right margins. You can create new ruler lines to suit the layout you require by typing the new ruler line as you would a line of text. The line must have a 'greater than' symbol (>) in the first column. You do not need to type in the hyphens (-) along the line and unless you wish to inset the left margin, which is described later, you should not enter the 'L'. By default PROTEXT assumes the first column to be the left margin. Simply type in the '!' wherever you want a tab and the point '.' wherever you want a decimal tab. Try creating a new ruler line just above the last ruler and then type in a few lines of text. You will find that the text will wrap round automatically when it reaches the new right margin that you have set. >---L---!------------------------------------------------------------------R There are two further commands connected with rulers. The first, CTRL-D, copies the 'default document ruler' (the first active ruler in a document) to the current cursor position and CTRL-R copies the previous ruler but one to the current cursor position. CTRL-R is particularly useful when you are working with areas of the text which are in different formats. as it allows you to quickly 'restore' the ruler in use prior to the last change of format. The ruler immediately below this paragraph was copied using CTRL-R. If you wished to create another inset paragraph a few lines further down, the CTRL-R command would copy the above ruler down, to repeat the process. >---!---------!------------------------------------------------------R Often, when creating a new ruler, it is convenient to use one or the other of the commands to copy a ruler down and then to edit it as required by adding or removing tabs, etc. Rulers may also be copied from anywhere in the text by using the normal block copy command, CTRL-INSERT, after marking the ruler with the block markers. PROTEXT has two types of tabs, the normal 'tab' and the 'decimal tab' and these are inserted into a ruler line by just typing in an exclamation mark (!) where you want a normal tab marker, or a point (.) where you want a decimal tab marker. You may have as many of either tab as you want on each ruler line. Every '!' on the ruler line marks a normal tab position. When editing text, pressing the TAB key will move the cursor to the next of these positions. Make sure you are in insert mode and position the cursor at the start of one of the lines in the middle of a paragraph. Press the TAB key and you will find that the cursor jumps across to the first TAB marker, pushing the text in front of it. Pressing the TAB key again will make the cursor jump to the next tab marker. If you now press BACKSPACE the cursor and text will be pulled back to the previous tab marker. If you want to tab across the line without moving the text across, then press SHIFT-TAB and this time the cursor will just pass over the text to the tab position. Now go into overwrite mode using CTRL-TAB and repeat the process. This time you will find that TAB passes over the text, whilst SHIFT- TAB has the effect of pushing the text across. Don't forget to return to insert mode afterwards. The main use of tabs is for aligning text or numbers in columns, and PROTEXT allows you to set tabs at any positions in the line (and as many as you like). The normal tab is also used to inset the start of a paragraph and when used in conjunction with RETURN can provide a very quick means of splitting one paragraph into two. Try it now, positioning the cursor on the 'T' of 'Try' at the start of this sentence, press RETURN, then TAB to inset the paragraph and finally CTRL-F to reformat the paragraph. Note: do not use TAB when creating or editing a ruler line since this will cause the tabs to be set wrongly. PROTEXT also has a special form of tab called a 'decimal tab' which can be used in a number of ways. It permits you to align numbers so that the decimal points line up automatically. Any numbers that you enter after pressing TAB to take you to a decimal tab will be automatically shunted to the left of the tab position until you enter the decimal point(.), after which any further numbers will be placed to the right. If you do not enter a decimal point (as for a whole number) and then press TAB again, the number will be right justified in such a way that units, tens, hundreds etc. all line up. This tab can also be used with words, in which case they will all be lined up so that the end of the words are all in line. This can be very useful for entry of words like 'Total' and 'Subtotal' in conjunction with columns of figures. The right margin (denoted by 'R' on the ruler line) also acts as a decimal tab. If TAB is pressed when the cursor is to the right of all tab markers, it will be moved to the column to the right of the right margin. Any text typed now is pushed to the left and is right- justified at the margin. This can be very useful for putting the date on the right hand side of a letter, amongst many other things. Position the cursor on a blank line and TAB across until the cursor is at the right margin, then enter the date and press RETURN. Note that there must be sufficient room between the previous tab and the margin for the text that is to be entered. Try copying a ruler down now, with CTRL-R and tabbing across until the cursor is at the right hand margin and then entering the date. You should not use a full stop in the date, or PROTEXT will think this is a decimal point and therefore an instruction to continue entering text normally. The ruler line is also used to define margins. These are indicated by 'L' for left margin, and 'R' for right margin. These define the part of the screen within which text will be formatted. If the left margin is in the first column the 'L' should be omitted as PROTEXT, by default, assumes the left margin to be in the first column. The main use of left margins is to indent a section of text. When RETURN (or SHIFT-RETURN or CTRL-RETURN) is pressed or the end of a line is reached, the cursor moves to the left margin, rather than the left hand column, so by insetting the left margin text can be automatically indented. A left margin should NOT be used to indent the whole of a document. If you want to leave part of the paper to the left of the text completely blank, this is accomplished by using the 'side margin' stored command (>SM) which is described in the manual. When the text is formatted with the 'FORMAT' command, any text that is within the left margin, i.e. to the left of the left margin setting, is unaffected. This means that the left margin can be used to include marginal comments with the text. To type a comment in the margin use CTRL- to force the cursor to column 1. Tabs are allowed within the margin and the following ruler line may be found useful for numbering indented paragraphs: >---!---L--------------------------------------------------R 1. First paragraph. You will notice that the text wraps round onto the next line, but starting at the left margin, not column 1. 2. Second paragraph. >---!---------!------------------------------------------------------R Try entering a 'Third paragraph'. First position the cursor at the end of the 'Second paragraph.' line and press RETURN as you would normally when you are entering text. The cursor will move to the left margin of the next line. Press CTRL- to get into the margin, then TAB, before entering the number. Finally press TAB again, which will take you back to the left margin to enter the text. Ruler lines allow you to re-format the text in any way you choose by altering the ruler line and using CTRL-F to reformat the paragraph. If you have tabulated text by inserting tab characters, altering the position of the tab markers on the ruler line will result in the tabulated columns being re-formatted to their new positions immediately, making it is easy to move columns about or experiment with different layouts to decide which is best. Try moving the decimal tabs around on the following piece of tabulated text. >---!--------------------.--------------------.-------R Item 1 100.00 10.2 Item 2 25.43 12.5 Item 3 240.50 .75 >---!---------!------------------------------------------------------R One command which is useful is the CTRL-V T command, which has the effect of making all tabs and Carriage Returns visible. CTRL-V T is a toggled command and using it again will remove them from sight. Tabs appear as a right pointing triangle, whilst carriage returns are a 'cranked arrow' pointing to the left. Another feature which has a direct effect on the appearance of a PROTEXT document is 'Right Justification'. This is the process whereby the right hand edge of the text has a straight edge, like a book and is achieved by PROTEXT spacing out the words on a line. By default right justification is on, but this can be changed by the use of the CTRL-J command. This also is a toggled command and right justification can be turned on and off at any time. Press CTRL-J now and enter a bit of text in the line beneath this paragraph and this time it will have a 'ragged' right edge, similar to that produced by a typewriter. If you now switch right justification on again and reformat the paragraph using CTRL-F, the text will be reformatted with a straight right edge. We have already seen that text can be reformatted at any time by the use of CTRL-F, which is very convenient for the odd paragraph. Text is reformatted from the cursor position to the end of the paragraph. As well as CTRL-F, SHIFT-CTRL-F may be used to reformat a complete paragraph, leaving the cursor at its original place in the text. If a considerable amount of the text has been disrupted by editing and moving blocks of text about, this could prove to be a bit long winded, so PROTEXT has a 'global' format command. This is used from command mode, so it is necessary to press ESC to enter command mode then type 'FORMAT'. When RETURN is pressed the entire document will be reformatted according to the current setting of right justification and any rulers in the text. There is also a command FORMATB which will only reformat the text within a block marked with the Block Markers. Try 'messing up' a few paragraphs by inserting and deleting text and just for good measure alter some of the rulers to different widths, or insert some new rulers with left margins. Now go into command mode and use the global FORMAT command. When complete, go back into edit mode and see what the effect has been. There are several other items which, though not strictly 'formatting' commands, have a very direct effect on the appearance of a document. Sometimes when right justification is in operation PROTEXT might insert spaces between words where it is important that there is only one space and PROTEXT has a special character to replace the space. When justification takes place, PROTEXT then knows not to insert any spaces where a 'Non-break space' has been used. To insert a non-break space, press CTRL-N, followed by a space and you will find the space represented as a small box,like this ''. One example which might illustrate the use of it is where you have a space after the 'A.' in Mr A. Smith. This would look wrong if separated by more than one space, as above, but when a non break space is used, 'MrA.Smith' will always appear with only the one space between, when printed. Another similar character is the 'non-break hyphen'. Normally, when PROTEXT finds a hyphen at the end of a line, it will split the word at that point, but on occasions it may be important not to split the word. An example of this is where we have used a hyphen in CTRL- TAB which has the effect of splitting the command. Pressing CTRL-N and then the hyphen key will insert a non break hyphen, ensuring that the two halves are permanently joined together. Try replacing the normal hyphen with a non-break hyphen in 'CTRL-TAB' above and then reformatting the paragraph. The opposite of the non-break hyphen is the 'soft-hyphen'. This may be used in the middle of a long word which might look better if split with a hyphen, rather than causing the text on the previous line to be 'stretched' unnaturally. It is inserted into the word by pressing CTRL-- (CTRL-hyphen key) and will appear as a hyphen in inverse video ''. The hyphen will always appear in the text on the screen, but the word will not be split unless the soft hyphen falls naturally towards the end of a line. When printing takes place the hyphen will only be printed if it is at the end of a line, otherwise it will just be ignored and the word will appear as one word. PROTEXT also has a command to make these codes 'invisible', so that the text can be viewed as it will appear. To see this in action, press CTRL-V V to view the text without any printer control codes, hard spaces or soft hyphens. Any place markers and block markers will also be made invisible. Pressing it again will restore them to the screen. Yet another command which is not strictly a formatting command, but which can prove most useful is CTRL-V S, which exposes all hard spaces. Hard spaces are those which are typed in by you, rather than the 'soft' spaces which are inserted by PROTEXT in the course of formatting. Soft spaces can be inserted and removed at any time by PROTEXT, whereas hard spaces are a permanent part of the document. To see this in use, press CTRL-V S and the hard spaces are shown as shaded spaces, with the soft spaces remaining blank. That brings us to the end of the supplied tutorial files which have given you a brief demonstration of most of the commonly used editing commands. Please note that there are many other commands and functions available in PROTEXT that have not been demonstrated and these are all fully described in the manual. In particular, no mention has been made of how to insert 'printer control codes' into the text, nor of how to use 'stored commands' or the many commands available in Command mode and these sections of the manual should be read fully. THE END ps. If you want to clear this tutorial from memory, in order to create your own document, enter command mode by pressing ESC and type:- CLEAR PROTEXT CONFIG FILE Ver C B .@ARNORENG.QIKA:\A:\>-------!-------!-------!-------!-------!-------!-------!-------!----R*8EXFILE DOCTXTASMBASBATC CVTERRH KEYLSTMAKPASPPDPRNSRCARNORENG.DCTUSER.DCTUSER.DCT2d,(SUNDRY TEXTDISC$FILE$FILENAMESNAMESPRINTING PRINT BACKGROUND#BACK#MACROS'EXECFILES'EXTERNAL8+PROGRAM8+DICTIONARY-DCT-QIKO1USER2UWF2DRIVER,5PPD,5CLEAR7DOC7PROG7EXT;LOAD<L<MERGE.=M.=NAME=N=PRINTF>PF>PRINTFB?PFB?*PRINT^@SAVEA@SA@SAVEABASABASAVEASASAVEBCSBCSPLITZCSPLZCSPOOL@DSPON@DSPOOLOFFDSPOFFDSWAP-ESW-ETYPEzETzEPRINTEPEPRINTBFPBFPRINTP>GPP>GPRINTPQGPPQGPRINTPS]HPPS]HPRINTSHPSHPRINTSB|JPSB|JPRINTQJPQJPRINTQBrKPQBrKABANDONKABKPARALLELsLPARsLPRINTER"MPR"MSERIALNSERNPRINTONNPRONNPRINTOFFFOPROFFFOTYPEWRITEROTWOA'PBQPC{PDPEPCATPDIRPCHDIRhSCDhSMKDIRTMDTRMDIR.URD.UERASEUDELUACCESSVACCVPROTECT/WPROT/WRENAMEXRENXCOPYXUPDATEXUP_ZFINDZREPLACEZFINDB^FB^REPLACEB}_RB}_Fv`Rv`FIX`FIXB`FORMATaFTaFORMATB(bFTB(bNUMBERvbNUMvbNUMBERBcNUMBcTABdANAGRAMeANeBUILDIfBUIfCOUNTDgCODgDELWORDShDWhFINDWhFWhINSWORDSiIWiJOINDCjJDCjLISTDkLDkLOOKUPlLKlMAKEDmMKDmSPELLmSCmCODE)pEXECpXpLMACROSQsLMQsMACROsKEYsCALCvCAvCOUNTaxCTaxCOUNTBxCTBxGOTOyHELPyHyLOADCFGszLCFGszPAUSEzQUITX{QX{STATUS{STAT{CONFIG|CONVERTA~CVA~LIFEARNORPROTEXTƀPATHHTEMPATH BUGSփBUGփMENUSSMENUSBLOCKS,BLOCK,CONT0CO0STOPzSTzCLEARKEYSCLRKLOADKEYS}LDK}SAVEKEYSSVKFF,ECHOrSYMBOLSYMDATE0TIME0INKTOUCHDESKTOPACC``SUNDRY`` SUNDRY : Miscellaneous command mode commands For further details on any command, type HELP followed by the command name, either from command mode or the menu option 'Help on named subject'. This gives the syntax of the command and, in brackets, the abbreviated form of the command if any. In many cases, examples and additional information are given as well. STATUS : lists useful settings in current configuration file. LOADCFG : loads a new configuration file. CONFIG : allows changes to current or other configuration file. TIME & DATE sets system time & date. INK changes the colours. Alternatively use CONTROL.ACC. CONFIG determines how colours are used. SYMBOL : changes the appearance of a character on screen. SPOOL : echo all command mode screen output to a file. Turn off with SPOOLOFF. PRINTON : echo all command mode screen output to printer. Turn off with PRINTOFF QUIT : ends the Protext run. CALC : calculates simple expressions. HELP : gives information on specified subjects - e.g: EXTERN, BLOCK, TEXT, FILE, NAMES, PRINT, BACKGROUND, MACROS, DCT, QIK, UWF, PPD and commands `TEXT`` TEXT : Text handling from command mode. For further details on any command, type HELP followed by the command name, either from command mode or the menu option 'Help on named subject'. SWAP : switches between the two documents in memory. CLEAR : clears the text from memory. FORMAT : re-formats entire text according to rulers and justification on/off. FIX : fixes text, so that it cannot be further re-formatted. COUNT : counts the words in the text. GOTO : enters edit mode with cursor on specified row, page or column. FIND : searches for any string (any sequence of letters or symbols). REPLACE : replaces any string by another. PROG : selects program editing/printing mode. DOC restores document mode. TAB : sets tab positions in PROG mode. NUMBER : numbers lines of text, or removes numbers. Other HELP subjects: FILE, PRINT, BLOCK, SPELL, FIND `DISC`FILE` LOAD : retrieves a document from disc ready for editing. MERGE : merges the text from a file into the current document. SAVE : stores the edited document in a disc file. SAVEA : creates an ASCII file. (works as a PRINT command). CONVERT: converts text files to and from other programs and computers. SPLIT : splits a large text file into smaller ones. TYPE : types the contents of a file to screen. CAT : lists the files in the current or another directory. DIR : alternative to CAT. CHDIR : changes the current directory. A, B, C, D or E change current drive. MKDIR : creates a new directory. RMDIR : removes a directory if it is empty. ERASE : erases file(s) in a directory on disc. PROTECT: protect file(s) from being erased/overwritten. Cancelled with ACCESS. RENAME : renames a file on disc. (NAME assigns a file name to text in memory). COPY : copies file(s) regardless of date & time. UPDATE copies new files only. TOUCH : 'touches' a file so that its date stamp is set to current date & time. Other HELP subjects: NAMES, BLOCK, DCT, MACROS, PRINT, SUNDRY, SPELL `FILENAMES`NAMES` When entering a file name to a command, a drive and/or directory can be specified as well, if required. This applies to all commands. The filename extension can in most cases be left out, when entering file names for commands which only operate on files of a certain type. For instance it is sufficient to type 'PRINTER epson' to load the printer driver EPSON.PPD, since printer drivers always end with '.PPD' anyway. There is no standard extension to distinguish text files, but with the command EXT (or CONFIG) a default extension can be defined that will be used when text is loaded (with LOAD and MERGE). Some commands can handle so called 'ambiguous file names', i.e. names containing 'wildcards'. A question mark (?) stands for a character that could be anything - except a full stop - or nothing. An asterisk (*) is equivalent to any number of '?'. E.g: PROT test?? protects all files named 'test' + up to two more characters. DEL *.* erases all files in the current directory. `PRINTING`PRINT` PRINT : Protext print commands PRINT : prints the whole text, PRINTB prints the marked block. PRINTQ : prints in Near Letter Quality. PRINTP : prints selected pages. ( PRINTPQ = PRINTP + PRINTQ ). STOP : stops background printing. CONT resumes it again. ABANDON : aborts printing (on certain printers immediately). TYPEWRITER : allows the computer to be used as a typewriter. FF : causes the printer to feed to the top of the next page. PRINTS : displays the text on the screen as it would be printed. PRINTF : prints to a file, that later can be 'dumped' to printer. SAVEA : prints to an ASCII file. SERIAL : selects a serial printer, PARALLEL selects a parallel printer. PRINTER : loads a printer driver. Also try 'HELP BACKGROUND', 'HELP BLOCK', 'HELP PPD', 'HELP P' `BACKGROUND`BACK` BACKGROUND : Background printing When printing, Protext sends the output not directly to the printer, but to a buffer in memory. From there it is passed on to the printer as fast as the printer can print it. Without the need to wait for the printer, Protext can quickly work through the text, and after that make itself available for editing or other tasks. The so called 'background printing' that will be going on in the background can be controlled with various commands: With STOP it can be (temporarily) stopped. With CONT it can be resumed. ABANDON erases the buffer, and in addition causes certain printers to immediately abandon the printing. (The printer has to be able to recognize and give priority to a special abort command which can make it erase its own built in buffer). With BACK OFF (or CONFIG) the background printing can be turned off. It is turned on again with BACK ON. `MACROS`EXECFILES` Commands for EXEC FILES and MACROS EXEC : executes a file of commands. EXECS : executes a string of commands given with EXECS. ECHO OFF : turns off echoing to screen of commands in an executed exec file. PAUSE : pauses execution until key is pressed. LMACROS : lists defined macros. SAVEKEYS : saves macros. LOADKEYS : loads macros. CLEARKEYS : erases user defined macros and restores the default ones. CLEARKEYS N: erases all macros. MACRO (KEY): allows definitions of macros. CODE : displays the function/character codes that each key produces. Escape characters: | in exec files ^ in macros Escape characters are used around numbers that are to be interpreted as codes. E.g. ^766^FIND^13^ - causes the program to enter command mode, then to type the letters 'FIND', and last perform a carriage return. `EXTERNAL`PROGRAM` EXTERNAL : external commands and programs from within Protext Programs can be run from within Protext if there is enough free memory. Simply type the program name as if it were a Protext command. If the program name clashes with a real Protext command, it can be prefixed with an asterisk (*) to make clear it is not the Protext command that is intended. Two of Protext's own commands - CONFIG and CONVERT - are in fact separate programs, and can also be run as such. Desktop accessories can be accessed by moving the pointer to the top line and clicking the left mouse button. `DICTIONARY`DCT` SPELL : spell checks and allows correction of words not recognised. BUILD : spell checks but sends words not recognised to disc file. Spell checking is done against several dictionary files simultaneously, up to five of which - the DCT files - are dictionaries in a compressed format. LISTD : lists the words in a DCT file (optionally to a file). MAKED : makes a new DCT file from the words in a text file. INSWORDS : inserts words in text file into DCT file. DELWORDS : deletes words in text file from DCT file. JOIND : joins two DCT files together. COUNTD : counts the words in a DCT file. LOOKUP : searches in a DCT file for all words similar to the one specified. FINDW : searches for all words matching a specified pattern. ANAGRAM : searches for all words containing certain specified letters. CONFIG is used to specify which DCT files are to be used. (Other HELP subjects: QIK, UWF) `QIK`` The quick dictionary, or QIK file, is an ordinary word file, in which the words have to be placed in alphabetical order for the the dictionary to work. It is loaded into memory in its entirety, in contrast to the ordinary dictionary files (the DCT files) from which just an index is loaded, and which Protext then has to call from disc each time they are needed. Other HELP subjects: DCT, UWF `USER`UWF` The user dictionary or update dictionary is the DCT file to which words stored with the 'S' key during a spell checking pass will be added. Before they are added to this file though, they will be put in a 'temporary' file: the UWF file (User Word File), which has the same name as the user dictionary but with the extension '.UWF'. It is an ordinary editable word file, and so mistakes can in most cases be corrected without resorting to the special dictionary commands. User dictionary can be changed with CONFIG. Other HELP subjects: DCT, QIK `DRIVER`PPD` All output sent by Protext to a printer is done according to rules set up in a printer driver (PPD file). Which printer driver is currently loaded is always displayed on the banner line. With the command PRINTER a new printer driver can be loaded. With CONFIG a certain printer driver can be made the default driver. (optionally one each for every port on the computer if several printers have been connected). The PPD files can be edited as ordinary text files. Details on the the various instructions found in these files are given in the manual. Compare the commands PRINTER, PARALLEL and SERIAL. `CLEAR`` CLEAR. Clears the text from memory. Syntax: CLEAR `DOC`PROG` PROG. Selects program text editing and printing. The effect on printing is that stored commands will be printed instead of acted upon. The effect on editing is that formatting commands are disabled. Ruler lines are not active but, with TAB, tabs can be set as required. With the editing command SHIFT-CTRL-I, Auto indent can be selected. DOC. Selects document editing/printing. Syntax: PROG DOC When text is loaded, Protext will automatically select DOC or PROG mode according to the name extension of the loaded file. (e.g. the extensions .DOC and .TXT will invoke document mode, while .BAS .C - not to mention .PPD .KEY etc. - invoke program mode). Which extensions should be associated with which kind of file, is user selectable with the help of CONFIG. `EXT`` EXT. Determines default name extension for text files. When LOAD and MERGE searches for text files to load, they will begin trying to find the literal name they have been given. But should they not find a file with this name, and no filename extension was given, they will make a second try with the extension as given by EXT. Syntax: EXT Example: EXT DOC `LOAD`L` LOAD (L). Loads new file from disc for editing. Compare MERGE, EXT and SAVE. Syntax: LOAD `MERGE`M` MERGE (M). Merges file into the current text. Compare LOAD and EXT. Syntax: MERGE `NAME`N` NAME (N). Assigns a file name to current text. Compare SAVE and RENAME. Syntax: NAME `PRINTF`PF` PRINTF (PF). Prints to disc, including printer control codes. Resulting file can later be printed without help from Protext, with any program capable of 'dumping' the file to the printer. Syntax: PF () Examples: PF text1 ; prints current text to file 'text1' PF text1 text ; prints from file 'text' to file 'text1' Also available as Block version PRINTFB. `PRINTFB`PFB` PRINTFB (PFB). Prints block to disc, including printer control codes. Syntax: PFB Compare PF. `*PRINT`` *PRINT. MSDOS command to print a file. Compare PF. `SAVEA`SA` SAVEA (SA). Creates ASCII file. Works like a print command, with >ZM implicitly defined at the start. Syntax: SA () Compare CONVERT. Also available as block version SAVEAB. `SAVEAB`SAB` SAVEAB (SAB). Prints to disc as ASCII file. Compare SAVEA. Syntax: SAB `SAVE`S` SAVE (S). Saves current text onto disc in a file with specified name. If the file name is omitted the text is saved under original file name, or under name given with NAME. Syntax: S Compare LOAD & MERGE. Also available as block version SAVEB. `SAVEB`SB` SAVEB (SB). Saves block. Syntax: SB `SPLIT`SPL` SPLIT (SPL). Splits large file. Maximum size of the smaller files may be specified. The files will have the same name with extensions 1, 2, 3,.. Syntax: SPLIT () `SPOOL`SPON` SPOOL (SPON). Echoes all command mode screen messages to file. Turn off with SPOOLOFF. Syntax: SPOOL Compare PRINTON. `SPOOLOFF`SPOFF` SPOOLOFF (SPOFF). Turns off SPOOL. Syntax: SPOFF `SWAP`SW` SWAP (SW). Swaps between two documents in memory. Syntax: SW `TYPE`T` TYPE (T). Types the file to screen. Syntax: TYPE Compare PRINTS `PRINT`P` PRINT (P). Sends text to printer, optionally from disc. The number of copies may be specified. Syntax: P () () Also as block version PB. Printing to printer also with PQ, PP, PPQ To screen with PS, PPS. To file with PF, SA `PRINTB`PB` PRINTB (PB). Prints defined text block. Syntax: PB `PRINTP`PP` PRINTP (PP). Prints pages selectively, optionally from disc. Syntax: PP () () Compare PPQ and PPS `PRINTPQ`PPQ` PRINTPQ (PPQ). Prints pages selectively in NLQ, optionally from disc. Syntax: PPQ () () `PRINTPS`PPS` PRINTPS (PPS). Prints pages to screen selectively, optionally from disc. Syntax: PPS () `PRINTS`PS` PRINTS (PS). Prints to screen, optionally from disc. With ESC the printing is stopped, to be resumed when any other key is pressed. Repeated pressing of ESC aborts. CTRL-HELP is used to toggle a Scroll lock mode, so that printing automatically is stopped after each screen full. Syntax: PS () Block version : PSB Selected pages: PPS `PRINTSB`PSB` PRINTSB (PSB). Prints block to screen. Syntax: PSB `PRINTQ`PQ` PRINTQ (PQ). Prints in Near Letter Quality, optionally from disc. Syntax: PQ () () Block version: PQB Selected Pages: PPQ `PRINTQB`PQB` PRINTQB (PQB). Prints block in Near Letter Quality.. Syntax: PQB `ABANDON`AB` ABANDON (AB). Abandon printing. Empties print buffer and causes certain printers to empty their own buffer. Syntax: AB Compare STOP `PARALLEL`PAR` PARALLEL (PAR). Selects parallel (Centronics) port and loads associated printer driver if any. Syntax: PAR Compare SERIAL and PRINTER. `PRINTER`PR` PRINTER (PR). Loads printer driver. The driver is loaded from current directory or, if not found, from the default search path. Syntax: PR Compare PARALLEL and SERIAL. `SERIAL`SER` SERIAL (SER). Selects serial port and loads associated printer driver if any. Syntax: SER Compare PARALLEL and PRINTER. `PRINTON`PRON` PRINTON (PRON). Echoes all command mode screen output to printer. Turn off with PRINTOFF. Syntax: PRON Compare SPOOL. `PRINTOFF`PROFF` PRINTOFF (PROFF). Turns off PRINTON. Syntax: PROFF `TYPEWRITER`TW` TYPEWRITER (TW). Typewriter mode. If a number is specified the text is indented by that many spaces. Syntax: TW (number) `A`` A. Selects drive A. Syntax: A `B`` B. Selects drive B. Syntax: B `C`` C. Selects drive C. Syntax: C `D`` D. Selects drive D. Syntax: D `E`` E. Selects drive E. Syntax: E `CAT`DIR` CAT. Catalogues files in (current) directory and reports free space on disc. The sizes of files are shown in K. Files protected with PROTECT are shown with asterisks. Syntax: CAT (pathname) Examples: CAT ; current directory on current drive. CAT B:\ ; root directory on drive B. CAT \PROTEXT\*.PPD ; all printer drivers in PROTEXT directory. DIR. As CAT but with the following differences: The sizes of files are shown in bytes. The date and time when each file was last changed is shown. Syntax: DIR (pathname) `CHDIR`CD` CHDIR (CD). Changes current directory. Syntax: CD Examples: CD .. ; changes to parent directory above the current one. CD letter ; changes to directory 'LETTER' under the current one. CD \ok ; changes to directory 'OK' which is off the root directory. CD \ ; changes to the root directory. `MKDIR`MD` MKDIR (MD). Creates new directory. Compare RD. Syntax: MD (pathname) `RMDIR`RD` RMDIR (RD). Removes a directory if it not contains any files. Compare DEL & MD. Syntax: RD (pathname) `ERASE`DEL` ERASE (DEL). Erases file(s) from (current) directory. Syntax: DEL Examples: DEL letter ; erases file 'letter' in current directory. DEL \test\*.* ; erases all files in directory 'test' under root directory. `ACCESS`ACC` ACCESS (ACC). Cancels delete/overwrite protection set with PROTECT. Syntax: ACC `PROTECT`PROT` PROTECT (PROT). Protects file(s) from being deleted or overwritten by setting their status to read-only. Use ACCESS to cancel the protection. Syntax: PROT `RENAME`REN` RENAME (REN). Renames a file on disc. Compare NAME. Syntax: REN `COPY`UPDATE` COPY. Copies file(s) regardless of date. UPDATE (UP). Copies only file(s) newer than any like named files in target. Syntax: COPY () UP () Destination can be: \ ; destination file(s) will be named as originals omitted ; file(s) will be copied to the current directory Compare TOUCH. `UP`` UP is the abbreviated form of UPDATE. See 'HELP UPDATE'. `FIND`REPLACE` FIND (F). Searches for text. REPLACE (R). Searches for and replaces text. Syntax: FIND Syntax: R Options: A Automatic search. Then displays number found. G Global search. (Starts from beginning of text). B Backward search. C Case specific search. S Spaces ignored. Text found regardless of number of spaces in it. W Search for complete Words only. n Search for every nth occurrence (ignore first n-1). Escape SEQUENCE FINDS SEQUENCE FINDS sequences: !. hard return (end of paragraph) !! ! !- soft hyphen !? ? !_ non-break hyphen !' ' ! non-break space !" " !~ footnote marker !a printer code 'a' != spell ignore marker !10 ascii code 10 `FINDB`FB` FINDB (FB). Searches for text in marked block only. Otherwise as FIND. Search option G (Global) only implies searching the whole block, not the whole text. `REPLACEB`RB` REPLACEB (RB). Searches and replaces text in marked block only. Otherwise as REPLACE. Search option G (Global) only implies searching and replacing in the whole block, not in the whole text. `F`R` F and R are abbreviated forms of FIND and REPLACE respectively. See these! `FIX`FIXB` FIX. Removes tabs, soft spaces and soft returns, converting to hard spaces and hard returns. Syntax: FIX FIXB. As for FIX, but on marked block. Syntax: FIXB `FORMAT`FT` FORMAT (FT). Formats whole text according to rulers and justification on/off. Syntax: FT Also available as block version FTB. `FORMATB`FTB` FORMATB (FTB). Formats block. Compare FORMAT. Syntax: FTB `NUMBER`NUM` NUMBER (NUM). Numbers text lines, or removes line numbers from text. A to add numbers, R to remove numbers from text. Syntax: NUM A|R Examples: NUM A 10 10 ; numbers from 10 and increase by 10 per line: 10, 20, 30 ... NUM R ; remove numbers Also available as block version NUMB. `NUMBERB`NUMB` NUMBERB (NUMB). Numbers text lines (or removes line numbers ) within marked block only. Compare NUM. Syntax: NUMB A|R `TAB`` TAB. Sets tab positions for PROG mode. Syntax: TAB ( *) Examples: TAB 9,15,40 ; tabs at columns 9,15,40 TAB *4 ; tabs at columns 5,9,13,... `ANAGRAM`AN` ANAGRAM (AN). Searches for all words that contains specified characters regardless of their order. Syntax: AN () Compare FINDW. `BUILD`BU` BUILD (BU). Spell checks text file and writes all words not recognized to file. This word file can later - after any editing that might be required - be added to a dictionary file (or be used to make a new dictionary). Syntax: BUILD Compare SPELL, and MAKED & INSWORDS `COUNTD`COD` COUNTD (COD). Counts words in dictionary. Syntax: COUNTD () `DELWORDS`DW` DELWORDS (DW). Removes words in text file from dictionary. Compare INSWORDS. Syntax: DW `FINDW`FW` FINDW (FW). Searches for all words with given characters, in given order. ? - stands for any one character. * - stands for any number of any characters. Syntax: FW () Compare ANAGRAM. `INSWORDS`IW` INSWORDS (IW). Adds the words in text file to dictionary file. Syntax: IW Compare DELWORDS, MAKED. `JOIND`JD` JOIND (JD). Joins two dictionary files together. If no name for the output file is expressly given, the name of input dictionary no 2 will be used, and this file will be overwritten by the resulting file. Syntax: JD () `LISTD`LD` LISTD (LD). Lists dictionary file, optionally to a file. By first creating a dictionary file and then listing it to a file, an alphabetically sorted word file may be created. Compare MAKED. Syntax: LD `LOOKUP`LK` LOOKUP (LK). Searches for similarly spelled words. Syntax: LK () `MAKED`MKD` MAKED (MKD). Makes a dictionary file that contains all words in text file. Syntax: MKD `SPELL`SC` SPELL (SC). Two pass spell check of text, optionally of file on disc. For each word not recognized, SPELL will stop and await action: V - View the word in its context. C - View the word in its context and possibly change it. L - Look up word in dictionary and find similarly spelled words. I - Ignore the word (leave it without action). B - Back to previously ignored word. S - Store word in dictionary. Syntax: SPELL Also available in block version SPELLB. Spell checking can also be done from edit mode with CTRL-S, CTRL-Q and SHIFT-CTRL-S Try also HELP subjects DCT, QIK, UWF and BUILD `CODE`` CODE. Displays the code numbers returned by the key pressed. Syntax: CODE `EXEC`X` EXEC (X). Executes a file of commands. Just type the commands in edit mode (in a new and empty file) as you would in command mode, and press return every time you normally would have had to do so to make the program act. Then save the file (with SAVE). After this you can at any time and repeatedly execute it with EXEC. If you want the Exec file to be able to execute editing commands, you can use the 'escape character': | (This is not necessary for command mode commands). Example: |765||744| enters edit mode and erase the block. Syntax: EXEC Other HELP-subjects: EXEC, CODE, PAUSE, ECHO `LMACROS`LM` LMACROS (LM). Lists defined macros. Syntax: LM `MACRO`KEY` MACRO (KEY). Defines macro. (This can alternatively be done with CTRL-f1). Syntax: KEY ; assign phrase to ALT+letter or KEY S ; assign phrase to SHIFT+ALT+letter or KEY ; assign phrase to function key or KEY S ; assign phrase to SHIFT+function key or KEY A ; assign phrase to ALT+function key or KEY C ; assign phrase to CTRL+function key ^ is 'escape character' and is used around numbers to be interpreted as code and not characters to be printed. For instance ^13^ produces a carriage return. The KEY files that are saved with the command SAVEKEYS are actually lists of KEY commands, and can be edited as ordinary text files. Other HELP subjects: MACROS, CODE, LMACROS `CALC`CA` CALC (CA). Calculates the value of a simple numeric expression. + - * / and parentheses can be used. When the result has been displayed, it can be inserted into the text as an integer (by pressing the space bar) or with required number of decimal places (by pressing the appropriate number key). Syntax: CALC `COUNT`CT` COUNT (CT). Counts words in text. Syntax: COUNT Also available as block version COUNTB. `COUNTB`CTB` COUNTB (CTB). Counts words in marked block. Syntax: COUNTB `GOTO`` GOTO (G). Enters edit mode with cursor on given Page/Row/Column. Syntax: GOTO or GOTO P or GOTO C `HELP`H` HELP (H). Displays Help information. Syntax: HELP or HELP Help on editing keys is provided within the menus (see HELP MENU). `LOADCFG`LCFG` LOADCFG (LCFG). Loads configuration file (CFG file). Compare STATUS, CONFIG. Syntax: LCFG `PAUSE`` PAUSE. Pauses (optionally with message). For EXEC files. Syntax: PAUSE (message) `QUIT`Q` QUIT (Q). Quits Protext. Syntax: Q `STATUS`STAT` STATUS (STAT). Lists important settings in currently loaded configuration file. Syntax: STAT Compare LOADCFG and CONFIG. `CONFIG`` CONFIG (CFG). Menu driven configuration program. When you call this, it will automatically load the same configuration file that currently determines the various working parameters of Protext. If you make changes and then save this file under the same name, you will be able to observe these changes as soon as you return to Protext. Syntax: CFG Note: This is an external command, so the program must be available on disc. Compare STATUS and LCFG `CONVERT`CV` CONVERT (CV). File conversion program. Syntax: CV (outfile) ; converts input file according to conv-type. CV ? ; gives help info on conversion types. CV ; Calls CONVERT menu (simplest method of use). Note: This is an external command, so the program must be available on disc. Compare SAVEA. `LIFE`` Can't help you with that one! `ARNOR`` See "The Lord of the Rings" by J.R.R.Tolkien. Alternatively, write to: Arnor 611 Lincoln Road PETERBOROUGH PE1 3HA England Tel: +44 (733) 68909 Fax: +44 (733) 67299 `PROTEXT`` Almost everything you might wish to know is covered in the manual. For the latest information see the file 'README'. `PATH`` The 'path', or 'search path' specifies the directory in which Protext looks for auxiliary files and programs. Examples of files that Protext tries to find here are dictionaries, printer drivers, the help file, macro files, exec files and external utilities (CONFIG and CONVERT). It will normally refer to the directory called 'PROTEXT' - on drive B on a floppy disc system, or on the hard disc. The path can be changed using CONFIG. `TEMPATH`` The 'temporary file path' specifies the directory which Protext uses for storing parts of a file which is too large to fit into memory. The temporary path can be changed using CONFIG. `BUGS`BUG` If you think you have found a bug in Protext, please write to Arnor giving as full a description of what you were doing when it occurred. Please quote the Protext version as displayed on the banner line, and please also give details of your computer and operating system (e.g. Protext v4.30 on a 1040STE with 1Mb memory). Type 'HELP ARNOR' for the address. `MENUS`MENU` Menus are provided as an alternative to command mode. Commands can be selected from menus in two ways, either using the mouse or the keyboard. To use the menus with the mouse first click the right mouse button. This will cause the menu bar to be displayed. Then move the mouse pointer over the menu bar. As the pointer moves over each menu title that menu will be displayed. To select a menu option move the pointer over the required line of the menu, which will then be highlighted. Click the left mouse button to perform the operation. To use the menus with the keyboard first press the menu key (f3), use the left and right cursor keys to select a menu and then the up and down cursor keys to select a menu line. Press RETURN to perform the operation. Some menu items are shown fainter than the rest and do not become highlighted. These options are unavailable in the current context - for example block operations when no block is defined. Some menu items are marked with ''. This means that selected this causes another 'submenu' to be called up. The descriptions in the menus include the equivalent keyboard commands. In these '^' means press the CTRL key, 's' means SHIFT, 'a' means 'ALT'. `BLOCKS`BLOCK` Most of those commands that in various ways operate on the loaded text, are available as block versions as well, which only operate on the the section of text that has been marked with the block markers. There is no need to learn these specifically, since they all have the same name as the main command with just a 'B' appended. For example, COUNT counts all the words in the document. COUNTB just the words between the block markers. The following commands are available as block versions: SAVE, SAVEA, PRINTF, PRINTS, PRINT, PRINTQ, SPELL, FIND, REPLACE, FORMAT, FIX, COUNT, NUMBER. Block markers are set in edit mode by placing the cursor at the required position and pressing CTRL-Z or by 'clicking and dragging' the mouse. `CONT`CO` CONT. Resumes background printing after STOP. Syntax: CO `STOP`ST` STOP. Stops printer but leaves text in printer buffer. Resume with CO. Syntax: ST Compare ABANDON `CLEARKEYS`CLRK` CLEARKEYS (CLRK). Removes all user defined macros and resets the supplied default macros. (Use LDK without any parameters to reset your own macros, as they were when you last saved them). CLEARKEYS N (CLRK N). Removes all macros. (Use KEY to remove a single macro). `LOADKEYS`LDK` LOADKEYS (LDK). Loads macro definitions from file. Existing definitions are left untouched if not redefined in the file. Syntax: LDK ; loads given macro file LDK ; reloads last macro file (resets after a mistake). Compare SVK, CLRK `SAVEKEYS`SVK` SAVEKEYS (SVK). Saves macro definitions in a file. Syntax: SVK () Compare KEY, LDK `FF`` FF. Sends a Form Feed character to printer. Syntax: FF `ECHO`` ECHO. Turns on or off echoing to screen of commands in an exec file. Syntax: ECHO OFF ECHO ON `SYMBOL`SYM` SYMBOL (SYM). Changes the appearance on screen of a character. Syntax: SYM ... ; for medium resolution SYM ... ; for high resolution Each number determines a dot (pixel) row (eight pixels) in the symbol, and is calculated as the sum of certain values for each filled pixel in the row: Pixel column: 1 2 3 4 5 6 7 8 Term to add : 1 2 4 8 16 32 64 128 E.g. 129 produces one dot in the start and one in the end of the row (1+128=129) `DATE`TIME` DATE and TIME sets the system clock. This is used for dating files and can be called into the documents during editing (ALT-D and ALT-T) or during printing. Alternatively CONTROL.ACC can be used. `INK`` INK is used to determine the shade of colour for each of the colour numbers that the computer can show. The use of these colours may then be set up with CONFIG. Colour Syntax: INK no,&rgb ; sets given colour number (0-3) to a colour shade determined from the three numbers (0-7) 'r' 'g' and 'b'. Example: INK 2,&070 ; makes colour no 2 light green. Mono Syntax: INK 0,0 ; sets black on white on a monochrome monitor. INK 0,1 ; sets white on black on a monochrome monitor. ; As an alternative for mono monitors the colours can be ; set with CONFIG, wich leaves the colours of the desktop ; unchanged. Alternatively CONTROL.ACC can be used, but the INK command (and CONFIG) has the advantage that all colour settings will be automatically restored upon exit from Protext. `TOUCH`` TOUCH. 'Touches' a file so that it is set to current time and date. Syntax: TOUCH `DESKTOP`ACC` The auxiliary programs of the Desktop (The ACC files) can be accessed simply by pressing the left mouse button while the pointer is on the top status line. #a000000 #b000000 #c7770007000600070055200505552220770557075055507703111103 #d #E DB 02 #W 00 00 0A 01 21 17 08 A:\*.*@ #W 00 00 0D 08 2A 0B 00 @ #W 00 00 0E 09 2A 0B 00 @ #W 00 00 0F 0A 2A 0B 00 @ #M 00 00 00 FF A FLOPPY DISK@ @ #M 00 01 00 FF B FLOPPY DISK@ @ #T 00 03 02 FF TRASH@ @ #F FF 04 @ *.*@ #D FF 01 @ *.*@ #G 03 FF *.APP@ @ #G 03 FF *.PRG@ @ #F 03 04 *.TOS@ @ #P 03 04 *.TTP@ @ >>> This file contains 60 of each character, and is used for calculating >>> character widths for use with proportional printing. >>> >>> Note: This file may print extra characters on some printers, for example >>> on daisywheels. These may be ignored, or deleted before the file is >>> printed >zm >ppoff  . .  !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! """""""""""""""""""""""""""""""""""""""""""""""""""""""""""" ############################################################ $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% &&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&& '''''''''''''''''''''''''''''''''''''''''''''''''''''''''''' (((((((((((((((((((((((((((((((((((((((((((((((((((((((((((( )))))))))))))))))))))))))))))))))))))))))))))))))))))))))))) ************************************************************ ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, ------------------------------------------------------------ ............................................................ //////////////////////////////////////////////////////////// 000000000000000000000000000000000000000000000000000000000000 111111111111111111111111111111111111111111111111111111111111 222222222222222222222222222222222222222222222222222222222222 333333333333333333333333333333333333333333333333333333333333 444444444444444444444444444444444444444444444444444444444444 555555555555555555555555555555555555555555555555555555555555 666666666666666666666666666666666666666666666666666666666666 777777777777777777777777777777777777777777777777777777777777 888888888888888888888888888888888888888888888888888888888888 999999999999999999999999999999999999999999999999999999999999 :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;; <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< ============================================================ >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> ???????????????????????????????????????????????????????????? @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY ZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZ [[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[ \\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\ ]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]] ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ ____________________________________________________________ ```````````````````````````````````````````````````````````` aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc dddddddddddddddddddddddddddddddddddddddddddddddddddddddddddd eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee ffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff gggggggggggggggggggggggggggggggggggggggggggggggggggggggggggg hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii jjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjj kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk llllllllllllllllllllllllllllllllllllllllllllllllllllllllllll mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo pppppppppppppppppppppppppppppppppppppppppppppppppppppppppppp qqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr ssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss tttttttttttttttttttttttttttttttttttttttttttttttttttttttttttt uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvv wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyy zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz {{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| }}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}} ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~       rem HP DeskJet/Deskjet Plus (using internal PC-8 character set) rem Supports Presentation cartridge M (with US ASCII symbol set) cc '@'=27,"E",27,"&k0G",27,"(10U",27,"(s1Q" cc 'b'=27,"(s3B" ; 27,"(s0B" cc 'i'=27,"(s1S" ; 27,"(s0S" cc 'q'=27,"(s2Q" ; 27,"(s1Q" cc 's'=27,"&a+0.25R" ; 27,"&a-0.25R" ;; subscript cc 't'=27,"&a-0.25R" ; 27,"&a+0.25R" ;; superscript cc 'u'=27,"&d0D" ; 27,"&d@" rem Character redefinitions using PC-8 Symbol set rc ''=27,"&p1X",2 rc ''=27,"&p1X",3 rc ''=27,"&p1X",4 rc ''=27,"&p1X",5 rc ''=27,"&p1X",6 rc ' '=27,"&p1X",11 rc 12=13,12 ;; form feed rc ''=27,"&p1X",14 rc ''=27,"&p1X",15 rc ''=27,"&p1X",16 rc ''=27,"&p1X",17 rc ''=27,"&p1X",18 rc ''=27,"&p1X",19 rc ''=27,"&p1X",20 rc ''=27,"&p1X",21 rc ''=27,"&p1X",22 rc ''=27,"&p1X",23 rc ''=27,"&p1X",24 rc ''=27,"&p1X",25 rc ''=27,"&p1X",26 rc ''=27,"&p1X",27 rc ''=27,"&p1X",28 rc ''=27,"&p1X",29 rc ''=27,"&p1X",30 rc ''=27,"&p1X",31 rem accented chars defined so as not to be split into letter and accent rc ''=128 rc ''=129 rc ''=130 rc ''=131 rc ''=132 rc ''=133 rc ''=134 rc ''=135 rc ''=136 rc ''=137 rc ''=138 rc ''=139 rc ''=140 rc ''=141 rc ''=142 rc ''=143 rc ''=144 rc ''=145 rc ''=146 rc ''=147 rc ''=148 rc ''=149 rc ''=150 rc ''=151 rc ''=152 rc ''=153 rc ''=154 rc ''=27,"(8U",214,27,"(10U" ;; o slash rc ''=156 rc ''=27,"(8U",210,27,"(10U" ;; O slash IF PC rc ''=158 ENDIF IF ST rc 158=27,"(8U",222,27,"(10U" ;; double s ENDIF rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 rc ''=27,"(8U",222,27,"(10U" rc ''=27,"(10U",175 rc ''=27,"(8U",227,27,"(10U" rc ''=27,"(8U",228,27,"(10U" rc ''=27,"(8U",240,27,"(10U" rc ''=27,"(8U",241,27,"(10U" rc ''=27,"(11U",158,27,"(10U" rc ''=27,"(11U",159,27,"(10U" IF ANSI rc ''=218 rc ''=191 rc ''=192 rc ''=217 rc ''=196 rc ''=179 rc ''=194 rc ''=193 rc ''=197 rc ''=195 rc ''=180 rc ''=166 rc ''=167 rc ''=168 rc ''=170 rc ''=171 rc ''=172 rc ''=173 rc ''=174 rc ''=230 rc ''=241 rc ''=246 rc ''=248 rc ''=250 rc 164=27,"(8U",186,27,"(10U" ;; curr. sym. rc 165=27,"(8U",188,27,"(10U" ;; yen rc 166=27,"(0N",166,27,"(10U" ;; vert rc 169=27,"(0N",169,27,"(10U" ;; copyright rc 174=27,"(0N",174,27,"(10U" ;; registered rc 175=27,"(0N",175,27,"(10U" ;; overline rc 179=27,"(0N",179,27,"(10U" ;; super 3 rc 190=27,"(8U",245,27,"(10U" ;; 3/4 rc 215=27,"(0N",215,27,"(10U" ;; multiply ENDIF hl 27,"=" mm 2 mf 1 ff on cw 30 cc 'c'=27,"(s20H" ; 27,"(s10H" cc 'e'=27,"(s16.67H" ; 27,"(s10H" cc 'l'=27,"(s5H" ; 27,"(s10H" cc 'p'=27,"(s1P" ; 27,"(s0P" rem Diablo 630, Brother HR15/HR25, Epson DX100 rem Apricot Writer 31XL cc '@'=27,13,"P",27,"&",27,"R" ;; reset code cc 'b'=27,"W" ; 27,"&" ;; bold (shadow) cc 'd'=27,"O" ; 27,"&" ;; double strike cc 's'=27,30,6,27,"U" ; 27,"D",27,30,9 ;; subscript cc 't'=27,30,6,27,"D" ; 27,"U",27,30,9 ;; superscript cc 'u'=27,"E" ; 27,"R" ;; underline cc 'r'=27,"A" ; 27,"B" ;; ribbon change rc 12=13,12 rc ''="#" IF SWEDISH rc ''=64 rc ''=91 rc ''=92 rc ''=93 rc ''=94 rc ''=96 rc ''=123 rc ''=124 rc ''=125 rc ''=126 ENDIF IF GERMAN rc ''=64 rc ''=91 rc ''=92 rc ''=93 rc ''=123 rc ''=124 rc ''=125 rc ''=126 ENDIF hl 27,"U" ab 0,0,0,27,26,"I" mm 3 mf 1 cw 12 pw 10 cc 'c'=27,31,9 ; 27,"S" cc 'e'=27,31,11 ; 27,"S" cc 'n'=27,31,13 ; 27,"S" cc 'p'=27,"P" ; 27,"Q" cc 'l'=27,17,10 ; 27,17,64 width ' '=10,6,8,12,10,14,14,6,6,6,10,10,6,8,6,8 width '0'=10,10,10,10,10,10,10,10,10,10 width ':'=6,6,10,10,10,10 width '@'=16,14,12,14,14,12,12,14,14,6,10,14,12,16 width 'N'=14,14,12,14,14,10,12,14,12,16,14,14,12 width '['=10,8,12,10,10 width '`'=8 width 'a'=10,10,10,10,10,8,10,10,6,6,10,6,16 width 'n'=10,10,10,10,8,8,8,10,10,14,10,10,10 width '{'=10,12,10,12 width ''=10 width ''=10 width ''=12 width ''=10 rem DeskJet 500 with CG Times (using internal PC-8 character set) cc '@'=27,"E",27,"&k0G",27,"&l1E",27,"(10U",27,"(s1Q" cc 'b'=27,"(s3B" ; 27,"(s0B" cc 'i'=27,"(s1S" ; 27,"(s0S" cc 'q'=27,"(s2Q" ; 27,"(s1Q" cc 's'=27,"&a+0.25R" ; 27,"&a-0.25R" ;; subscript cc 't'=27,"&a-0.25R" ; 27,"&a+0.25R" ;; superscript cc 'u'=27,"&d0D" ; 27,"&d@" cc 'c'=27,"(s20H" ; 27,"(s10H" cc 'e'=27,"(s16.67H" ; 27,"(s10H" cc 'l'=27,"(s5H" ; 27,"(s10H" cc 'g'=27,"(s0p12h12v6T" ; 27,"(s0p12v10h3T" ;; gothic 12 pt, 12 cpi cc 'p'=27,"(s1p12v4101T" ; 27,"(s0p12v10h3T" ;; cg times 12 pt cc 'r'=27,"(s1p12v4101T" ; 27,"(s0p12v10h3T" ;; cg times 12 pt rem Character redefinitions using PC-8 Symbol set rc ''=27,"&p1X",2 rc ''=27,"&p1X",3 rc ''=27,"&p1X",4 rc ''=27,"&p1X",5 rc ''=27,"&p1X",6 rc ' '=27,"&p1X",11 rc 12=13,12 ;; form feed rc ''=27,"&p1X",14 rc ''=27,"&p1X",15 rc ''=27,"&p1X",16 rc ''=27,"&p1X",17 rc ''=27,"&p1X",18 rc ''=27,"&p1X",19 rc ''=27,"&p1X",20 rc ''=27,"&p1X",21 rc ''=27,"&p1X",22 rc ''=27,"&p1X",23 rc ''=27,"&p1X",24 rc ''=27,"&p1X",25 rc ''=27,"&p1X",26 rc ''=27,"&p1X",27 rc ''=27,"&p1X",28 rc ''=27,"&p1X",29 rc ''=27,"&p1X",30 rc ''=27,"&p1X",31 rem accented chars defined so as not to be split into letter and accent rc ''=128 rc ''=129 rc ''=130 rc ''=131 rc ''=132 rc ''=133 rc ''=134 rc ''=135 rc ''=136 rc ''=137 rc ''=138 rc ''=139 rc ''=140 rc ''=141 rc ''=142 rc ''=143 rc ''=144 rc ''=145 rc ''=146 rc ''=147 rc ''=148 rc ''=149 rc ''=150 rc ''=151 rc ''=152 rc ''=153 rc ''=154 rc ''=27,"(8U",214,27,"(10U" ;; o slash rc ''=156 rc ''=27,"(8U",210,27,"(10U" ;; O slash IF PC rc ''=158 ENDIF IF ST rc 158=27,"(8U",222,27,"(10U" ;; double s ENDIF rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 rc ''=27,"(8U",222,27,"(10U" rc ''=27,"(10U",175 IF ANSI rc ''=218 rc ''=191 rc ''=192 rc ''=217 rc ''=196 rc ''=179 rc ''=194 rc ''=193 rc ''=197 rc ''=195 rc ''=180 rc ''=166 rc ''=167 rc ''=168 rc ''=170 rc ''=171 rc ''=172 rc ''=173 rc ''=174 rc ''=230 rc ''=241 rc ''=246 rc ''=248 rc ''=250 rc 164=27,"(8U",186,27,"(10U" ;; curr. sym. rc 165=27,"(8U",188,27,"(10U" ;; yen rc 166=27,"(0N",166,27,"(10U" ;; vert rc 169=27,"(0N",169,27,"(10U" ;; copyright rc 174=27,"(0N",174,27,"(10U" ;; registered rc 175=27,"(0N",175,27,"(10U" ;; overline rc 179=27,"(0N",179,27,"(10U" ;; super 3 rc 190=27,"(8U",245,27,"(10U" ;; 3/4 rc 215=27,"(0N",215,27,"(10U" ;; multiply ENDIF hl 27,"=" mm 2 mf 1 ff on cw 30 pw 21 widths 15 !17 "23 #25 $25 %44 &39 '17 (17 )17 *25 +44 ,17 -17 .17 /17 025 125 225 325 425 525 625 725 825 925 :17 ;17 <50 =44 >50 ?22 @44 A36 B31 C34 D37 E31 F30 G36 H37 I17 J19 K35 L31 M45 N37 O36 P29 Q36 R33 S27 T31 U37 V36 W47 X36 Y36 Z32 [17 \17 ]17 ^25 _25 `17 a22 b25 c22 d25 e22 f17 g25 h25 i14 j14 k25 l14 m39 n25 o25 p25 q25 r18 s19 t14 u25 v25 w36 x25 y25 z22 {22 |25 }22 ~25 34 25 22 22 22 22 22 22 22 22 22 14 14 14 36 36 31 33 44 25 25 25 25 25 25 36 37 25 25 25 44 25 22 14 25 25 25 37 25 25 22 44 44 44 44 17 20 20 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 30 25 30 30 30 25 28 22 33 36 30 22 50 30 19 50 50 44 50 50 36 36 44 50 25 0 0 36 25 18 25 25 36 50 50 50 50 50 50 36 36 50 36 36 36 26 25 25 50 36 36 36 36 36 44 36 36 36 rem General Epson 9 pin (with 8 intl char sets, without ibm char set) rem as FX80 but without reverse line feed in line draw graphics cc '@'=27,"@" cc 'b'=27,"E",27,"G"; 27,"F",27,"H" cc 'c'=15 ; 18 cc 'e'=27,"M" ; 27,"P" cc 'i'=27,"4" ; 27,"5" cc 'l'=27,"W",1 ; 27,"W",0 cc 'n'=27,"P" cc 'p'=27,"p",1 ; 27,"p",0 cc 'q'=27,"(",0,27,"x",1 ; 27,"x",0 cc 's'=27,"S",1 ; 27,"T" cc 't'=27,"S",0 ; 27,"T" cc 'u'=27,"-",1 ; 27,"-",0 rc '#'=27,"R",0,"#" rc '$'=27,"R",0,"$" rc '@'=27,"R",0,"@" rc '['=27,"R",0,"[" rc '\'=27,"R",0,"\" rc ']'=27,"R",0,"]" rc '^'=27,"R",0,"^" rc '`'=27,"R",0,"`" rc '{'=27,"R",0,"{" rc '|'=27,"R",0,"|" rc '}'=27,"R",0,"}" rc '~'=27,"R",0,"~" rc ''=27,"R",1,"@" rc ''=27,"R",1,"[" rc ''=27,"R",1,"\" rc ''=27,"R",1,"{" rc ''=27,"R",1,"|" rc ''=27,"R",1,"}" rc ''=27,"R",2,"[" rc ''=27,"R",2,"\" rc ''=27,"R",2,"]" rc ''=27,"R",2,"{" rc ''=27,"R",2,"|" rc ''=27,"R",2,"}" rc ''=27,"R",2,"~" rc ''=27,"R",3,"#" rc ''=27,"R",4,"[" rc ''=27,"R",4,"]" rc ''=27,"R",4,"{" rc ''=27,"R",4,"}" rc ''=27,"R",5,"@" rc ''=27,"R",6,"|" rc ''=27,"R",6,"~" rc ''=27,"R",7,"[" rc ''=27,"R",7,"\" rc ''=27,"R",7,"]" rc ''=27,"R",7,"|" rc ''=27,"L",12,0, 18,40,130,40,130,40,130,112,10,0,0,0 rc ''=27,"L",12,0, 2,112,138,0,138,0,138,112,2,0,0,0 rc ''=27,"L",12,0, 64,0,248,0,9,18,1,20,9,0,0,0 rc ''=27,"L",12,0, 64,0,250,4,10,0,31,0,2,0,0,0 rc ''=27,"K",6,0, 16,40,84,40,68,0 rc ''=27,"K",6,0, 68,40,84,40,16,0 rc ''=27,"L",12,0, 0,20,2,16,2,124,128,16,128,16,0,0 rc ''=">",8,"_" rc ''="<",8,"_" rc ''="+",8,"_" rc ''="C",8,"," rc ''="a",8,27,"R",0,"^" rc ''="e",8,27,"R",0,"^" rc ''="i",8,27,"R",0,"^" rc ''="o",8,27,"R",0,"^" rc ''="u",8,27,"R",0,"^" rc ''="e",8,27,"R",1,"~" rc ''="i",8,27,"R",1,"~" rc ''="y",8,27,"R",1,"~" rc ''="a",8,27,"K",6,0,0,0,64,128,0,0 rc ''="i",8,27,"K",6,0,0,0,64,128,0,0 rc ''="o",8,27,"K",6,0,0,0,64,128,0,0 rc ''="u",8,27,"K",6,0,0,0,64,128,0,0 rc ''=27,"R",1,"]" rc ''=27,"R",4,"\" rc ''=27,"R",4,"|" rc ''=27,"K",6,0, 32,64,254,64,32,0 rc ''=27,"K",6,0, 8,4,254,4,8,0 rc ''=27,"L",12,0, 16,16,16,16,16,16,84,56,16,0,0,0 rc ''=27,"L",12,0, 16,56,84,16,16,16,16,16,16,0,0,0 rc ''=27,"L",12,0, 64,0,240,0,254,0,128,126,128,0,0,0 rc ''=27,"K",6,0, 0,0,15,8,8,8 rc ''=27,"K",6,0, 8,8,15,0,0,0 rc ''=27,"K",6,0, 0,0,248,8,8,8 rc ''=27,"K",6,0, 8,8,248,0,0,0 rc ''=27,"K",6,0, 8,8,8,8,8,8 rc ''=27,"K",6,0, 0,0,255,0,0,0 rc ''=27,"K",6,0, 8,8,15,8,8,8 rc ''=27,"K",6,0, 8,8,248,8,8,8 rc ''=27,"K",6,0, 8,8,255,8,8,8 rc ''=27,"K",6,0, 0,0,255,8,8,8 rc ''=27,"K",6,0, 8,8,255,0,0,0 IF PC rc ''=27,"R",7,"#" ENDIF IF ST rc 158=27,"R",2,"~" ENDIF hl 27,"J",18 pscode 27,"9"; 27,"8" IF VER5 pp on ms off mm 1 mf 4 double L regular bcilpqstu group en ELSE mm 1 mf 2 pw 10 cw 12 ENDIF rem all units assume 1/240" (9 pin dot matrix) IF VER5 rules qp=5,p=4,ce=3,c=1,e=2,n=0 font 0 ; normal pica cw 24 font 1 ; condensed pica cw 14 copyrc 0 rc ''=27,"L",7,0, 0,0,0,15,8,8,8 rc ''=27,"L",7,0, 8,8,8,15,0,0,0 rc ''=27,"L",7,0, 0,0,0,248,8,8,8 rc ''=27,"L",7,0, 8,8,8,248,0,0,0 rc ''=27,"L",7,0, 8,8,8,8,8,8,8 rc ''=27,"L",7,0, 0,0,0,255,0,0,0 rc ''=27,"L",7,0, 8,8,8,15,8,8,8 rc ''=27,"L",7,0, 8,8,8,248,8,8,8 rc ''=27,"L",7,0, 8,8,8,255,8,8,8 rc ''=27,"L",7,0, 0,0,0,255,8,8,8 rc ''=27,"L",7,0, 8,8,8,255,0,0,0 font 2 ; elite cw 20 copyrc 0 rc ''=27,"K",5,0, 0,0,15,8,8 rc ''=27,"K",5,0, 8,8,15,0,0 rc ''=27,"K",5,0, 0,0,248,8,8 rc ''=27,"K",5,0, 8,8,248,0,0 rc ''=27,"K",5,0, 8,8,8,8,8 rc ''=27,"K",5,0, 0,0,255,0,0 rc ''=27,"K",5,0, 8,8,15,8,8 rc ''=27,"K",5,0, 8,8,248,8,8 rc ''=27,"K",5,0, 8,8,255,8,8 rc ''=27,"K",5,0, 0,0,255,8,8 rc ''=27,"K",5,0, 8,8,255,0,0 font 3 ; condensed elite (may not be possible) cw 12 copyrc 0 rc ''=27,"K",3,0, 0,15,8 rc ''=27,"K",3,0, 8,15,0 rc ''=27,"K",3,0, 0,248,8 rc ''=27,"K",3,0, 8,248,0 rc ''=27,"K",3,0, 8,8,8 rc ''=27,"K",3,0, 0,255,0 rc ''=27,"K",3,0, 8,15,8 rc ''=27,"K",3,0, 8,248,8 rc ''=27,"K",3,0, 8,255,8 rc ''=27,"K",3,0, 0,255,8 rc ''=27,"K",3,0, 8,255,0 font 4 ; draft proportional (widths not available, treat as elite) pw 20 cw 20 font 5 ; nlq proportional (widths not available, treat as elite) pw 20 cw 20 ENDIF rem General Epson 24 pin (8 intl char sets, without IBM char set) rem Epson SQ2000 ink jet printer. Also Fujitsu 24 pin. rem This is a subset of LQ1000 driver cc '@'=27,"@",27,"x",0 cc 'b'=27,"E",27,"G"; 27,"F",27,"H" cc 'c'=15 ; 18 cc 'e'=27,"M" ; 27,"P" cc 'i'=27,"4" ; 27,"5" cc 'l'=27,"W",1 ; 27,"W",0 cc 'n'=27,"P" cc 'p'=27,"p",1 ; 27,"p",0 cc 'q'=27,"x",1 ; 27,"x",0 cc 's'=27,"S",1 ; 27,"T" cc 't'=27,"S",0 ; 27,"T" cc 'u'=27,"-",1 ; 27,"-",0 rc '#'=27,"R",0,"#" rc '$'=27,"R",0,"$" rc '@'=27,"R",0,"@" rc '['=27,"R",0,"[" rc '\'=27,"R",0,"\" rc ']'=27,"R",0,"]" rc '^'=27,"R",0,"^" rc '`'=27,"R",0,"`" rc '{'=27,"R",0,"{" rc '|'=27,"R",0,"|" rc '}'=27,"R",0,"}" rc '~'=27,"R",0,"~" rc ''=27,"R",1,"@" rc ''=27,"R",1,"[" rc ''=27,"R",1,"\" rc ''=27,"R",1,"]" rc ''=27,"R",1,"{" rc ''=27,"R",1,"|" rc ''=27,"R",1,"}" rc ''=27,"R",2,"~" rc ''=27,"R",3,"#" rc ''=27,"R",4,"[" rc ''=27,"R",4,"\" ;; O slash rc ''=27,"R",4,"]" rc ''=27,"R",4,"{" rc ''=27,"R",4,"|" ;; o slash rc ''=27,"R",4,"}" rc ''=27,"R",5,"@" rc ''=27,"R",5,"[" rc ''=27,"R",5,"\" rc ''=27,"R",5,"^" rc ''=27,"R",5,"{" rc ''=27,"R",5,"|" rc ''=27,"R",5,"~" rc ''=27,"R",6,"|" rc ''=27,"R",6,"~" rc ''=27,"R",7,"[" rc ''=27,"R",7,"\" rc ''=27,"R",7,"]" rc ''=27,"R",7,"|" rc ''=27,"L",12,0, 18,40,130,40,130,40,130,112,10,0,0,0 rc ''=27,"L",12,0, 2,112,138,0,138,0,138,112,2,0,0,0 rc ''=27,"L",12,0, 0,20,2,16,2,124,128,16,128,16,0,0 rc ''=">",8,"_" rc ''="<",8,"_" rc ''="+",8,"_" IF PC rc ''=27,"R",7,"#" ENDIF IF ST rc 158=27,"R",2,"~" ENDIF rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,64,0,0,192,0,1,192,0,7,192,0,31,192,0,63,255,192,31,192,0,7,192,0,1,192,0,0,192,0,0,64,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,48,0,0,56,0,0,62,0,0,63,128,63,255,192,0,63,128,0,62,0,0,56,0,0,48,0,0,32,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,7,255,0,3,254,0,1,252,0,0,248,0,0,248,0,0,112,0,0,112,0,0,32,0,0,32,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,32,0,0,112,0,0,112,0,0,248,0,0,248,0,1,252,0,3,254,0,7,255,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,6,0,96,12,0,127,24,0,127,48,0,0,96,0,0,192,0,1,144,192,3,48,192,6,97,192,12,99,192,24,62,192,16,28,192,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,6,0,96,12,0,127,24,0,127,51,0,0,103,0,0,207,0,1,155,0,3,51,0,6,127,192,12,127,192,24,3,0,16,3,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,4,0,64,6,0,192,3,1,128,1,131,0,0,198,0,4,108,64,6,56,192,3,17,128,1,131,0,0,198,0,0,108,0,0,56,0,0,16,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,16,0,0,56,0,0,108,0,0,198,0,1,131,0,3,17,128,6,56,192,4,108,64,0,198,0,1,131,0,3,1,128,6,0,192,4,0,64,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,127,255,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,127,255,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,255,192,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,255,192,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,255,255,255,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,255,255,255,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,255,255,255,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,255,255,255,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,255,192,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,127,255,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0 hl 27,"J",15 pscode 27,"9"; 27,"8" mm 4 mf 2 cw 36 pw 30 rem all widths are in units of 1/360" widths 30 !18 "30 #30 $30 %36 &36 '18 (24 )24 *30 +30 ,18 -30 .18 /30 030 130 230 330 430 530 630 730 830 930 :18 ;18 <30 =30 >30 ?30 @36 A36 B36 C36 D36 E36 F36 G36 H36 I24 J30 K36 L36 M42 N36 O36 P36 Q36 R36 S36 T36 U42 V36 W42 X36 Y36 Z30 [24 \30 ]24 ^30 _30 `18 a30 b36 c30 d36 e30 f24 g36 h36 i18 j24 k36 l18 m42 n36 o30 p36 q36 r30 s30 t24 u36 v36 w42 x30 y36 z30 {24 |18 }24 ~30 36 36 30 30 30 30 30 30 30 30 30 18 18 18 36 36 36 42 42 30 30 30 36 36 36 36 42 30 30 36 42 36 30 18 30 36 36 36 36 36 30 36 36 30 36 36 36 30 30 30 30 36 36 36 36 36 36 36 36 36 36 36 36 36 36 36 36 36 rem General Epson 24 pin (8 intl char sets, without IBM char set) rem This is the same as Epson24 but with better line draw chars + ascend cc '@'=27,"@",27,"x",0 cc 'b'=27,"E",27,"G"; 27,"F",27,"H" cc 'c'=15 ; 18 cc 'e'=27,"M" ; 27,"P" cc 'i'=27,"4" ; 27,"5" cc 'l'=27,"W",1 ; 27,"W",0 cc 'n'=27,"P" cc 'p'=27,"p",1 ; 27,"p",0 cc 'q'=27,"x",1 ; 27,"x",0 cc 's'=27,"S",1 ; 27,"T" cc 't'=27,"S",0 ; 27,"T" cc 'u'=27,"-",1 ; 27,"-",0 rc '#'=27,"R",0,"#" rc '$'=27,"R",0,"$" rc '@'=27,"R",0,"@" rc '['=27,"R",0,"[" rc '\'=27,"R",0,"\" rc ']'=27,"R",0,"]" rc '^'=27,"R",0,"^" rc '`'=27,"R",0,"`" rc '{'=27,"R",0,"{" rc '|'=27,"R",0,"|" rc '}'=27,"R",0,"}" rc '~'=27,"R",0,"~" rc ''=27,"R",1,"@" rc ''=27,"R",1,"[" rc ''=27,"R",1,"\" rc ''=27,"R",1,"]" rc ''=27,"R",1,"{" rc ''=27,"R",1,"|" rc ''=27,"R",1,"}" rc ''=27,"R",2,"~" rc ''=27,"R",3,"#" rc ''=27,"R",4,"[" rc ''=27,"R",4,"\" ;; O slash rc ''=27,"R",4,"]" rc ''=27,"R",4,"{" rc ''=27,"R",4,"|" ;; o slash rc ''=27,"R",4,"}" rc ''=27,"R",5,"@" rc ''=27,"R",5,"[" rc ''=27,"R",5,"\" rc ''=27,"R",5,"^" rc ''=27,"R",5,"{" rc ''=27,"R",5,"|" rc ''=27,"R",5,"~" rc ''=27,"R",6,"|" rc ''=27,"R",6,"~" rc ''=27,"R",7,"[" rc ''=27,"R",7,"\" rc ''=27,"R",7,"]" rc ''=27,"R",7,"|" rc ''=27,"L",12,0, 18,40,130,40,130,40,130,112,10,0,0,0 rc ''=27,"L",12,0, 2,112,138,0,138,0,138,112,2,0,0,0 rc ''=27,"L",12,0, 0,20,2,16,2,124,128,16,128,16,0,0 rc ''=">",8,"_" rc ''="<",8,"_" rc ''="+",8,"_" IF PC rc ''=27,"R",7,"#" ENDIF IF ST rc 158=27,"R",2,"~" ENDIF rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,64,0,0,192,0,1,192,0,7,192,0,31,192,0,63,255,192,31,192,0,7,192,0,1,192,0,0,192,0,0,64,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,48,0,0,56,0,0,62,0,0,63,128,63,255,192,0,63,128,0,62,0,0,56,0,0,48,0,0,32,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,7,255,0,3,254,0,1,252,0,0,248,0,0,248,0,0,112,0,0,112,0,0,32,0,0,32,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,32,0,0,112,0,0,112,0,0,248,0,0,248,0,1,252,0,3,254,0,7,255,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,6,0,96,12,0,127,24,0,127,48,0,0,96,0,0,192,0,1,144,192,3,48,192,6,97,192,12,99,192,24,62,192,16,28,192,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,6,0,96,12,0,127,24,0,127,51,0,0,103,0,0,207,0,1,155,0,3,51,0,6,127,192,12,127,192,24,3,0,16,3,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,4,0,64,6,0,192,3,1,128,1,131,0,0,198,0,4,108,64,6,56,192,3,17,128,1,131,0,0,198,0,0,108,0,0,56,0,0,16,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,16,0,0,56,0,0,108,0,0,198,0,1,131,0,3,17,128,6,56,192,4,108,64,0,198,0,1,131,0,3,1,128,6,0,192,4,0,64,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,127,255,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0, 27,"J",12, 8, 27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,15,255,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, 27,"j",12 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,127,255,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, 27,"J",12, 8, 27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,15,255,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, 27,"j",12 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,255,192,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,255,192,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,255,255,255,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, 27,"J",12, 8, 27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,15,255,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, 27,"j",12 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,255,255,255,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0, 27,"J",12, 8, 27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,15,255,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, 27,"j",12 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,255,255,255,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, 27,"J",12, 8, 27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,15,255,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, 27,"j",12 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,255,255,255,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0, 27,"J",12, 8, 27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,15,255,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, 27,"j",12 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,255,192,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,127,255,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0, 27,"J",12, 8, 27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,15,255,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, 27,"j",12 hl 27,"J",15 pscode 27,"9"; 27,"8" mm 4 mf 2 cw 36 pw 30 rem all widths are in units of 1/360" widths 30 !18 "30 #30 $30 %36 &36 '18 (24 )24 *30 +30 ,18 -30 .18 /30 030 130 230 330 430 530 630 730 830 930 :18 ;18 <30 =30 >30 ?30 @36 A36 B36 C36 D36 E36 F36 G36 H36 I24 J30 K36 L36 M42 N36 O36 P36 Q36 R36 S36 T36 U42 V36 W42 X36 Y36 Z30 [24 \30 ]24 ^30 _30 `18 a30 b36 c30 d36 e30 f24 g36 h36 i18 j24 k36 l18 m42 n36 o30 p36 q36 r30 s30 t24 u36 v36 w42 x30 y36 z30 {24 |18 }24 ~30 36 36 30 30 30 30 30 30 30 30 30 18 18 18 36 36 36 42 42 30 30 30 36 36 36 36 42 30 30 36 42 36 30 18 30 36 36 36 36 36 30 36 36 30 36 36 36 30 30 30 30 36 36 36 36 36 36 36 36 36 36 36 36 36 36 36 36 36 rem Epson 9 pin (with ibm char set) rem Epson LX86,LX800,RX800,EX800/1000,FX800/1000,LX850,FX850/1050 cc '@'=27,"@",27,"t",1 cc 'b'=27,"E",27,"G"; 27,"F",27,"H" cc 'c'=15 ; 18 cc 'e'=27,"M" ; 27,"P" cc 'i'=27,"4" ; 27,"5" cc 'l'=27,"W",1 ; 27,"W",0 cc 'n'=27,"P" cc 'p'=27,"p",1 ; 27,"p",0 cc 'q'=27,"(",0,27,"x",1 ; 27,"x",0 cc 's'=27,"S",1 ; 27,"T" cc 't'=27,"S",0 ; 27,"T" cc 'u'=27,"-",1 ; 27,"-",0 rc ''=27,"6",128 rc ''=27,"6",129 rc ''=27,"6",130 rc ''=27,"6",131 rc ''=27,"6",132 rc ''=27,"6",133 rc ''=27,"6",134 rc ''=27,"6",135 rc ''=27,"6",136 rc ''=27,"6",137 rc ''=27,"6",138 rc ''=27,"6",139 rc ''=27,"6",140 rc ''=27,"6",141 rc ''=27,"6",142 rc ''=27,"6",143 rc ''=27,"6",144 rc ''=27,"6",145 rc ''=27,"6",146 rc ''=27,"6",147 rc ''=27,"6",148 rc ''=27,"6",149 rc ''=27,"6",150 rc ''=27,"6",151 rc ''=27,"6",152 rc ''=27,"6",153 rc ''=27,"6",154 rc ''=27,"R",4,"|",27,"R",0 ;; O slash rc ''=27,"6",156 rc ''=27,"R",4,"\",27,"R",0 ;; O slash rc ''=27,"6",159 rc ''=27,"R",2,"~",27,"R",0 IF PC rc ''=27,"6","" ENDIF IF ST rc 158=27,"R",2,"~",27,"R",0 ENDIF rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 rc ''=27,"K",6,0, 32,64,254,64,32,0 rc ''=27,"K",6,0, 8,4,254,4,8,0 rc ''=27,"L",12,0, 16,16,16,16,16,16,84,56,16,0,0,0 rc ''=27,"L",12,0, 16,56,84,16,16,16,16,16,16,0,0,0 rc ''=27,"L",12,0, 64,0,240,0,254,0,128,126,128,0,0,0 IF ANSI rc ''=218 rc ''=191 rc ''=192 rc ''=217 rc ''=196 rc ''=179 rc ''=194 rc ''=193 rc ''=197 rc ''=195 rc ''=180 rc ''=166 rc ''=167 rc ''=168 rc ''=170 rc ''=171 rc ''=172 rc ''=173 rc ''=174 rc ''=175 rc ''=230 rc ''=241 rc ''=246 rc ''=248 rc ''=250 rc ''=253 ENDIF hl 27,"J",18 pscode 27,"9"; 27,"8" IF VER5 pp on ms off mm 1 mf 4 double L regular bcilpqstu group en ELSE mm 1 mf 2 pw 10 cw 12 ENDIF rem all units assume 1/240" (9 pin dot matrix) IF VER5 rules qp=5,p=4,ce=3,c=1,e=2,n=0 font 0 ; normal pica cw 24 font 1 ; condensed pica cw 14 font 2 ; elite cw 20 font 3 ; condensed elite (may not be possible) cw 12 font 4 ; draft proportional (widths not available, treat as elite) pw 20 cw 20 font 5 ; nlq proportional (widths not available, treat as elite) pw 20 cw 20 ENDIF rem Epson 9 pin (with 8 intl char sets, without ibm char set) rem Epson FX80/FX100, Amstrad DMP series, Juki5510 rem Star NL10, Brother 1109,1409. Kaga Taxan KP810/910. rem Seikosha SP1200/1600, MP1350-AI, MP5350-AI, BP5420/5500 rem Fujitsu M3349B, NEC P560/565, Most dot matrix printers cc '@'=27,"@" cc 'b'=27,"E",27,"G"; 27,"F",27,"H" cc 'c'=15 ; 18 cc 'e'=27,"M" ; 27,"P" cc 'i'=27,"4" ; 27,"5" cc 'l'=27,"W",1 ; 27,"W",0 cc 'n'=27,"P" cc 'p'=27,"p",1 ; 27,"p",0 cc 'q'=27,"(",0,27,"x",1 ; 27,"x",0 cc 's'=27,"S",1 ; 27,"T" cc 't'=27,"S",0 ; 27,"T" cc 'u'=27,"-",1 ; 27,"-",0 rc '#'=27,"R",0,"#" rc '$'=27,"R",0,"$" rc '@'=27,"R",0,"@" rc '['=27,"R",0,"[" rc '\'=27,"R",0,"\" rc ']'=27,"R",0,"]" rc '^'=27,"R",0,"^" rc '`'=27,"R",0,"`" rc '{'=27,"R",0,"{" rc '|'=27,"R",0,"|" rc '}'=27,"R",0,"}" rc '~'=27,"R",0,"~" rc ''=27,"R",1,"@" rc ''=27,"R",1,"[" rc ''=27,"R",1,"\" rc ''=27,"R",1,"{" rc ''=27,"R",1,"|" rc ''=27,"R",1,"}" rc ''=27,"R",2,"[" rc ''=27,"R",2,"\" rc ''=27,"R",2,"]" rc ''=27,"R",2,"{" rc ''=27,"R",2,"|" rc ''=27,"R",2,"}" rc ''=27,"R",2,"~" rc ''=27,"R",3,"#" rc ''=27,"R",4,"[" rc ''=27,"R",4,"]" rc ''=27,"R",4,"{" rc ''=27,"R",4,"}" rc ''=27,"R",5,"@" rc ''=27,"R",6,"|" rc ''=27,"R",6,"~" rc ''=27,"R",7,"[" rc ''=27,"R",7,"\" rc ''=27,"R",7,"]" rc ''=27,"R",7,"|" rc ''=27,"L",12,0, 18,40,130,40,130,40,130,112,10,0,0,0 rc ''=27,"L",12,0, 2,112,138,0,138,0,138,112,2,0,0,0 rc ''=27,"L",12,0, 64,0,248,0,9,18,1,20,9,0,0,0 rc ''=27,"L",12,0, 64,0,250,4,10,0,31,0,2,0,0,0 rc ''=27,"K",6,0, 16,40,84,40,68,0 rc ''=27,"K",6,0, 68,40,84,40,16,0 rc ''=27,"L",12,0, 0,20,2,16,2,124,128,16,128,16,0,0 rc ''=">",8,"_" rc ''="<",8,"_" rc ''="+",8,"_" rc ''="C",8,"," rc ''="a",8,27,"R",0,"^" rc ''="e",8,27,"R",0,"^" rc ''="i",8,27,"R",0,"^" rc ''="o",8,27,"R",0,"^" rc ''="u",8,27,"R",0,"^" rc ''="e",8,27,"R",1,"~" rc ''="i",8,27,"R",1,"~" rc ''="y",8,27,"R",1,"~" rc ''="a",8,27,"K",6,0,0,0,64,128,0,0 rc ''="i",8,27,"K",6,0,0,0,64,128,0,0 rc ''="o",8,27,"K",6,0,0,0,64,128,0,0 rc ''="u",8,27,"K",6,0,0,0,64,128,0,0 rc ''=27,"R",1,"]" rc ''=27,"R",4,"\" rc ''=27,"R",4,"|" rc ''=27,"K",6,0, 32,64,254,64,32,0 rc ''=27,"K",6,0, 8,4,254,4,8,0 rc ''=27,"L",12,0, 16,16,16,16,16,16,84,56,16,0,0,0 rc ''=27,"L",12,0, 16,56,84,16,16,16,16,16,16,0,0,0 rc ''=27,"L",12,0, 64,0,240,0,254,0,128,126,128,0,0,0 rc ''=27,"K",6,0, 0,0,15,8,8,8, 8, 27,"J",12, 27,"K",6,0, 0,0,15,0,0,0, 27,"j",12 rc ''=27,"K",6,0, 8,8,15,0,0,0, 8, 27,"J",12, 27,"K",6,0, 0,0,15,0,0,0, 27,"j",12 rc ''=27,"K",6,0, 0,0,248,8,8,8 rc ''=27,"K",6,0, 8,8,248,0,0,0 rc ''=27,"K",6,0, 8,8,8,8,8,8 rc ''=27,"K",6,0, 0,0,255,0,0,0, 8, 27,"J",12, 27,"K",6,0, 0,0,15,0,0,0, 27,"j",12 rc ''=27,"K",6,0, 8,8,15,8,8,8, 8, 27,"J",12, 27,"K",6,0, 0,0,15,0,0,0, 27,"j",12 rc ''=27,"K",6,0, 8,8,248,8,8,8 rc ''=27,"K",6,0, 8,8,255,8,8,8, 8, 27,"J",12, 27,"K",6,0, 0,0,15,0,0,0, 27,"j",12 rc ''=27,"K",6,0, 0,0,255,8,8,8, 8, 27,"J",12, 27,"K",6,0, 0,0,15,0,0,0, 27,"j",12 rc ''=27,"K",6,0, 8,8,255,0,0,0, 8, 27,"J",12, 27,"K",6,0, 0,0,15,0,0,0, 27,"j",12 IF PC rc ''=27,"R",7,"#" ENDIF IF ST rc 158=27,"R",2,"~" ENDIF hl 27,"J",18 pscode 27,"9"; 27,"8" IF VER5 pp on ms off mm 1 mf 4 double L regular bcilpqstu group en ELSE mm 1 mf 2 pw 10 cw 12 ENDIF rem Epson GQ3500 Laser Printer with Resident Fonts. rem Portrait fonts only rem rem 'e', 'n' and 'p' are exclusive. Setting one toggles the other off. rem 'e' uses EDP, 'n' uses Courier and 'p' uses Modern proportional. rem 'i' is ignored unless an italic font is available. rem 's' and 't' use EDP char set unless a 15 pitch char set is available. rem 'l' sets double width rem 'z' sets 'shaded' background. Top left and bottom right are rem marked with 'z' codes, in similar fashion to 'BOX' mode. rem Character widths are set for 'p', using Modern Proportional Font cc '@'=27,"@",27,"R",0,27,"t",1,27,"v",0,1,27,"v",7,1,12,0,17,0,0,0,0,0,0,0,+ 0,0,4,0,6,0,7,0,7,128,63,192,63,224,63,240,63,224,63,192,7,128,7,0,6,0,4,0,+ 27,"v",0,2,27,"v",7,2,12,0,17,0,0,0,0,0,0,0,0,0,0,128,1,128,3,128,7,128,15,+ 240,31,240,63,240,31,240,15,240,7,128,3,128,1,128,0,128,27,"v",0,3,27,"v",7,+ 3,12,0,17,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,15,0,15,0,15,0,15,0,255,240,127,224,+ 63,192,31,128,15,0,6,0,27,"v",0,4,27,"v",7,4,12,0,17,0,0,0,0,0,0,0,0,0,0,0,0,+ 0,6,0,15,0,31,128,63,192,127,224,255,240,15,0,15,0,15,0,15,0,0,0 cc 'b'=27,"E" ; 27,"F" cc 'd'=27,"G" ; 27,"H" cc 'e'=27,"p",0,27,"y",0,2 cc 'i'=27,"4" ; 27,"5" cc 'l'=27,"W",1 ; 27,"W",0 cc 'n'=27,"p",0,27,"y",0,0 cc 'p'=27,"y",0,4,27,"p",1 cc 'q'=27,25,2 ; 27,25,1 cc 's'=27,"S",1 ; 27,"T" cc 't'=27,"S",0 ; 27,"T" cc 'u'=27,"-",1 ; 27,"-",0 cc "z" 27,"~",3,1 ; 27,"~",0,1 hl 27,"J",25 mm 4 pw 25 cw 30 mf 1 ff on rem character translations using IBM char set rc ''=128 rc ''=129 rc ''=130 rc ''=131 rc ''=132 rc ''=133 rc ''=134 rc ''=135 rc ''=136 rc ''=137 rc ''=138 rc ''=139 rc ''=140 rc ''=141 rc ''=142 rc ''=143 rc ''=144 rc ''=145 rc ''=146 rc ''=147 rc ''=148 rc ''=149 rc ''=150 rc ''=151 rc ''=152 rc ''=153 rc ''=154 rc ''=27,"R",4,124,27,"R",0 rc ''=156 rc ''=27,"R",4,92,27,"R",0 rc ''=159 IF PC rc ''=158 ENDIF IF ST rc 158=225 ENDIF rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 rc ''=27,"t",1,175 IF ANSI rc ''=218 rc ''=191 rc ''=192 rc ''=217 rc ''=196 rc ''=179 rc ''=194 rc ''=193 rc ''=197 rc ''=195 rc ''=180 rc ''=166 rc ''=167 rc ''=168 rc ''=170 rc ''=171 rc ''=172 rc ''=173 rc ''=174 rc ''=230 rc ''=241 rc ''=246 rc ''=248 rc ''=250 rc ''=253 ENDIF rc ''=27,"v",12,3,2,2," " rc ''=27,"v",12,4,2,2," " rc ''=27,"v",12,1,2,2," " rc ''=27,"v",12,2,2,2," " rc ''=21 rc ''=27,"v",0,5,27,"v",7,5,12,0,18,0,0,0,0,0,0,0,0,0,15,224,30,224,62,192,54,+ 192,62,192,30,192,14,192,6,192,6,192,6,192,6,192,6,192,6,192,6,192,+ 27,"v",12,5,2,2," " rem widths for Modern proportional font widths 24 !16 "22 #26 $26 %26 &26 '14 (17 )17 *24 +24 ,14 -24 .14 /18 024 124 224 324 424 524 624 724 824 924 :16 ;16 <21 =24 >21 ?22 @30 A32 B29 C32 D32 E29 F29 G32 H33 I19 J27 K32 L30 M35 N31 O34 P29 Q34 R32 S28 T29 U32 V31 W35 X34 Y32 Z28 [23 \16 ]23 ^24 _26 `20 a27 b29 c25 d29 e26 f22 g27 h30 i19 j18 k30 l19 m35 n29 o28 p29 q29 r24 s25 t22 u30 v29 w35 x29 y27 z22 {24 |16 }24 ~24 32 30 26 27 27 27 27 25 26 26 26 21 21 19 32 32 29 34 35 28 28 28 30 30 27 34 32 25 27 29 35 23 27 19 28 30 29 31 27 28 22 29 29 24 24 16 32 32 28 26 28 27 29 28 29 23 31 25 30 26 31 28 27 29 24 25 24 24 24 25 rem IBM Proprinter X24. 24 pin. cc '@'=27,"F",27,"H",27,"W",0,27,"-",0 cc 'b'=27,"E",27,"G"; 27,"F",27,"H" cc 'l'=27,"W",1 ; 27,"W",0 cc 's'=27,"S",1 ; 27,"T" cc 't'=27,"S",0 ; 27,"T" cc 'u'=27,"-",1 ; 27,"-",0 rc ''=27,"^",2 rc ''=27,"^",3 rc ''=27,"^",4 rc ''=27,"^",5 rc ''=27,"^",6 rc ' '=27,"^",11 rc ''=27,"^",14 rc ''=27,"^",15 rc ''=27,"^",16 rc ''=27,"^",17 rc ''=27,"^",18 rc ''=27,"^",19 rc ''=27,"^",20 rc ''=27,"^",21 rc ''=27,"^",22 rc ''=27,"^",23 rc ''=27,"^",24 rc ''=27,"^",25 rc ''=27,"^",26 rc ''=27,"^",27 rc ''=27,"^",28 rc ''=27,"^",29 rc ''=27,"^",30 rc ''=27,"^",31 rc ''=27,"6",128 rc ''=27,"6",129 rc ''=27,"6",130 rc ''=27,"6",131 rc ''=27,"6",132 rc ''=27,"6",133 rc ''=27,"6",134 rc ''=27,"6",135 rc ''=27,"6",136 rc ''=27,"6",137 rc ''=27,"6",138 rc ''=27,"6",139 rc ''=27,"6",140 rc ''=27,"6",141 rc ''=27,"6",142 rc ''=27,"6",143 rc ''=27,"6",144 rc ''=27,"6",145 rc ''=27,"6",146 rc ''=27,"6",147 rc ''=27,"6",148 rc ''=27,"6",149 rc ''=27,"6",150 rc ''=27,"6",151 rc ''=27,"6",152 rc ''=27,"6",153 rc ''=27,"6",154 rc ''=27,"6",155 rc ''=27,"6",156 rc ''=27,"6",157 rc ''=27,"6",159 IF PC rc ''=27,"6",158 ENDIF IF ST rc 158=225 ENDIF rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 IF ANSI rc ''=218 rc ''=191 rc ''=192 rc ''=217 rc ''=196 rc ''=179 rc ''=194 rc ''=193 rc ''=197 rc ''=195 rc ''=180 rc ''=166 rc ''=167 rc ''=168 rc ''=170 rc ''=171 rc ''=172 rc ''=173 rc ''=174 rc ''=175 rc ''=230 rc ''=241 rc ''=246 rc ''=248 rc ''=250 rc ''=253 ENDIF hl 27,"J",18 pscode 27,"9"; 27,"8" IF VER5 pp on ms off mm 1 mf 6 double L regular bclpqstu group en omit i ELSE mm 1 mf 2 pw 10 cw 12 cc 'e'=27,":" ; 18 cc 'n'=18 cc 'q'=27,"x",1 ; 27,"x",0 ENDIF rem all widths in 1/360" IF VER5 rules p=6,qc=5,c=4,qe=3,e=2,q=1,n=0 font 0 ; draft pica enter 27,"I",0 cw 36 font 1 ; LQ pica enter 27,"I",2 cw 36 font 2 ; draft elite enter 27,"I",8 cw 30 font 3 ; LQ elite enter 27,"I",10 cw 30 font 4 ; draft condensed pica enter 27,"I",16 cw 21 font 5 ; LQ condensed pica enter 27,"I",18 cw 21 font 6 ; proportional enter 27,"I",3 pw 31 ENDIF widths 30 !30 "30 #30 $30 %30 &36 '18 (30 )30 *30 +30 ,30 -30 .30 /30 030 130 230 330 430 530 630 730 830 930 :30 ;30 <30 =30 >30 ?30 @30 A42 B42 C42 D42 E36 F36 G42 H42 I24 J30 K42 L36 M42 N42 O42 P36 Q42 R42 S36 T42 U42 V42 W42 X42 Y42 Z36 [30 \30 ]30 ^30 _30 `30 a30 b36 c30 d36 e30 f24 g36 h36 i18 j18 k36 l18 m42 n36 o30 p36 q36 r30 s30 t24 u36 v36 w42 x36 y36 z30 {30 |30 }30 ~30 42 36 30 30 30 30 30 30 30 30 30 18 18 18 36 36 36 42 42 30 30 30 36 36 36 36 42 30 30 36 42 30 30 18 30 36 36 36 30 30 30 30 30 30 30 30 42 42 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 36 36 36 42 36 36 30 42 42 42 30 30 42 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 rem IBM Proprinter 9 pin. cc '@'=27,"F",27,"H",27,"W",0,27,"-",0 cc 'b'=27,"E",27,"G"; 27,"F",27,"H" cc 'c'=15 ; 18 cc 'l'=27,"W",1 ; 27,"W",0 cc 'p'=27,"P",1 ; 27,"P",0 cc 's'=27,"S",1 ; 27,"T" cc 't'=27,"S",0 ; 27,"T" cc 'u'=27,"-",1 ; 27,"-",0 rc ''=27,"^",2 rc ''=27,"^",3 rc ''=27,"^",4 rc ''=27,"^",5 rc ''=27,"^",6 rc ' '=27,"^",11 rc ''=27,"^",14 rc ''=27,"^",15 rc ''=27,"^",16 rc ''=27,"^",17 rc ''=27,"^",18 rc ''=27,"^",19 rc ''=27,"^",20 rc ''=27,"^",21 rc ''=27,"^",22 rc ''=27,"^",23 rc ''=27,"^",24 rc ''=27,"^",25 rc ''=27,"^",26 rc ''=27,"^",27 rc ''=27,"^",28 rc ''=27,"^",29 rc ''=27,"^",30 rc ''=27,"^",31 rc ''=27,"6",128 rc ''=27,"6",129 rc ''=27,"6",130 rc ''=27,"6",131 rc ''=27,"6",132 rc ''=27,"6",133 rc ''=27,"6",134 rc ''=27,"6",135 rc ''=27,"6",136 rc ''=27,"6",137 rc ''=27,"6",138 rc ''=27,"6",139 rc ''=27,"6",140 rc ''=27,"6",141 rc ''=27,"6",142 rc ''=27,"6",143 rc ''=27,"6",144 rc ''=27,"6",145 rc ''=27,"6",146 rc ''=27,"6",147 rc ''=27,"6",148 rc ''=27,"6",149 rc ''=27,"6",150 rc ''=27,"6",151 rc ''=27,"6",152 rc ''=27,"6",153 rc ''=27,"6",154 rc ''=27,"6",155 rc ''=27,"6",156 rc ''=27,"6",157 rc ''=27,"6",159 IF PC rc ''=27,"6",158 ENDIF IF ST rc 158=225 ENDIF rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 IF ANSI rc ''=218 rc ''=191 rc ''=192 rc ''=217 rc ''=196 rc ''=179 rc ''=194 rc ''=193 rc ''=197 rc ''=195 rc ''=180 rc ''=166 rc ''=167 rc ''=168 rc ''=170 rc ''=171 rc ''=172 rc ''=173 rc ''=174 rc ''=175 rc ''=230 rc ''=241 rc ''=246 rc ''=248 rc ''=250 rc ''=253 ENDIF hl 27,"J",18 pscode 27,"9"; 27,"8" IF VER5 pp on ms off mm 1 mf 4 double L regular bclpqstu group en omit i ELSE mm 1 mf 4 pw 20 cw 24 cc 'e'=27,":" ; 18 cc 'n'=18 cc 'q'=27,"x",1 ; 27,"x",0 ENDIF rem all widths in 1/240" IF VER5 rules p=4,c=3,e=2,q=1,n=0 font 0 ; draft pica enter 27,"I",0 cw 24 font 1 ; LQ pica enter 27,"I",2 cw 24 font 2 ; draft elite enter 27,"I",1 cw 20 font 3 ; condensed, 17.14 cpi cw 14 font 4 ; proportional (widths not available, treat as elite) enter 27,"I",3 pw 20 cw 20 ENDIF rem Juki6100/6200 Proportional Daisywheel cc '@'=27,13,"P" cc 'b'=27,"W" ; 27,"&" cc 'd'=27,"O" ; 27,"&" cc 's'=27,30,6,27,"U" ; 27,"D",27,30,9 cc 't'=27,30,6,27,"D" ; 27,"U",27,30,9 cc 'u'=27,"E" ; 27,"R" rc 12=13,12 rem Note that redefined characters depend on which daisywheel is being used rc ''=27,"I" rc ''=27,"K" rc ''="}" rc ''="{" IF SWEDISH rc ''=64 rc ''=91 rc ''=92 rc ''=93 rc ''=94 rc ''=96 rc ''=123 rc ''=124 rc ''=125 rc ''=126 ENDIF IF GERMAN rc ''=64 rc ''=91 rc ''=92 rc ''=93 rc ''=123 rc ''=124 rc ''=125 rc ''=126 ENDIF hl 27,"U" ab 0,0,0,27,26,"I" mc 27,"3"," ",27,"4" mm 0 cw 12 pw 10 mf 2 cc 'c'=27,31,9 ; 27,"S" cc 'e'=27,31,11 ; 27,"S" cc 'n'=27,31,13 ; 27,"S" cc 'p'=27,"P" ; 27,"Q" cc 'l'=27,17,10 ; 27,17,64 width ' '=10,6,8,12,10,14,14,6,6,6,10,10,6,8,6,8 width '0'=10,10,10,10,10,10,10,10,10,10 width ':'=6,6,10,10,10,10 width '@'=16 width 'A'=14,12,14,14,12,12,14,14,6,10,14,12,16 width 'N'=14,14,12,14,14,10,12,14,12,16,14,14,12 width '['=10,8,12,10,10 width '`'=8 width 'a'=10,10,10,10,10,8,10,10,6,6,10,6,16 width 'n'=10,10,10,10,8,8,8,10,10,14,10,10,10 width '{'=10,12,10,12 width ''=10 width ''=10 width ''=12 width ''=10 rem Panasonic KXP1124 rem (Does not support italics in IBM char set) cc '@'=27,"@",27,"x",0,27,"t",0 cc 'b'=27,"E",27,"G"; 27,"F",27,"H" cc 'c'=15 ; 18 cc 'e'=27,"M" ; 27,"P" cc 'i'=27,"4" ; 27,"5" cc 'l'=27,"W",1 ; 27,"W",0 cc 'n'=27,"P" cc 'p'=27,"p",1 ; 27,"p",0 cc 'q'=27,"x",1 ; 27,"x",0 cc 's'=27,"S",1 ; 27,"T" cc 't'=27,"S",0 ; 27,"T" cc 'u'=27,"-",1 ; 27,"-",0 cc 'f'=27,"g" ; 27,"P" ;; fifteen pitch cc 'h'=27,"k",1,27,"x",1 ; 27,"k",2 ;; helvetica (san serif) cc 'j'=27,"k",4,27,"x",1 ; 27,"k",2 ;; joined (script) rc '#'=27,"R",0,"#" rc '$'=27,"R",0,"$" rc '@'=27,"R",0,"@" rc '['=27,"R",0,"[" rc '\'=27,"R",0,"\" rc ']'=27,"R",0,"]" rc '^'=27,"R",0,"^" rc '`'=27,"R",0,"`" rc '{'=27,"R",0,"{" rc '|'=27,"R",0,"|" rc '}'=27,"R",0,"}" rc '~'=27,"R",0,"~" rc ''=27,"R",1,"@" rc ''=27,"R",1,"[" rc ''=27,"R",1,"\" rc ''=27,"R",1,"]" rc ''=27,"R",1,"{" rc ''=27,"R",1,"|" rc ''=27,"R",1,"}" rc ''=27,"t",1,225,27,"t",0 rc ''=27,"R",3,"#" rc ''=27,"R",4,"[" rc ''=27,"R",4,"\" ;; O slash rc ''=27,"R",4,"]" rc ''=27,"R",4,"{" rc ''=27,"R",4,"|" ;; o slash rc ''=27,"R",4,"}" rc ''=27,"R",5,"@" rc ''=27,"R",5,"[" rc ''=27,"R",5,"\" rc ''=27,"R",5,"^" rc ''=27,"R",5,"{" rc ''=27,"R",5,"|" rc ''=27,"R",5,"~" rc ''=27,"R",6,"|" rc ''=27,"R",6,"~" rc ''=27,"R",7,"[" rc ''=27,"R",7,"\" rc ''=27,"R",7,"]" rc ''=27,"R",7,"|" rc ''=27,"R",11,"@" rc ''=27,"R",11,"{" rc ''=27,"R",11,"}" rc ''=27,"R",11,"~" rc ''=27,"t",1,27,"6",128,27,"t",0 rc ''=27,"t",1,27,"6",131,27,"t",0 rc ''=27,"t",1,27,"6",136,27,"t",0 rc ''=27,"t",1,27,"6",137,27,"t",0 rc ''=27,"t",1,27,"6",139,27,"t",0 rc ''=27,"t",1,27,"6",140,27,"t",0 rc ''=27,"t",1,27,"6",147,27,"t",0 rc ''=27,"t",1,27,"6",150,27,"t",0 rc ''=27,"t",1,27,"6",152,27,"t",0 rc ''=27,"t",1,27,"6",159,27,"t",0 rc ''=27,"t",1,166,27,"t",0 rc ''=27,"t",1,167,27,"t",0 rc ''=27,"t",1,169,27,"t",0 rc ''=27,"t",1,170,27,"t",0 rc ''=27,"t",1,171,27,"t",0 rc ''=27,"t",1,172,27,"t",0 rc ''=27,"t",1,174,27,"t",0 rc ''=27,"t",1,175,27,"t",0 rc ''=27,"t",1,176,27,"t",0 rc ''=27,"t",1,177,27,"t",0 rc ''=27,"t",1,178,27,"t",0 rc ''=27,"t",1,179,27,"t",0 rc ''=27,"t",1,180,27,"t",0 rc ''=27,"t",1,181,27,"t",0 rc ''=27,"t",1,182,27,"t",0 rc ''=27,"t",1,183,27,"t",0 rc ''=27,"t",1,184,27,"t",0 rc ''=27,"t",1,185,27,"t",0 rc ''=27,"t",1,186,27,"t",0 rc ''=27,"t",1,187,27,"t",0 rc ''=27,"t",1,188,27,"t",0 rc ''=27,"t",1,189,27,"t",0 rc ''=27,"t",1,190,27,"t",0 rc ''=27,"t",1,191,27,"t",0 rc ''=27,"t",1,192,27,"t",0 rc ''=27,"t",1,193,27,"t",0 rc ''=27,"t",1,194,27,"t",0 rc ''=27,"t",1,195,27,"t",0 rc ''=27,"t",1,196,27,"t",0 rc ''=27,"t",1,197,27,"t",0 rc ''=27,"t",1,198,27,"t",0 rc ''=27,"t",1,199,27,"t",0 rc ''=27,"t",1,200,27,"t",0 rc ''=27,"t",1,201,27,"t",0 rc ''=27,"t",1,202,27,"t",0 rc ''=27,"t",1,203,27,"t",0 rc ''=27,"t",1,204,27,"t",0 rc ''=27,"t",1,205,27,"t",0 rc ''=27,"t",1,206,27,"t",0 rc ''=27,"t",1,207,27,"t",0 rc ''=27,"t",1,208,27,"t",0 rc ''=27,"t",1,209,27,"t",0 rc ''=27,"t",1,210,27,"t",0 rc ''=27,"t",1,211,27,"t",0 rc ''=27,"t",1,212,27,"t",0 rc ''=27,"t",1,213,27,"t",0 rc ''=27,"t",1,214,27,"t",0 rc ''=27,"t",1,215,27,"t",0 rc ''=27,"t",1,216,27,"t",0 rc ''=27,"t",1,217,27,"t",0 rc ''=27,"t",1,218,27,"t",0 rc ''=27,"t",1,219,27,"t",0 rc ''=27,"t",1,220,27,"t",0 rc ''=27,"t",1,221,27,"t",0 rc ''=27,"t",1,222,27,"t",0 rc ''=27,"t",1,223,27,"t",0 rc ''=27,"t",1,224,27,"t",0 rc ''=27,"t",1,226,27,"t",0 rc ''=27,"t",1,227,27,"t",0 rc ''=27,"t",1,228,27,"t",0 rc ''=27,"t",1,229,27,"t",0 rc ''=27,"t",1,230,27,"t",0 rc ''=27,"t",1,231,27,"t",0 rc ''=27,"t",1,232,27,"t",0 rc ''=27,"t",1,233,27,"t",0 rc ''=27,"t",1,234,27,"t",0 rc ''=27,"t",1,235,27,"t",0 rc ''=27,"t",1,236,27,"t",0 rc ''=27,"t",1,237,27,"t",0 rc ''=27,"t",1,238,27,"t",0 rc ''=27,"t",1,239,27,"t",0 rc ''=27,"t",1,240,27,"t",0 rc ''=27,"t",1,241,27,"t",0 rc ''=27,"t",1,242,27,"t",0 rc ''=27,"t",1,243,27,"t",0 rc ''=27,"t",1,244,27,"t",0 rc ''=27,"t",1,245,27,"t",0 rc ''=27,"t",1,246,27,"t",0 rc ''=27,"t",1,247,27,"t",0 rc ''=27,"t",1,249,27,"t",0 rc ''=27,"t",1,250,27,"t",0 rc ''=27,"t",1,251,27,"t",0 rc ''=27,"t",1,252,27,"t",0 rc ''=27,"t",1,253,27,"t",0 rc ''=27,"t",1,254,27,"t",0 IF PC rc ''=27,"R",7,"#" ENDIF IF ST rc 158=27,"t",1,225,27,"t",0 ENDIF rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,64,0,0,192,0,1,192,0,7,192,0,31,192,0,63,255,192,31,192,0,7,192,0,1,192,0,0,192,0,0,64,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,48,0,0,56,0,0,62,0,0,63,128,63,255,192,0,63,128,0,62,0,0,56,0,0,48,0,0,32,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,7,255,0,3,254,0,1,252,0,0,248,0,0,248,0,0,112,0,0,112,0,0,32,0,0,32,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,32,0,0,112,0,0,112,0,0,248,0,0,248,0,1,252,0,3,254,0,7,255,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,0,0 hl 27,"J",15 pscode 27,"9"; 27,"8" mm 4 mf 2 cw 36 pw 30 widths 30 !18 "30 #30 $30 %36 &36 '18 (24 )24 *30 +30 ,18 -30 .18 /30 030 130 230 330 430 530 630 730 830 930 :18 ;18 <30 =30 >30 ?30 @36 A36 B36 C36 D36 E36 F36 G36 H36 I24 J30 K36 L36 M42 N36 O36 P36 Q36 R36 S36 T36 U42 V36 W42 X36 Y36 Z30 [24 \30 ]24 ^30 _30 `18 a30 b36 c30 d36 e30 f24 g36 h36 i18 j24 k36 l18 m42 n36 o30 p36 q36 r30 s30 t24 u36 v36 w42 x30 y36 z30 {24 |18 }24 ~30 36 36 30 30 30 30 30 30 30 30 30 18 18 18 36 36 36 42 42 30 30 30 36 36 36 36 42 30 30 36 42 36 30 18 30 36 36 36 36 36 30 36 36 30 36 36 36 30 30 30 30 36 36 36 36 36 36 36 36 36 36 36 36 36 36 36 36 36 rem Kyocera F1010, F2010 rem widths for font 2 rem assumes HP LaserJet emulation mm 2 mf 1 pw 18 ff on pp on hl 27,"=" ss "!R!CASS0;EXIT;" cp "!R!CASS1;EXIT;" cc 'b'="!R!SCF;FONT4;EXIT;" ; "!R!RPF;EXIT;" cc 'c'="!R!SCF;FONT5;EXIT;" ; "!R!RPF;EXIT;" cc 'e'="!R!SCF;FONT6;EXIT;" ; "!R!RPF;EXIT;" cc 'i'="!R!SCF;FONT3;EXIT;" ; "!R!RPF;EXIT;" cc 'u'=27,"&dD" ; 27,"&d@" cc 'h'="!R!SCF;FONT11;EXIT;" ; "!R!RPF;EXIT;" cc 'l'="!R!SCF;FONT10;EXIT;" ; "!R!RPF;EXIT;" cc 'n'="!R!SCF;FONT1;EXIT;" ; "!R!RPF;EXIT;" cc 'p'="!R!SCF;FONT2;EXIT;" ; "!R!RPF;EXIT;" cc '@'="!R!RES;FTMD13;FONT2;UNITD;",+ "DELMU;MCROU;UNITD;MRP12,0;SCP;DRP0,-30;SCP;DRP-10,15;RPP;DRP10,15;RPP;MRP12,0;ENDM;",+ "DELMD;MCROD;UNITD;MRP12,0;SCP;DRP0,-30;RPP;SCP;DRP-10,-15;RPP;SCP;DRP10,-15;RPP;MRP12,0;ENDM;",+ "DELML;" ; "MCROL;UNITD;MRP2,-12;SCP;DRP15,10;RPP;SCP;DRP15,-10;RPP;DRP30,0;MRP2,12;ENDM;",+ "DELMR;MCROR;UNITD;MRP2,-12;DRP30,0;SCP;DRP-15,10;RPP;SCP;DRP-15,-10;RPP;MRP2,12;ENDM;",+ "DELF99;LDFC99,39,12,8,896,0,320,114,0;Op0Op0Op0O`0O`0O`0O@0O@0N@0N@0L@0L@0;EXIT;" rem rc '''="!R!SCF;FONT99;TEXT",34,"'",34,",E;RPF;EXIT;" IF PC rc ''="!R!SCF;EXIT;",27,"(1U","|",27,"(1E","!R!RPF;EXIT;" rc 24="!R!CALLU;EXIT;" rc 25="!R!CALLD;EXIT;" rc 26="!R!CALLR;EXIT;" rc 27="!R!CALLL;EXIT;" ENDIF IF ST rc ''="!R!CALLU;EXIT;" rc ''="!R!CALLD;EXIT;" rc ''="!R!CALLR;EXIT;" rc ''="!R!CALLL;EXIT;" ENDIF rc ''=180 rc ''=207 rc ''=197 rc ''=192 rc ''=204 rc ''=200 rc ''=212 rc ''=181 rc ''=193 rc ''=205 rc ''=201 rc ''=221 rc ''=209 rc ''=217 rc ''=216 rc ''=208 rc ''=220 rc ''=215 rc ''=211 rc ''=194 rc ''=206 rc ''=202 rc ''=195 rc ''=203 rc ''=239 rc ''=218 rc ''=219 rc ''=191 rc ''=187 rc ''=188 rc ''=190 rc ''=196 rc ''=213 rc ''=198 rc ''=199 rc ''=183 rc ''=182 rc ''=249 rc ''=250 rc ''=185 rc ''=248 rc ''=247 rc ''=184 rc ''=251 rc ''=253 rc ''=222 rc ''=254 rc ''=179 IF PC rc ''=189 ENDIF IF ST rc 158=222 rc 176=226 rc 177=234 rc 178=210 rc 179=214 rc 182=161 rc 183=225 rc 184=233 rc 185=171 rc 186=168 rc 192=239 rc 193=238 rc 221=189 ENDIF IF PC width ''=30 width ''=21 width 24=24 width 25=24 width 26=34 width 27=34 ENDIF IF ST width 1=24 width 2=24 width 3=34 width 4=34 width 221=21 ENDIF rc ''=27,"&f0S",27,"*p+0x-16Y",27,"*c30a4b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+13x-39Y",27,"*c4a50b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+13x-16Y",27,"*c17a4b0P",27,"*c4a27b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+0x-16Y",27,"*c17a4b0P",27,"*p+13x+0Y",27,"*c4a27b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+13x-16Y",27,"*c17a4b0P",27,"*p+0x-23Y",27,"*c4a27b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+0x-16Y",27,"*c17a4b0P",27,"*p+13x-23Y",27,"*c4a27b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+0x-16Y",27,"*c30a4b0P",27,"*p+13x+0Y",27,"*c4a27b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+0x-16Y",27,"*c30a4b0P",27,"*p+13x-23Y",27,"*c4a27b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+0x-16Y",27,"*c30a4b0P",27,"*p+13x-23Y",27,"*c4a50b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+13x-16Y",27,"*c17a4b0P",27,"*p+0x-23Y",27,"*c4a50b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+0x-16Y",27,"*c17a4b0P",27,"*p+13x-23Y",27,"*c4a50b0P",27,"&f1S"," " widths 40 40 40 40 21 20 21 21 21 22 41 41 11 !13 "13 #32 $20 %39 &34 '13 (16 )16 *21 +41 ,10 -14 .10 /12 020 120 220 320 420 520 620 720 820 920 :11 ;11 <41 =41 >41 ?20 @40 A32 B28 C29 D33 E29 F25 G33 H34 I15 J18 K30 L27 M39 N31 O33 P25 Q33 R31 S22 T27 U34 V31 W40 X32 Y31 Z29 [13 \21 ]13 ^41 _21 `21 a20 b22 c19 d23 e20 f13 g20 h22 i11 j11 k21 l11 m33 n22 o22 p23 q23 r16 s16 t13 u22 v18 w28 x18 y18 z18 {21 |21 }21 ~41 29 22 20 20 20 20 20 19 20 20 20 11 11 11 32 32 29 31 43 22 22 22 22 22 18 33 34 20 30 20 20 11 22 22 22 31 14 15 20 31 31 13 21 21 13 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 41 26 25 20 41 27 31 24 27 27 24 27 18 20 31 41 41 15 33 25 22 22 33 23 27 11 27 11 11 rem HP LaserJet, HP Laserjet+ using HP Roman 8 symbol set mm 2 mf 1 cw 30 pw 21 ff on hl 27,"=" cc '@'=27,"E",27,"(8U" cc 'b'=27,"(s3B" ; 27,"(s0B" cc 'i'=27,"(s1S" ; 27,"(s0S" cc 'p'=27,"(s1P" ; 27,"(s0P" cc 'u'=27,"&dD" ; 27,"&d@" rem font selection cc 'r'=27,"(s1p10v0s0b5T" ;; select 10 point TIMES ROMAN cc 'h'=27,"(s1p14.4v0s0b4T" ;; select 14.4 point HELVETICA rem pitch control cc 'c'=27,"(s16.66H" cc 'e'=27,"(s12H" cc 'n'=27,"(s10H" cc 's'=27,"&a+0.5R" ; 27,"&a-0.5R" cc 't'=27,"&a-0.5R" ; 27,"&a+0.5R" rc ''=180 rc ''=207 rc ''=197 rc ''=192 rc ''=204 rc ''=200 rc ''=212 rc ''=181 rc ''=193 rc ''=205 rc ''=201 rc ''=221 rc ''=209 rc ''=217 rc ''=216 rc ''=208 rc ''=220 rc ''=215 rc ''=211 rc ''=194 rc ''=206 rc ''=202 rc ''=195 rc ''=203 rc ''=239 rc ''=218 rc ''=219 rc ''=191 rc ''=187 rc ''=188 rc ''=190 rc ''=196 rc ''=213 rc ''=198 rc ''=199 rc ''=183 rc ''=182 rc ''=249 rc ''=250 rc ''=185 rc ''=248 rc ''=247 rc ''=184 rc ''=251 rc ''=253 rc ''=222 rc ''=254 rc ''=179 IF PC rc ''=189 ENDIF IF ST rc 158=222 rc 176=226 rc 177=234 rc 178=210 rc 179=214 rc 182=161 rc 183=225 rc 184=233 rc 185=171 rc 186=168 rc 192=239 rc 193=238 rc 221=189 ENDIF rc ''=27,"&f0S",27,"*p+0x-16Y",27,"*c30a4b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+13x-39Y",27,"*c4a50b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+13x-16Y",27,"*c17a4b0P",27,"*c4a27b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+0x-16Y",27,"*c17a4b0P",27,"*p+13x+0Y",27,"*c4a27b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+13x-16Y",27,"*c17a4b0P",27,"*p+0x-23Y",27,"*c4a27b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+0x-16Y",27,"*c17a4b0P",27,"*p+13x-23Y",27,"*c4a27b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+0x-16Y",27,"*c30a4b0P",27,"*p+13x+0Y",27,"*c4a27b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+0x-16Y",27,"*c30a4b0P",27,"*p+13x-23Y",27,"*c4a27b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+0x-16Y",27,"*c30a4b0P",27,"*p+13x-23Y",27,"*c4a50b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+13x-16Y",27,"*c17a4b0P",27,"*p+0x-23Y",27,"*c4a50b0P",27,"&f1S"," " rc ''=27,"&f0S",27,"*p+0x-16Y",27,"*c17a4b0P",27,"*p+13x-23Y",27,"*c4a50b0P",27,"&f1S"," " rem the following widths for TIMES ROMAN 10 POINT are in units of 1/300" widths 17 !12 "15 #30 $23 %35 &35 '12 (15 )16 *22 +23 ,14 -23 .12 /21 023 123 223 323 423 523 623 723 823 923 :10 ;12 <24 =25 >24 ?22 @39 A35 B29 C31 D34 E30 F28 G36 H35 I16 J20 K38 L30 M42 N35 O33 P26 Q33 R34 S22 T30 U37 V34 W38 X36 Y33 Z31 [13 \21 ]14 ^24 _35 `12 a21 b25 c21 d25 e21 f19 g23 h25 i14 j17 k25 l13 m37 n25 o23 p25 q24 r18 s17 t15 u25 v24 w34 x24 y24 z20 {16 |8 }17 ~26 31 25 21 21 21 21 21 21 21 21 21 14 14 14 34 34 30 31 40 23 23 23 25 25 24 33 37 24 23 33 41 30 21 14 23 25 25 35 20 20 22 21 21 12 26 26 26 24 16 25 20 30 30 30 30 30 30 30 30 30 30 30 rem Epson LQ800/LQ1000/LQ1500 printer. As SQ2000 but with rem Star NB2410/NB2415/NB15. Citizen HQP40/45. Seikosha SL80-AI, SL130-AI. rem (IBM char set not supported, and intl char sets 0-11) cc '@'=27,"@",27,"x",0 cc 'b'=27,"E",27,"G"; 27,"F",27,"H" cc 'c'=15 ; 18 cc 'e'=27,"M" ; 27,"P" cc 'i'=27,"4" ; 27,"5" cc 'l'=27,"W",1 ; 27,"W",0 cc 'n'=27,"P" cc 'p'=27,"p",1 ; 27,"p",0 cc 'q'=27,"x",1 ; 27,"x",0 cc 's'=27,"S",1 ; 27,"T" cc 't'=27,"S",0 ; 27,"T" cc 'u'=27,"-",1 ; 27,"-",0 rc '#'=27,"R",0,"#" rc '$'=27,"R",0,"$" rc '@'=27,"R",0,"@" rc '['=27,"R",0,"[" rc '\'=27,"R",0,"\" rc ']'=27,"R",0,"]" rc '^'=27,"R",0,"^" rc '`'=27,"R",0,"`" rc '{'=27,"R",0,"{" rc '|'=27,"R",0,"|" rc '}'=27,"R",0,"}" rc '~'=27,"R",0,"~" rc ''=27,"R",1,"@" rc ''=27,"R",1,"[" rc ''=27,"R",1,"\" rc ''=27,"R",1,"]" rc ''=27,"R",1,"{" rc ''=27,"R",1,"|" rc ''=27,"R",1,"}" rc ''=27,"R",2,"~" rc ''=27,"R",3,"#" rc ''=27,"R",4,"[" rc ''=27,"R",4,"\" ;; O slash rc ''=27,"R",4,"]" rc ''=27,"R",4,"{" rc ''=27,"R",4,"|" ;; o slash rc ''=27,"R",4,"}" rc ''=27,"R",5,"@" rc ''=27,"R",5,"[" rc ''=27,"R",5,"\" rc ''=27,"R",5,"^" rc ''=27,"R",5,"{" rc ''=27,"R",5,"|" rc ''=27,"R",5,"~" rc ''=27,"R",6,"|" rc ''=27,"R",6,"~" rc ''=27,"R",7,"[" rc ''=27,"R",7,"\" rc ''=27,"R",7,"]" rc ''=27,"R",7,"|" rc ''=27,"R",11,"@" rc ''=27,"R",11,"{" rc ''=27,"R",11,"}" rc ''=27,"R",11,"~" rc ''=27,"L",12,0, 18,40,130,40,130,40,130,112,10,0,0,0 rc ''=27,"L",12,0, 2,112,138,0,138,0,138,112,2,0,0,0 rc ''=27,"L",12,0, 0,20,2,16,2,124,128,16,128,16,0,0 rc ''=">",8,"_" rc ''="<",8,"_" rc ''="+",8,"_" IF PC rc ''=27,"R",7,"#" ENDIF IF ST rc ''=27,"R",1,"~" rc 158=27,"R",2,"~" ENDIF rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,64,0,0,192,0,1,192,0,7,192,0,31,192,0,63,255,192,31,192,0,7,192,0,1,192,0,0,192,0,0,64,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,48,0,0,56,0,0,62,0,0,63,128,63,255,192,0,63,128,0,62,0,0,56,0,0,48,0,0,32,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,7,255,0,3,254,0,1,252,0,0,248,0,0,248,0,0,112,0,0,112,0,0,32,0,0,32,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,32,0,0,112,0,0,112,0,0,248,0,0,248,0,1,252,0,3,254,0,7,255,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,6,0,96,12,0,127,24,0,127,48,0,0,96,0,0,192,0,1,144,192,3,48,192,6,97,192,12,99,192,24,62,192,16,28,192,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,6,0,96,12,0,127,24,0,127,51,0,0,103,0,0,207,0,1,155,0,3,51,0,6,127,192,12,127,192,24,3,0,16,3,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,4,0,64,6,0,192,3,1,128,1,131,0,0,198,0,4,108,64,6,56,192,3,17,128,1,131,0,0,198,0,0,108,0,0,56,0,0,16,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,16,0,0,56,0,0,108,0,0,198,0,1,131,0,3,17,128,6,56,192,4,108,64,0,198,0,1,131,0,3,1,128,6,0,192,4,0,64,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,127,255,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,127,255,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,255,192,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,255,192,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,255,255,255,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,255,255,255,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,255,255,255,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,255,255,255,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,255,192,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0 rc ''=27,"*",39,18,0, 0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,127,255,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0,0,64,0 hl 27,"J",15 pscode 27,"9"; 27,"8" mm 4 mf 2 cw 36 pw 30 widths 30 !18 "30 #30 $30 %36 &36 '18 (24 )24 *30 +30 ,18 -30 .18 /30 030 130 230 330 430 530 630 730 830 930 :18 ;18 <30 =30 >30 ?30 @36 A36 B36 C36 D36 E36 F36 G36 H36 I24 J30 K36 L36 M42 N36 O36 P36 Q36 R36 S36 T36 U42 V36 W42 X36 Y36 Z30 [24 \30 ]24 ^30 _30 `18 a30 b36 c30 d36 e30 f24 g36 h36 i18 j24 k36 l18 m42 n36 o30 p36 q36 r30 s30 t24 u36 v36 w42 x30 y36 z30 {24 |18 }24 ~30 36 36 30 30 30 30 30 30 30 30 30 18 18 18 36 36 36 42 42 30 30 30 36 36 36 36 42 30 30 36 42 36 30 18 30 36 36 36 36 36 30 36 36 30 36 36 36 30 30 30 30 36 36 36 36 36 36 36 36 36 36 36 36 36 36 36 36 36 rem Epson 24 pin printers (LQ500/550,LQ850/1050,LQ860/1060,LQ2500/2550) rem Also Epson SQ850,SQ2550. Seikosha SL92,SL230-AI. rem Also Citizen Swift 24, Prodot 24, 124D. Brother 1224,1724,1824/1924. rem (uses IBM char set) cc '@'=27,"@",27,"x",0,27,"R",0,27,"t",1 cc 'b'=27,"E",27,"G"; 27,"F",27,"H" cc 'c'=15 ; 18 cc 'e'=27,"M" ; 27,"P" cc 'i'=27,"4" ; 27,"5" cc 'l'=27,"W",1 ; 27,"W",0 cc 'n'=27,"P" cc 'p'=27,"p",1 ; 27,"p",0 cc 'q'=27,"x",1 ; 27,"x",0 cc 's'=27,"S",1 ; 27,"T" cc 't'=27,"S",0 ; 27,"T" cc 'u'=27,"-",1 ; 27,"-",0 cc 'f'=27,"g" ; 27,"P" ;; fifteen pitch cc 'o'=27,"q",1 ; 27,"q",0 ;; outline cc 'h'=27,"k",1 ; 27,"k",0 ;; helvetica (san serif) cc 'j'=27,"k",4 ; 27,"k",0 ;; joined (script) rc ''=27,"6",128 rc ''=27,"6",129 rc ''=27,"6",130 rc ''=27,"6",131 rc ''=27,"6",132 rc ''=27,"6",133 rc ''=27,"6",134 rc ''=27,"6",135 rc ''=27,"6",136 rc ''=27,"6",137 rc ''=27,"6",138 rc ''=27,"6",139 rc ''=27,"6",140 rc ''=27,"6",141 rc ''=27,"6",142 rc ''=27,"6",143 rc ''=27,"6",144 rc ''=27,"6",145 rc ''=27,"6",146 rc ''=27,"6",147 rc ''=27,"6",148 rc ''=27,"6",149 rc ''=27,"6",150 rc ''=27,"6",151 rc ''=27,"6",152 rc ''=27,"6",153 rc ''=27,"6",154 rc ''=27,"R",4,"|",27,"R",0 ;; O slash rc ''=27,"6",156 rc ''=27,"R",4,"\",27,"R",0 ;; O slash rc ''=27,"6",159 rc ''=27,"R",2,"~",27,"R",0 IF PC rc ''=27,"6","" ENDIF IF ST rc 158=27,"R",2,"~",27,"R",0 ENDIF rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,64,0,0,192,0,1,192,0,7,192,0,31,192,0,63,255,192,31,192,0,7,192,0,1,192,0,0,192,0,0,64,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,48,0,0,56,0,0,62,0,0,63,128,63,255,192,0,63,128,0,62,0,0,56,0,0,48,0,0,32,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,7,255,0,3,254,0,1,252,0,0,248,0,0,248,0,0,112,0,0,112,0,0,32,0,0,32,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,32,0,0,112,0,0,112,0,0,248,0,0,248,0,1,252,0,3,254,0,7,255,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,0,0 rc ''=27,"t",1,175 IF ANSI rc ''=218 rc ''=191 rc ''=192 rc ''=217 rc ''=196 rc ''=179 rc ''=194 rc ''=193 rc ''=197 rc ''=195 rc ''=180 rc ''=166 rc ''=167 rc ''=168 rc ''=170 rc ''=171 rc ''=172 rc ''=173 rc ''=174 rc ''=230 rc ''=241 rc ''=246 rc ''=248 rc ''=250 ENDIF hl 27,"J",15 pscode 27,"9"; 27,"8" IF VER5 mm 4 mf 2 pp on ms on double L regular bcilpqstuohj group enf menu "Fifteen pitch:^XF" F "Outline:^XO" O "Helve (san-serif):^XH" H "Joined (script):^XJ" J menuend ELSE mm 4 mf 2 cw 36 pw 30 ENDIF rem all widths are in units of 1/360" widths 30 !18 "30 #30 $30 %36 &36 '18 (24 )24 *30 +30 ,18 -30 .18 /30 030 130 230 330 430 530 630 730 830 930 :18 ;18 <30 =30 >30 ?30 @36 A36 B36 C36 D36 E36 F36 G36 H36 I24 J30 K36 L36 M42 N36 O36 P36 Q36 R36 S36 T36 U42 V36 W42 X36 Y36 Z30 [24 \30 ]24 ^30 _30 `18 a30 b36 c30 d36 e30 f24 g36 h36 i18 j24 k36 l18 m42 n36 o30 p36 q36 r30 s30 t24 u36 v36 w42 x30 y36 z30 {24 |18 }24 ~30 36 36 30 30 30 30 30 30 30 30 30 18 18 18 36 36 36 42 42 30 30 30 36 36 36 36 42 30 30 36 42 30 30 18 30 36 36 36 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 36 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 36 36 36 36 36 36 rem Amstrad LQ3500 rem not all of the characters can be italicised cc '@'=27,"@" cc 'b'=27,"E",27,"G"; 27,"F",27,"H" cc 'b'=27,"E" ; 27,"F" cc 'c'=15 ; 18 cc 'e'=27,"M" ; 27,"P" cc 'i'=27,"4" ; 27,"5" cc 'l'=27,"W",1 ; 27,"W",0 cc 'n'=27,"P" cc 'p'=27,"p",1 ; 27,"p",0 cc 'q'=27,"x",1 ; 27,"x",0 cc 's'=27,"S",1 ; 27,"T" cc 't'=27,"S",0 ; 27,"T" cc 'u'=27,"-",1 ; 27,"-",0 rem note ESC "R" only works if in EPSON ie ESC "t" 0 rc ''=27,"R",1,"]" rc '#'=27,"R",0,"#" rc '$'=27,"R",0,"$" rc '@'=27,"R",0,"@" rc '['=27,"R",0,"[" rc '\'=27,"R",0,"\" rc ']'=27,"R",0,"]" rc '^'=27,"R",0,"^" rc '`'=27,"R",0,"`" rc '{'=27,"R",0,"{" rc '|'=27,"R",0,"|" rc '}'=27,"R",0,"}" rc '~'=27,"R",0,"~" rc ''=27,"5",27,"t",1,27,"6",128,27,"t",0 rc ''=27,"R",2,"}" rc ''=27,"R",1,"{" rc ''=27,"5",27,"t",1,27,"6",131,27,"t",0 rc ''=27,"R",2,"{" rc ''=27,"R",1,"@" rc ''=27,"R",4,"}" rc ''=27,"R",1,"\" rc ''=27,"5",27,"t",1,27,"6",136,27,"t",0 rc ''=27,"5",27,"t",1,27,"6",137,27,"t",0 rc ''=27,"R",1,"}" rc ''=27,"5",27,"t",1,27,"6",139,27,"t",0 rc ''=27,"5",27,"t",1,27,"6",140,27,"t",0 rc ''=27,"R",6,"~" rc ''=27,"R",2,"[" rc ''=27,"R",4,"]" rc ''=27,"R",5,"@" rc ''=27,"R",4,"{" rc ''=27,"R",4,"[" rc ''=27,"5",27,"t",1,27,"6",147,27,"t",0 rc ''=27,"R",2,"|" rc ''=27,"R",6,"|" rc ''=27,"5",27,"t",1,27,"6",150,27,"t",0 rc ''=27,"R",1,"|" rc ''=27,"5",27,"t",1,27,"6",152,27,"t",0 rc ''=27,"R",2,"\" rc ''=27,"R",2,"]" rc ''=27,"R",4,"|" rc ''=27,"R",3,"#" rc ''=27,"R",4,"\" rc ''=27,"R",7,"#" rc ''=27,"5",27,"t",1,27,"6",159,27,"t",0 rc ''=27,"5",27,"t",1,160,27,"t",0 rc ''=27,"5",27,"t",1,161,27,"t",0 rc ''=27,"5",27,"t",1,162,27,"t",0 rc ''=27,"5",27,"t",1,163,27,"t",0 rc ''=27,"R",7,"|" rc ''=27,"R",7,"\" rc ''=27,"5",27,"t",1,166,27,"t",0 rc ''=27,"5",27,"t",1,167,27,"t",0 rc ''=27,"R",7,"]" rc ''=27,"5",27,"t",1,169,27,"t",0 rc ''=27,"5",27,"t",1,170,27,"t",0 rc ''=27,"5",27,"t",1,171,27,"t",0 rc ''=27,"5",27,"t",1,172,27,"t",0 rc ''=27,"R",7,"[" rc ''=27,"5",27,"t",1,174,27,"t",0 rc ''=27,"5",27,"t",1,175,27,"t",0 rc ''=27,"5",27,"t",1,176,27,"t",0 rc ''=27,"5",27,"t",1,177,27,"t",0 rc ''=27,"5",27,"t",1,178,27,"t",0 rc ''=27,"5",27,"t",1,179,27,"t",0 rc ''=27,"5",27,"t",1,180,27,"t",0 rc ''=27,"5",27,"t",1,181,27,"t",0 rc ''=27,"5",27,"t",1,182,27,"t",0 rc ''=27,"5",27,"t",1,183,27,"t",0 rc ''=27,"5",27,"t",1,184,27,"t",0 rc ''=27,"5",27,"t",1,185,27,"t",0 rc ''=27,"5",27,"t",1,186,27,"t",0 rc ''=27,"5",27,"t",1,187,27,"t",0 rc ''=27,"5",27,"t",1,188,27,"t",0 rc ''=27,"5",27,"t",1,189,27,"t",0 rc ''=27,"5",27,"t",1,190,27,"t",0 rc ''=27,"5",27,"t",1,191,27,"t",0 rc ''=27,"5",27,"t",1,192,27,"t",0 rc ''=27,"5",27,"t",1,193,27,"t",0 rc ''=27,"5",27,"t",1,194,27,"t",0 rc ''=27,"5",27,"t",1,195,27,"t",0 rc ''=27,"5",27,"t",1,196,27,"t",0 rc ''=27,"5",27,"t",1,197,27,"t",0 rc ''=27,"5",27,"t",1,198,27,"t",0 rc ''=27,"5",27,"t",1,199,27,"t",0 rc ''=27,"5",27,"t",1,200,27,"t",0 rc ''=27,"5",27,"t",1,201,27,"t",0 rc ''=27,"5",27,"t",1,202,27,"t",0 rc ''=27,"5",27,"t",1,203,27,"t",0 rc ''=27,"5",27,"t",1,204,27,"t",0 rc ''=27,"5",27,"t",1,205,27,"t",0 rc ''=27,"5",27,"t",1,206,27,"t",0 rc ''=27,"5",27,"t",1,207,27,"t",0 rc ''=27,"5",27,"t",1,208,27,"t",0 rc ''=27,"5",27,"t",1,209,27,"t",0 rc ''=27,"5",27,"t",1,210,27,"t",0 rc ''=27,"5",27,"t",1,211,27,"t",0 rc ''=27,"5",27,"t",1,212,27,"t",0 rc ''=27,"5",27,"t",1,213,27,"t",0 rc ''=27,"5",27,"t",1,214,27,"t",0 rc ''=27,"5",27,"t",1,215,27,"t",0 rc ''=27,"5",27,"t",1,216,27,"t",0 rc ''=27,"5",27,"t",1,217,27,"t",0 rc ''=27,"5",27,"t",1,218,27,"t",0 rc ''=27,"5",27,"t",1,219,27,"t",0 rc ''=27,"5",27,"t",1,220,27,"t",0 rc ''=27,"5",27,"t",1,221,27,"t",0 rc ''=27,"5",27,"t",1,222,27,"t",0 rc ''=27,"5",27,"t",1,223,27,"t",0 rc ''=27,"5",27,"t",1,224,27,"t",0 rc ''=27,"R",2,"~" rc ''=27,"5",27,"t",1,226,27,"t",0 rc ''=27,"5",27,"t",1,227,27,"t",0 rc ''=27,"5",27,"t",1,228,27,"t",0 rc ''=27,"5",27,"t",1,229,27,"t",0 rc ''=27,"5",27,"t",1,230,27,"t",0 rc ''=27,"5",27,"t",1,231,27,"t",0 rc ''=27,"5",27,"t",1,232,27,"t",0 rc ''=27,"5",27,"t",1,233,27,"t",0 rc ''=27,"5",27,"t",1,234,27,"t",0 rc ''=27,"5",27,"t",1,235,27,"t",0 rc ''=27,"5",27,"t",1,236,27,"t",0 rc ''=27,"5",27,"t",1,237,27,"t",0 rc ''=27,"5",27,"t",1,238,27,"t",0 rc ''=27,"5",27,"t",1,239,27,"t",0 rc ''=27,"5",27,"t",1,240,27,"t",0 rc ''=27,"5",27,"t",1,241,27,"t",0 rc ''=27,"5",27,"t",1,242,27,"t",0 rc ''=27,"5",27,"t",1,243,27,"t",0 rc ''=27,"5",27,"t",1,244,27,"t",0 rc ''=27,"5",27,"t",1,245,27,"t",0 rc ''=27,"5",27,"t",1,246,27,"t",0 rc ''=27,"5",27,"t",1,247,27,"t",0 rc ''=27,"R",1,"[" rc ''=27,"5",27,"t",1,249,27,"t",0 rc ''=27,"5",27,"t",1,250,27,"t",0 rc ''=27,"5",27,"t",1,251,27,"t",0 rc ''=27,"5",27,"t",1,252,27,"t",0 rc ''=27,"5",27,"t",1,253,27,"t",0 rc ''=27,"5",27,"t",1,254,27,"t",0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,64,0,0,192,0,1,192,0,7,192,0,31,192,0,63,255,192,31,192,0,7,192,0,1,192,0,0,192,0,0,64,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,48,0,0,56,0,0,62,0,0,63,128,63,255,192,0,63,128,0,62,0,0,56,0,0,48,0,0,32,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,7,255,0,3,254,0,1,252,0,0,248,0,0,248,0,0,112,0,0,112,0,0,32,0,0,32,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,32,0,0,112,0,0,112,0,0,248,0,0,248,0,1,252,0,3,254,0,7,255,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,0,0 IF PC rc ''=27,"R",7,"#" ENDIF IF ST rc 158=27,"R",2,"~" ENDIF ab 0,0,0,24 hl 27,"J",15 pscode 27,"9"; 27,"8" MM 4 MF 2 CW 36 PW 30 widths 30 !18 "30 #30 $30 %36 &36 '18 (24 )24 *30 +30 ,18 -30 .18 /30 030 130 230 330 430 530 630 730 830 930 :18 ;18 <30 =30 >30 ?30 @36 A36 B36 C36 D36 E36 F36 G36 H36 I24 J30 K36 L36 M42 N36 O36 P36 Q36 R36 S36 T36 U42 V36 W42 X36 Y36 Z30 [24 \30 ]24 ^30 _30 `18 a30 b36 c30 d36 e30 f24 g36 h36 i18 j24 k36 l18 m42 n36 o30 p36 q36 r30 s30 t24 u36 v36 w42 x30 y36 z30 {24 |18 }24 ~30 35 36 30 33 30 30 30 30 31 31 30 31 30 18 36 36 36 42 42 33 30 30 34 36 35 36 42 30 30 36 42 32 33 30 33 34 36 36 34 34 30 36 36 35 35 30 33 33 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 36 36 29 36 26 30 35 29 35 29 35 32 35 30 27 29 36 36 36 36 36 36 35 36 24 19 19 36 27 22 25 36 36 36 36 30 rem Epson LX80,JX80,RX80/100,FX80+/100+ rem (without ibm char set, but with 12 intl char sets) cc '@'=27,"@" cc 'b'=27,"E",27,"G"; 27,"F",27,"H" cc 'c'=15 ; 18 cc 'e'=27,"M" ; 27,"P" cc 'i'=27,"4" ; 27,"5" cc 'l'=27,"W",1 ; 27,"W",0 cc 'n'=27,"P" cc 'p'=27,"p",1 ; 27,"p",0 cc 'q'=27,"(",0,27,"x",1 ; 27,"x",0 cc 's'=27,"S",1 ; 27,"T" cc 't'=27,"S",0 ; 27,"T" cc 'u'=27,"-",1 ; 27,"-",0 rc '#'=27,"R",0,"#" rc '$'=27,"R",0,"$" rc '@'=27,"R",0,"@" rc '['=27,"R",0,"[" rc '\'=27,"R",0,"\" rc ']'=27,"R",0,"]" rc '^'=27,"R",0,"^" rc '`'=27,"R",0,"`" rc '{'=27,"R",0,"{" rc '|'=27,"R",0,"|" rc '}'=27,"R",0,"}" rc '~'=27,"R",0,"~" rc ''=27,"R",1,"@" rc ''=27,"R",1,"[" rc ''=27,"R",1,"\" rc ''=27,"R",1,"{" rc ''=27,"R",1,"|" rc ''=27,"R",1,"}" rc ''=27,"R",2,"[" rc ''=27,"R",2,"\" rc ''=27,"R",2,"]" rc ''=27,"R",2,"{" rc ''=27,"R",2,"|" rc ''=27,"R",2,"}" rc ''=27,"R",2,"~" rc ''=27,"R",3,"#" rc ''=27,"R",4,"[" rc ''=27,"R",4,"]" rc ''=27,"R",4,"{" rc ''=27,"R",4,"}" rc ''=27,"R",5,"@" rc ''=27,"R",6,"|" rc ''=27,"R",6,"~" rc ''=27,"R",7,"[" rc ''=27,"R",7,"\" rc ''=27,"R",7,"]" rc ''=27,"R",7,"|" rc ''=27,"R",11,"@" rc ''=27,"R",11,"{" rc ''=27,"R",11,"}" rc ''=27,"R",11,"~" rc ''=27,"L",12,0, 18,40,130,40,130,40,130,112,10,0,0,0 rc ''=27,"L",12,0, 2,112,138,0,138,0,138,112,2,0,0,0 rc ''=27,"L",12,0, 64,0,248,0,9,18,1,20,9,0,0,0 rc ''=27,"L",12,0, 64,0,250,4,10,0,31,0,2,0,0,0 rc ''=27,"K",6,0, 16,40,84,40,68,0 rc ''=27,"K",6,0, 68,40,84,40,16,0 rc ''=27,"L",12,0, 0,20,2,16,2,124,128,16,128,16,0,0 rc ''=">",8,"_" rc ''="<",8,"_" rc ''="+",8,"_" rc ''="C",8,"," rc ''="a",8,27,"R",0,"^" rc ''="e",8,27,"R",0,"^" rc ''="i",8,27,"R",0,"^" rc ''="o",8,27,"R",0,"^" rc ''="u",8,27,"R",0,"^" rc ''="e",8,27,"R",1,"~" rc ''="i",8,27,"R",1,"~" rc ''="y",8,27,"R",1,"~" rc ''=27,"R",1,"]" rc ''=27,"R",4,"\" rc ''=27,"R",4,"|" rc ''=27,"K",6,0, 32,64,254,64,32,0 rc ''=27,"K",6,0, 8,4,254,4,8,0 rc ''=27,"L",12,0, 16,16,16,16,16,16,84,56,16,0,0,0 rc ''=27,"L",12,0, 16,56,84,16,16,16,16,16,16,0,0,0 rc ''=27,"L",12,0, 64,0,240,0,254,0,128,126,128,0,0,0 rc ''=27,"K",6,0, 0,0,15,8,8,8 rc ''=27,"K",6,0, 8,8,15,0,0,0 rc ''=27,"K",6,0, 0,0,248,8,8,8 rc ''=27,"K",6,0, 8,8,248,0,0,0 rc ''=27,"K",6,0, 8,8,8,8,8,8 rc ''=27,"K",6,0, 0,0,255,0,0,0 rc ''=27,"K",6,0, 8,8,15,8,8,8 rc ''=27,"K",6,0, 8,8,248,8,8,8 rc ''=27,"K",6,0, 8,8,255,8,8,8 rc ''=27,"K",6,0, 0,0,255,8,8,8 rc ''=27,"K",6,0, 8,8,255,0,0,0 IF PC rc ''=27,"R",7,"#" ENDIF IF ST rc 158=27,"R",2,"~" ENDIF hl 27,"J",18 pscode 27,"9"; 27,"8" IF VER5 pp on ms off mm 1 mf 4 double L regular bcilpqstu group en ELSE mm 1 mf 2 pw 10 cw 12 ENDIF rem all units assume 1/240" (9 pin dot matrix) IF VER5 rules qp=5,p=4,ce=3,c=1,e=2,n=0 font 0 ; normal pica cw 24 font 1 ; condensed pica cw 14 font 2 ; elite cw 20 font 3 ; condensed elite (may not be possible) cw 12 font 4 ; draft proportional (widths not available, treat as elite) pw 20 cw 20 font 5 ; nlq proportional (widths not available, treat as elite) pw 20 cw 20 ENDIF rem NEC Pinwriter P2200 Series and P5,P6,P7,P9 Series cc '@'=27,"@",27,"R",0,28,"I",1,27,"x",0,27,"T" cc 'b'=27,"E",27,"G"; 27,"F",27,"H" cc 'c'=15 ; 18 cc 'e'=27,"M" ; 27,"P" cc 'h'=28,"V",1 ; 28,"V",0 cc 'i'=27,"4" ; 27,"5" cc 'l'=27,"W",1 ; 27,"W",0 cc 'n'=27,"P" cc 'p'=27,"p",1 ; 27,"p",0 cc 'q'=27,"x",1 ; 27,"x",0 cc 's'=27,"S",1 ; 27,"T" cc 't'=27,"S",0 ; 27,"T" cc 'u'=27,"-",1 ; 27,"-",0 rem the following commands allow correct form length setting to the printer rem x - 11" forms; y - A4 11 2/3" forms; z - 12" forms cc 'x'=27,"C",66 cc 'y'=27,"C",70 cc 'z'=27,"C",72 cc 'f'=27,"g" ;27,"P" ;; fifteen pitch rc ''=27,"6",128 rc ''=27,"6",129 rc ''=27,"6",130 rc ''=27,"6",131 rc ''=27,"6",132 rc ''=27,"6",133 rc ''=27,"6",134 rc ''=27,"6",135 rc ''=27,"6",136 rc ''=27,"6",137 rc ''=27,"6",138 rc ''=27,"6",139 rc ''=27,"6",140 rc ''=27,"6",141 rc ''=27,"6",142 rc ''=27,"6",143 rc ''=27,"6",144 rc ''=27,"6",145 rc ''=27,"6",146 rc ''=27,"6",147 rc ''=27,"6",148 rc ''=27,"6",149 rc ''=27,"6",150 rc ''=27,"6",151 rc ''=27,"6",152 rc ''=27,"6",153 rc ''=27,"6",154 rc ''=27,"R",4,155,27,"R",0 ;; o slash rc ''=27,"6",156 rc ''=27,"R",4,157,27,"R",0 ;; O slash rc ''=27,"6",159 rc ''=27,"R",2,"~",27,"R",0 IF PC rc ''=27,"6","" ENDIF IF ST rc 158=27,"R",2,"~",27,"R",0 ENDIF rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,64,0,0,192,0,1,192,0,7,192,0,31,192,0,63,255,192,31,192,0,7,192,0,1,192,0,0,192,0,0,64,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,48,0,0,56,0,0,62,0,0,63,128,63,255,192,0,63,128,0,62,0,0,56,0,0,48,0,0,32,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,7,255,0,3,254,0,1,252,0,0,248,0,0,248,0,0,112,0,0,112,0,0,32,0,0,32,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,32,0,0,112,0,0,112,0,0,248,0,0,248,0,1,252,0,3,254,0,7,255,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,0,0 rc ''=27,"t",1,175 IF ANSI rc ''=218 rc ''=191 rc ''=192 rc ''=217 rc ''=196 rc ''=179 rc ''=194 rc ''=193 rc ''=197 rc ''=195 rc ''=180 rc ''=166 rc ''=167 rc ''=168 rc ''=170 rc ''=171 rc ''=172 rc ''=173 rc ''=174 rc ''=230 rc ''=241 rc ''=246 rc ''=248 rc ''=250 ENDIF hl 27,"J",15 pscode 27,"9"; 27,"8" mf 3 mm 0 mc 28,90,3,0, 0,0,0, 0,0,0, 0,0,0 cw 36 pw 30 widths 30 !26 "25 #41 $31 %41 &39 '16 (23 )23 *26 +40 ,18 -38 .18 /24 032 132 232 332 432 532 632 732 832 932 :18 ;18 <30 =40 >30 ?26 @39 A40 B33 C34 D36 E35 F34 G36 H36 I20 J29 K36 L32 M40 N37 O38 P32 Q38 R33 S30 T36 U36 V38 W40 X40 Y34 Z30 [19 \24 ]19 ^28 _36 `19 a32 b32 c28 d32 e30 f23 g30 h34 i20 j17 k33 l20 m41 n34 o30 p32 q32 r25 s28 t25 u34 v35 w40 x33 y33 z28 {20 |16 }20 ~26 34 34 30 32 32 32 32 28 30 30 30 18 20 18 40 40 35 40 41 30 30 30 34 34 33 38 36 33 37 30 36 33 32 18 30 34 34 37 25 24 26 36 36 41 41 26 24 24 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 37 30 32 36 28 33 36 30 36 36 38 32 36 32 26 34 38 38 38 38 36 36 40 36 23 22 18 38 31 21 40 30 30 30 30 31 rem HP Paintjet (using PC-8 character set) cc '@'=27,"E",27,"&k0G",27,"(10U",27,"(s1Q" cc 'b'=27,"(s3B" ; 27,"(s0B" cc 'i'=27,"(s1S" ; 27,"(s0S" cc 'q'=27,"(s2Q" ; 27,"(s1Q" cc 's'=27,"&a+0.25R",27,"(s6V" ; 27,"&a-0.25R",27,"(s12V" ;; subscript cc 't'=27,"&a-0.25R",27,"(s6V" ; 27,"&a+0.25R",27,"(s12V" ;; superscript cc 'u'=27,"&d0D" ; 27,"&d@" rem colours - use ctrlcode twice to return to black cc 'r'=27,"&v1S" ; 27,"&v0S" ;; red cc 'g'=27,"&v2S" ; 27,"&v0S" ;; green cc 'm'=27,"&v5S" ; 27,"&v0S" ;; magenta cc 'y'=27,"&v3S" ; 27,"&v0S" ;; yellow cc 'a'=27,"&v6S" ; 27,"&v0S" ;; cyan cc 'd'=27,"&v4S" ; 27,"&v0S" ;; dark blue rem Character redefinitions using PC-8 Symbol set rc ''=27,"&p1X",2 rc ''=27,"&p1X",3 rc ''=27,"&p1X",4 rc ''=27,"&p1X",5 rc ''=27,"&p1X",6 rc ' '=27,"&p1X",11 rc 12=13,12 ;; form feed rc ''=27,"&p1X",14 rc ''=27,"&p1X",15 rc ''=27,"&p1X",16 rc ''=27,"&p1X",17 rc ''=27,"&p1X",18 rc ''=27,"&p1X",19 rc ''=27,"&p1X",20 rc ''=27,"&p1X",21 rc ''=27,"&p1X",22 rc ''=27,"&p1X",23 rc ''=27,"&p1X",24 rc ''=27,"&p1X",25 rc ''=27,"&p1X",26 rc ''=27,"&p1X",27 rc ''=27,"&p1X",28 rc ''=27,"&p1X",29 rc ''=27,"&p1X",30 rc ''=27,"&p1X",31 rem accented chars defined so as not to be split into letter and accent rc ''=128 rc ''=129 rc ''=130 rc ''=131 rc ''=132 rc ''=133 rc ''=134 rc ''=135 rc ''=136 rc ''=137 rc ''=138 rc ''=139 rc ''=140 rc ''=141 rc ''=142 rc ''=143 rc ''=144 rc ''=145 rc ''=146 rc ''=147 rc ''=148 rc ''=149 rc ''=150 rc ''=151 rc ''=152 rc ''=153 rc ''=154 rc ''=27,"(8U",214,27,"(10U" ;; o slash rc ''=156 rc ''=27,"(8U",210,27,"(10U" ;; O slash IF PC rc ''=158 ENDIF IF ST rc 158=27,"(8U",222,27,"(10U" ;; double s ENDIF rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 rc ''=27,"(8U",222,27,"(10U" rc ''=27,"(10U",175 IF ANSI rc ''=218 rc ''=191 rc ''=192 rc ''=217 rc ''=196 rc ''=179 rc ''=194 rc ''=193 rc ''=197 rc ''=195 rc ''=180 rc ''=166 rc ''=167 rc ''=168 rc ''=170 rc ''=171 rc ''=172 rc ''=173 rc ''=174 rc ''=230 rc ''=241 rc ''=246 rc ''=248 rc ''=250 rc ''=253 rc 164=27,"(0N",164,27,"(10U" ;; curr. sym. rc 165=27,"(0N",165,27,"(10U" ;; yen rc 166=27,"(0N",166,27,"(10U" ;; vert rc 169=27,"(0N",169,27,"(10U" ;; copyright rc 174=27,"(0N",174,27,"(10U" ;; registered rc 175=27,"(0N",175,27,"(10U" ;; overline rc 179=27,"(0N",179,27,"(10U" ;; super 3 rc 190=27,"(0N",190,27,"(10U" ;; 3/4 rc 215=27,"(0N",215,27,"(10U" ;; multiply ENDIF IF VER5 acute ; 27,"&f0S",27,"(8U",8,168,27,"(10U",27,"&f1S" grave ; 27,"&f0S",27,"(8U",8,169,27,"(10U",27,"&f1S" circumflex ; 27,"&f0S",27,"(8U",8,170,27,"(10U",27,"&f1S" umlaut ; 27,"&f0S",27,"(8U",8,171,27,"(10U",27,"&f1S" tilde ; 27,"&f0S",27,"(8U",8,172,27,"(10U",27,"&f1S" macron ; 27,"&f0S",27,"(8U",8,176,27,"(10U",27,"&f1S" ascend 27,"*p-5Y" ; 27,"*p+5Y" ENDIF hl 27,"=" IF VER5 mm 5 mf 1 pp on ms on ff on double ;; no auto doubling regular ibuclsturgmyad group en end 27,"E" omit p menu "Red:^XR" R "Green:^XG" G "Cyan:^XA" A "Magenta:^XM" M "Dark blue:^XD" D "Yellow:^XY" Y menuend ELSE mm 5 mf 1 ff on cw 72 cc 'c'=27,"(s20H" ; 27,"(s10H" cc 'e'=27,"(s16.67H" ; 27,"(s10H" cc 'l'=27,"(s5H" ; 27,"(s10H" cc 'p'=27,"(s1P" ; 27,"(s0P" ENDIF rem all widths in units of 1/720" IF VER5 rules c=2,e=1,n=0 font 0 ; Courier 10 cpi enter 27,"(s0p10h3T"27,"&k12H" cw 72 font 1 ; "elite", 12 cpi enter 27,"(s0p12h3T",27,"&k10H" cw 60 font 2 ; "condensed", 18 cpi enter 27,"(s0p18h12v3T"27,"&k6.6667H" cw 40 ENDIF rem Quendata DWP1120 Fixed Pitch Daisywheel cc '@'=27,"R",27,"&" cc 'b'=27,"W" ; 27,"&" cc 'd'=27,"Q" ; 27,"&" cc 's'=27,30,6,27,"U" ; 27,"D",27,30,9 cc 't'=27,30,6,27,"D" ; 27,"U",27,30,9 cc 'u'=27,"_" ; 27,"R" rc 12=13,12 rc ''="#" IF SWEDISH rc ''=64 rc ''=91 rc ''=92 rc ''=93 rc ''=94 rc ''=96 rc ''=123 rc ''=124 rc ''=125 rc ''=126 ENDIF IF GERMAN rc ''=64 rc ''=91 rc ''=92 rc ''=93 rc ''=123 rc ''=124 rc ''=125 rc ''=126 ENDIF hl 27,"U" ab 0,0,0,27,26,"I" mc 27,31,2," ",27,31,13 mm 0 mf 1 cw 12 cc 'c'=27,31,9 ; 27,31,13 cc 'e'=27,31,11 ; 27,31,13 cc 'n'=27,31,13 rem Qume Sprint 11 Plus cc '@'=27,26,"I" cc 'b'=27,"Q" ; 27,"R" cc 'd'=27,"K",1 ; 27,"M" cc 's'=27,30,6,27,"U" ; 27,"D",27,30,9 cc 't'=27,30,6,27,"D" ; 27,"U",27,30,9 cc 'u'=27,"I" ; 27,"J" rc ''="#" IF SWEDISH rc ''=64 rc ''=91 rc ''=92 rc ''=93 rc ''=94 rc ''=96 rc ''=123 rc ''=124 rc ''=125 rc ''=126 ENDIF IF GERMAN rc ''=64 rc ''=91 rc ''=92 rc ''=93 rc ''=123 rc ''=124 rc ''=125 rc ''=126 ENDIF hl 27,"U" ab 0,0,0,27,13,"P" mm 0 mc 27,"H",64,64,65 mf 1 cw 12 pw 10 cc 'c'=27,31,9 ; 27,31,13 cc 'e'=27,31,11 ; 27,31,13 cc 'l'=27,17,10 ; 27,17,64 cc 'n'=27,31,13 cc 'p'=27,"$" ; 27,"%" width ' '=10,6,8,12,10,14,14,6,6,6,10,10,6,8,6,8 width '0'=10,10,10,10,10,10,10,10,10,10 width ':'=6,6,10,10,10,10 width '@'=16,14,12,14,14,12,12,14,14,6,10,14,12,16 width 'N'=14,14,12,14,14,10,12,14,12,16,14,14,12 width '['=10,8,12,10,10 width '`'=8 width 'a'=10,10,10,10,10,8,10,10,6,6,10,6,16 width 'n'=10,10,10,10,8,8,8,10,10,14,10,10,10 width '{'=10,12,10,12 width ''=10 width ''=10 width ''=12 width ''=10 This is a dummy printer driver file called 'SIMPLE'. It's sole purpose is to allow the simple printer driver to be selected from the file selector. This text is completely ignored, so there is no point in changing it. rem Simple backspacing printer with U.K./Swedish character set rem Silver Reed EX32 mf 1 simple on rc ''="#" IF SWEDISH rc ''=64 rc ''=91 rc ''=92 rc ''=93 rc ''=94 rc ''=96 rc ''=123 rc ''=124 rc ''=125 rc ''=126 ENDIF IF GERMAN rc ''=64 rc ''=91 rc ''=92 rc ''=93 rc ''=123 rc ''=124 rc ''=125 rc ''=126 ENDIF rem Atari SLM804 Laser Printer in Diablo 630 emulation cc '@'=27,13,"P" cc 'b'=27,"O" ; 27,"&" ;; bold cc 'c'=27,31,9 ; 27,"S" ;; condensed cc 'e'=27,31,11 ; 27,"S" ;; elite cc 'i'=27,"W" ; 27,"&" ;; italics cc 'l'=27,17,10 ; 27,17,64 cc 'n'=27,31,13 ; 27,"S" cc 'p'=27,"P" ; 27,"Q" cc 's'=27,30,6,27,"U" ; 27,"D",27,30,9 cc 't'=27,30,6,27,"D" ; 27,"U",27,30,9 cc 'u'=27,"E" ; 27,"R" ;; underline cc 'v'=27,14,4 ; 27,14,1 slot 4 - light cc 'w'=27,14,5 ; 27,14,1 5 empty cc 'x'=27,14,6 ; 27,14,1 6 '' cc 'y'=27,14,7 ; 27,14,1 7 '' cc 'z'=27,14,8 ; 27,14,1 8 '' rc ''=128 rc ''=129 rc ''=130 rc ''=131 rc ''=132 rc ''=133 rc ''=134 rc ''=135 rc ''=136 rc ''=137 rc ''=138 rc ''=139 rc ''=140 rc ''=141 rc ''=142 rc ''=143 rc ''=144 rc ''=145 rc ''=146 rc ''=147 rc ''=148 rc ''=149 rc ''=150 rc ''=151 rc ''=152 rc ''=153 rc ''=154 rc ''=179 rc ''=156 rc ''=178 rc ''=159 rc 158=158 rc 225=158 rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 cw 12 hl 27,"U" rem mc (27,"Q",)27,31,2," ",27,"S"(,27,"P") mf 1 mm 3 pw 10 rem Atari SLM804 laser printer with Epson emulator cc '@'=27,"@",27,2,1 cc 'b'=27,"E" ; 27,"F" cc 'c'=15 ; 18 cc 'd'=27,"G" ; 27,"H" cc 'e'=27,"M" ; 27,"P" cc 'i'=27,"I",1 ; 27,"I",0 cc 'l'=27,"W",1 ; 27,"W",0 cc 'n'=27,"P" cc 'p'=27,"p",1 ; 27,"p",0 cc 'q'=27,"x",1 ; 27,"x",0 cc 's'=27,"S",1 ; 27,"T" cc 't'=27,"S",0 ; 27,"T" cc 'u'=27,"-",1 ; 27,"-",0 rc ''=27,"K",6,0, 32,64,254,64,32,0 rc ''=27,"K",6,0, 8,4,254,4,8,0 rc ''=27,"L",12,0, 16,16,16,16,16,16,84,56,16,0,0,0 rc ''=27,"L",12,0, 16,56,84,16,16,16,16,16,16,0,0,0 rc ''=128 rc ''=129 rc ''=130 rc ''=131 rc ''=132 rc ''=133 rc ''=134 rc ''=135 rc ''=136 rc ''=137 rc ''=138 rc ''=139 rc ''=140 rc ''=141 rc ''=142 rc ''=143 rc ''=144 rc ''=145 rc ''=146 rc ''=147 rc ''=148 rc ''=149 rc ''=150 rc ''=151 rc ''=152 rc ''=153 rc ''=154 rc ''=179 rc ''=156 rc ''=178 rc ''=159 rc 158=158 rc 225=158 rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 hl 27,"J",18 pscode 27,"9"; 27,"8" mm 1 pw 10 cw 12 mf 2 rc ''=27,"K",6,0, 0,0,15,8,8,8 rc ''=27,"K",6,0, 8,8,15,0,0,0 rc ''=27,"K",6,0, 0,0,248,8,8,8 rc ''=27,"K",6,0, 8,8,248,0,0,0 rc ''=27,"K",6,0, 8,8,8,8,8,8 rc ''=27,"K",6,0, 0,0,255,0,0,0 rc ''=27,"K",6,0, 8,8,15,8,8,8 rc ''=27,"K",6,0, 8,8,248,8,8,8 rc ''=27,"K",6,0, 8,8,255,8,8,8 rc ''=27,"K",6,0, 0,0,255,8,8,8 rc ''=27,"K",6,0, 8,8,255,0,0,0 rem Star LC10 Colour (Epson mode) cc '@'=27,"@",27,"R",0,27,"t",1 cc 'b'=27,"E",27,"G" ; 27,"F",27,"H" cc 'c'=15 ; 18 cc 'e'=27,"M" ; 27,"P" cc 'i'=27,"4" ; 27,"5" cc 'l'=27,"W",1 ; 27,"W",0 cc 'n'=27,"P" cc 'p'=27,"p",1 ; 27,"p",0 cc 'q'=27,"x",1 ; 27,"x",0 cc 's'=27,"S",1 ; 27,"T" cc 't'=27,"S",0 ; 27,"T" cc 'u'=27,"-",1 ; 27,"-",0 cc 'h'=27,"k",1,27,"x",1 ; 27,"k",0 ;; rem h = helve (san serif) cc 'o'=27,"k",3,27,"x",1 ; 27,"k",0 ;; rem o = orator cc 'a'=27,"k",2,27,"x",1 ; 27,"k",0 ;; rem o = orator (small caps) cc 'w'= 27,"r",0 ;; rem black cc 'x'= 27,"r",5 ;; rem orange cc 'g'= 27,"r",6 ;; rem green cc 'r'= 27,"r",1 ;; rem red cc 'v'= 27,"r",3 ;; rem violet cc 'y'= 27,"r",4 ;; rem yellow cc 'z'= 27,"r",2 ;; rem blue rc ''=27,"6",128 rc ''=27,"6",129 rc ''=27,"6",130 rc ''=27,"6",131 rc ''=27,"6",132 rc ''=27,"6",133 rc ''=27,"6",134 rc ''=27,"6",135 rc ''=27,"6",136 rc ''=27,"6",137 rc ''=27,"6",138 rc ''=27,"6",139 rc ''=27,"6",140 rc ''=27,"6",141 rc ''=27,"6",142 rc ''=27,"6",143 rc ''=27,"6",144 rc ''=27,"6",145 rc ''=27,"6",146 rc ''=27,"6",147 rc ''=27,"6",148 rc ''=27,"6",149 rc ''=27,"6",150 rc ''=27,"6",151 rc ''=27,"6",152 rc ''=27,"6",153 rc ''=27,"6",154 rc ''=27,"R",4,"|",27,"R",0 ;; O slash rc ''=27,"6",156 rc ''=27,"R",4,"\",27,"R",0 ;; O slash rc ''=27,"6",159 rc ''=27,"R",2,"~",27,"R",0 IF PC rc ''=27,"6","" ENDIF IF ST rc 158=27,"R",2,"~",27,"R",0 ENDIF rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 rc ''=27,"K",6,0, 32,64,254,64,32,0 rc ''=27,"K",6,0, 8,4,254,4,8,0 rc ''=27,"L",12,0, 16,16,16,16,16,16,84,56,16,0,0,0 rc ''=27,"L",12,0, 16,56,84,16,16,16,16,16,16,0,0,0 rc ''=27,"L",12,0, 64,0,240,0,254,0,128,126,128,0,0,0 rc ''=27,"t",1,175 IF ANSI rc ''=218 rc ''=191 rc ''=192 rc ''=217 rc ''=196 rc ''=179 rc ''=194 rc ''=193 rc ''=197 rc ''=195 rc ''=180 rc ''=166 rc ''=167 rc ''=168 rc ''=170 rc ''=171 rc ''=172 rc ''=173 rc ''=174 rc ''=230 rc ''=241 rc ''=246 rc ''=248 rc ''=250 rc ''=253 ENDIF hl 27,"J",18 pscode 27,"9"; 27,"8" mm 1 mf 4 pw 20 cw 24 rem all units assume 1/240" (9 pin dot matrix) widths 24 18 24 24 24 24 26 !14 "14 #22 $22 %22 &22 '14 (14 )14 *18 +22 ,14 -22 .14 /18 022 114 222 322 422 522 622 722 822 922 :14 ;14 <18 =22 >18 ?22 @22 A22 B22 C22 D22 E22 F22 G22 H22 I14 J22 K22 L22 M22 N22 O22 P22 Q22 R22 S22 T22 U22 V22 W22 X18 Y22 Z18 [14 \18 ]14 ^22 _26 `14 a22 b20 c22 d20 e22 f22 g20 h20 i14 j16 k18 l14 m22 n20 o22 p20 q20 r18 s22 t22 u22 v22 w22 x18 y22 z18 {16 |14 }16 ~22 22 22 22 22 22 22 22 18 18 22 22 14 18 14 22 22 22 22 22 18 18 18 20 22 20 22 22 22 22 22 22 22 22 14 18 22 20 22 22 22 22 22 22 22 22 14 22 22 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 22 22 22 20 22 20 22 22 22 22 22 22 22 22 20 18 22 22 18 18 26 26 22 22 14 14 14 22 14 16 14 rem Star LC10 (Epson mode) cc '@'=27,"@",27,"R",0,27,"t",1 cc 'b'=27,"E",27,"G" ; 27,"F",27,"H" cc 'c'=15 ; 18 cc 'e'=27,"M" ; 27,"P" cc 'i'=27,"4" ; 27,"5" cc 'l'=27,"W",1 ; 27,"W",0 cc 'n'=27,"P" cc 'p'=27,"p",1 ; 27,"p",0 cc 'q'=27,"x",1 ; 27,"x",0 cc 's'=27,"S",1 ; 27,"T" cc 't'=27,"S",0 ; 27,"T" cc 'u'=27,"-",1 ; 27,"-",0 cc 'h'=27,"k",1,27,"x",1 ; 27,"k",0 ;; rem h = helve (san serif) cc 'o'=27,"k",3,27,"x",1 ; 27,"k",0 ;; rem o = orator cc 'a'=27,"k",2,27,"x",1 ; 27,"k",0 ;; rem a = orator (small caps) rc ''=27,"6",128 rc ''=27,"6",129 rc ''=27,"6",130 rc ''=27,"6",131 rc ''=27,"6",132 rc ''=27,"6",133 rc ''=27,"6",134 rc ''=27,"6",135 rc ''=27,"6",136 rc ''=27,"6",137 rc ''=27,"6",138 rc ''=27,"6",139 rc ''=27,"6",140 rc ''=27,"6",141 rc ''=27,"6",142 rc ''=27,"6",143 rc ''=27,"6",144 rc ''=27,"6",145 rc ''=27,"6",146 rc ''=27,"6",147 rc ''=27,"6",148 rc ''=27,"6",149 rc ''=27,"6",150 rc ''=27,"6",151 rc ''=27,"6",152 rc ''=27,"6",153 rc ''=27,"6",154 rc ''=27,"R",4,"|",27,"R",0 ;; O slash rc ''=27,"6",156 rc ''=27,"R",4,"\",27,"R",0 ;; O slash rc ''=27,"6",159 rc ''=27,"R",2,"~",27,"R",0 IF PC rc ''=27,"6","" ENDIF IF ST rc 158=27,"R",2,"~",27,"R",0 ENDIF rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 rc ''=27,"K",6,0, 32,64,254,64,32,0 rc ''=27,"K",6,0, 8,4,254,4,8,0 rc ''=27,"L",12,0, 16,16,16,16,16,16,84,56,16,0,0,0 rc ''=27,"L",12,0, 16,56,84,16,16,16,16,16,16,0,0,0 rc ''=27,"L",12,0, 64,0,240,0,254,0,128,126,128,0,0,0 rc ''=27,"t",1,175 IF ANSI rc ''=218 rc ''=191 rc ''=192 rc ''=217 rc ''=196 rc ''=179 rc ''=194 rc ''=193 rc ''=197 rc ''=195 rc ''=180 rc ''=166 rc ''=167 rc ''=168 rc ''=170 rc ''=171 rc ''=172 rc ''=173 rc ''=174 rc ''=230 rc ''=241 rc ''=246 rc ''=248 rc ''=250 rc ''=253 ENDIF hl 27,"J",18 pscode 27,"9"; 27,"8" IF VER5 mm 1 mf 4 pp on ms off double L regular bcilpqstuoha group en menu "Helve (san-serif):^XH" H "Orator:^XO" O "Orator (small caps):^XA"A menuend ELSE mm 1 mf 4 pw 20 cw 24 ENDIF rem all units assume 1/240" (9 pin dot matrix) widths 24 18 24 24 24 24 26 !14 "14 #22 $22 %22 &22 '14 (14 )14 *18 +22 ,14 -22 .14 /18 022 114 222 322 422 522 622 722 822 922 :14 ;14 <18 =22 >18 ?22 @22 A22 B22 C22 D22 E22 F22 G22 H22 I14 J22 K22 L22 M22 N22 O22 P22 Q22 R22 S22 T22 U22 V22 W22 X18 Y22 Z18 [14 \18 ]14 ^22 _26 `14 a22 b20 c22 d20 e22 f22 g20 h20 i14 j16 k18 l14 m22 n20 o22 p20 q20 r18 s22 t22 u22 v22 w22 x18 y22 z18 {16 |14 }16 ~22 22 22 22 22 22 22 22 18 18 22 22 14 18 14 22 22 22 22 22 18 18 18 20 22 20 22 22 22 22 22 22 22 22 14 18 22 20 22 22 22 22 22 22 22 22 14 22 22 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 26 22 22 22 20 22 20 22 22 22 22 22 22 22 22 20 18 22 22 18 18 26 26 22 22 14 14 14 22 14 16 14 rem Star LC24-10 printer (in Epson mode) cc '@'=27,"@",27,"R",0,27,"t",1,27,"x",0 cc 'b'=27,"E",27,"G" ; 27,"F",27,"H" ;; bold (and double strike) cc 'c'=15 ; 18 ;; condensed cc 'e'=27,"M" ; 27,"P" ;; elite cc 'i'=27,"4" ; 27,"5" ;; italics cc 'l'=27,"W",1 ; 27,"W",0 ;; enlarged (double width) cc 'n'=27,"P" ;; normal, pica cc 'p'=27,"p",1 ; 27,"p",0 ;; proportional cc 'q'=27,"x",1 ; 27,"x",0 ;; nlq cc 's'=27,"S",1 ; 27,"T" ;; subscript cc 't'=27,"S",0 ; 27,"T" ;; superscript cc 'u'=27,"-",1 ; 27,"-",0 ;; underline cc 'f'=27,"g" ; 27,"P" ;; fifteen pitch cc 'o'=27,"q",1 ; 27,"q",0 ;; outline cc 'h'=27,"k",3,27,"x",1 ; 27,"k",0 ;; orator (helvetica) cc 'j'=27,"k",4,27,"x",1 ; 27,"k",0 ;; joined (script) rc ''=27,"6",3 rc ''=27,"6",4 rc ''=27,"6",5 rc ''=27,"6",6 rc ''=27,"6",21 rc ''=27,"6",128 rc ''=27,"6",129 rc ''=27,"6",130 rc ''=27,"6",131 rc ''=27,"6",132 rc ''=27,"6",133 rc ''=27,"6",134 rc ''=27,"6",135 rc ''=27,"6",136 rc ''=27,"6",137 rc ''=27,"6",138 rc ''=27,"6",139 rc ''=27,"6",140 rc ''=27,"6",141 rc ''=27,"6",142 rc ''=27,"6",143 rc ''=27,"6",144 rc ''=27,"6",145 rc ''=27,"6",146 rc ''=27,"6",147 rc ''=27,"6",148 rc ''=27,"6",149 rc ''=27,"6",150 rc ''=27,"6",151 rc ''=27,"6",152 rc ''=27,"6",153 rc ''=27,"6",154 rc ''=27,"R",4,"|",27,"R",0 ;; O slash rc ''=27,"6",156 rc ''=27,"R",4,"\",27,"R",0 ;; O slash rc ''=27,"6",159 rc ''=27,"R",2,"~",27,"R",0 IF PC rc ''=27,"6","" ENDIF IF ST rc 158=27,"R",2,"~",27,"R",0 ENDIF rc ''=160 rc ''=161 rc ''=162 rc ''=163 rc ''=164 rc ''=165 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,64,0,0,192,0,1,192,0,7,192,0,31,192,0,63,255,192,31,192,0,7,192,0,1,192,0,0,192,0,0,64,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,48,0,0,56,0,0,62,0,0,63,128,63,255,192,0,63,128,0,62,0,0,56,0,0,48,0,0,32,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,7,255,0,3,254,0,1,252,0,0,248,0,0,248,0,0,112,0,0,112,0,0,32,0,0,32,0,0,0,0,0,0,0,0,0,0 rc ''=27,"*",39,18,0, 0,0,0,0,0,0,0,32,0,0,32,0,0,112,0,0,112,0,0,248,0,0,248,0,1,252,0,3,254,0,7,255,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,32,0,0,0,0 rc ''=27,"t",1,175 IF ANSI rc ''=218 rc ''=191 rc ''=192 rc ''=217 rc ''=196 rc ''=179 rc ''=194 rc ''=193 rc ''=197 rc ''=195 rc ''=180 rc ''=166 rc ''=167 rc ''=168 rc ''=170 rc ''=171 rc ''=172 rc ''=173 rc ''=174 rc ''=230 rc ''=241 rc ''=246 rc ''=248 rc ''=250 ENDIF hl 27,"J",15 pscode 27,"9"; 27,"8" mm 1 mf 6 cw 36 pw 30 rem all widths are in units of 1/360" pw 30 widths 30 !18 "30 #30 $30 %36 &36 '18 (24 )24 *30 +30 ,18 -30 .18 /30 030 130 230 330 430 530 630 730 830 930 :18 ;18 <30 =30 >30 ?30 @36 A36 B36 C36 D36 E36 F36 G36 H36 I24 J30 K36 L36 M42 N36 O36 P36 Q36 R36 S36 T36 U42 V36 W42 X36 Y36 Z30 [24 \30 ]24 ^30 _30 `18 a30 b36 c30 d36 e30 f24 g36 h36 i18 j24 k36 l18 m42 n36 o30 p36 q36 r30 s30 t24 u36 v36 w42 x30 y36 z30 {24 |18 }24 ~30 36 36 30 30 30 30 30 30 30 30 30 18 18 18 36 36 36 42 42 30 30 30 36 36 36 36 42 30 30 36 42 30 30 18 30 36 36 36 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 36 36 36 36 36 rem Standard proportional daisywheel (subset of Diablo 630 codes) cc '@'=27,"&",27,"R" ;; reset code cc 'b'=27,"W" ; 27,"&" ;; bold (shadow) cc 'd'=27,"O" ; 27,"&" ;; double strike cc 's'=27,30,6,27,"U" ; 27,"D",27,30,9 ;; subscript cc 't'=27,30,6,27,"D" ; 27,"U",27,30,9 ;; superscript cc 'u'=27,"E" ; 27,"R" ;; underline cc 'r'=27,"A" ; 27,"B" ;; ribbon change rc 12=13,12 rc ''="#" IF SWEDISH rc ''=64 rc ''=91 rc ''=92 rc ''=93 rc ''=94 rc ''=96 rc ''=123 rc ''=124 rc ''=125 rc ''=126 ENDIF IF GERMAN rc ''=64 rc ''=91 rc ''=92 rc ''=93 rc ''=123 rc ''=124 rc ''=125 rc ''=126 ENDIF hl 27,"U" ab 0,0,0,27,26,"I" rem mc (27,"Q",)27,31,2," ",27,"S"(,27,"P") mm 3 mf 1 cw 12 pw 10 cc 'c'=27,31,9 ; 27,"S" cc 'e'=27,31,11 ; 27,"S" cc 'n'=27,31,13 ; 27,"S" cc 'p'=27,"P" ; 27,"Q" cc 'l'=27,17,10 ; 27,17,64 width ' '=10,6,8,12,10,14,14,6,6,6,10,10,6,8,6,8 width '0'=10,10,10,10,10,10,10,10,10,10 width ':'=6,6,10,10,10,10 width '@'=16,14,12,14,14,12,12,14,14,6,10,14,12,16 width 'N'=14,14,12,14,14,10,12,14,12,16,14,14,12 width '['=10,8,12,10,10 width '`'=8 width 'a'=10,10,10,10,10,8,10,10,6,6,10,6,16 width 'n'=10,10,10,10,8,8,8,10,10,14,10,10,10 width '{'=10,12,10,12 width ''=10 width ''=10 width ''=12 width ''=10 `,E$oI,)JEB?< NA)xE x h9hF2(I9AFB/@> NA"j)IEA W*j,Jf J-gRMJg"RE AfR&MRM Rf Gf Vf =fp#@JgN&IMaJf"JfB` _fj Pfd Bf^ PfX =fRYIJfLrpg:鉰<0e<<9dҀ`<Ae(<zd"<Fc<ae Ҁ`²$W`.Jfg&BN&IAp<}bB0,Ha(N|"@$ p lFep@)@E)IE"`BQ)IE`BQ ,Eo2V@l$)I[pB"Y"XI#I2B"2D)IED" XA"AJEfF" lFeT)AE ,D0BAHAR@&,D얁HCBCHCFC׬D.I/ S// / ?<?<JNAO NNN>`\O ,Eg/?<?<NMPO?<LNAJ =f8RNrtB0m| nҁ&ҁҁ҃҂`.g f Jg)AD NNu ,E",EIJe ЀЀNuNNNN:/>/ @gN G!e G9bp0 /HldNQPO`4 Gc Gd HlNQ~XO` GcHlNQlXO` HlNQ`XO.NuProtext Configuration ProgramIMSLRQInitial InstallationPress RETURN for a new installationMain configuration menuSave new configurationLoad configurationReset default configurationQuitProtext installation menuDPCLFDisc configurationSelect your hard disc or number of floppiesInstall PrintersOne or more printers may be selectedSet ColoursKeyboard LanguageChange this if the language shown is incorrectUse Gem File selectorAllows the Gem (or replacement) file selector to be usedCONFIG main menuELSMFPKDOEditing optionsLayout optionsSpelling checker optionsMemory optionsFile and disc optionsPrinter driver optionsKeyboard optionsDisplay optionsOther optionsPLTHFBSCNEORPage lengthThis is the physical paper sizeLine spacing1 is normal spacingTop marginThese lines are left blank at the top of each pageHeader marginThis will contain the header line or linesFooter marginThis will contain the footer line or linesBottom marginThese lines are left blank at the bottom of each pageSide marginThese columns are left blank at the left side of each pageContinuous printingOFF for single sheet printingNew page after printingON to eject the last pageHeadersWith page number in the centreFootersEdit default Ruler linePress RETURN to see and edit ruler lineIJWTSCPBAInsert or overwrite modeRight justificationWord wrapTabs & returns displayedSpaces displayedControl codes displayedWhen OFF Protext shows underlining, bold and italicsPage modePage Break displayAuto re-formattingWhen ON the text is automatically re-formatted when editedMiscellaneous optionsMTILBOSDPWCFADocument or program ModeThis mode is selected when Protext starts upProgram mode TabsEnter list of tab column numbers (*n means every nth column)Auto IndentApplies to program mode onlyLine drawing modeWhen ON, ALT + cursor keys draw linesBackups when savingCan be set to OFF if short of disc spaceStart in command modeFor experienced Protext usersSideways scrolling incrementThe number of columns scrolled when the cursor reaches the screen's edgeDecimal characterComma is used in most European countriesBackground printingSimultaneous printing and editing when ONAudible Warning disabledThe 'beep' sounded when certain errors occur or CTRL-f1 is pressedTurn off status line ClockSet to YES to turn off the clock displayDate FormatSelect one of three formatsSorting method for AccentsGoverns alphabetic sorting of accented characters12345QUPAMSDictionary 1Dictionary for spell checkingDictionary 2Dictionary 3Dictionary 4Dictionary 5Quick dictionaryThe dictionary held in memory for very fast checkingUpdate dictionaryNew words stored are put into this dictionaryDictionary PromptCommands such as LISTD, FINDW, ANAGRAM can ask for dictionary nameLookup accented charactersSet to YES if spell checking non-English languages (this is slower)Disable Mixed case warningSet to YES if using text with mixed case wordsSpell check whilst typingSTEDPXFSearch pathUsed to find dictionaries, printer drivers and help filesTemporary text pathUsed for storing temporary files when editing large documentsDefault Extension to loadIf filename is not found Protext tries again with this extensionDocument mode extensionsThese extensions switch Protext to document modeProgram mode extensionsThese extensions switch Protext to program modeAutoeXec file nameCommands in this file are executed when Protext starts up12SIUFile 1 memory sizeNumber of bytes (characters) allocated to 1st documentFile 2 memory sizeNumber of bytes (characters) allocated to 2nd documentSpell memory (/S)Number of bytes used by two pass spell checkMaximum Index words (/I)When creating a dictionary the maximum size is 20 times this (words)Undelete buffer sizeIncreasing this reduces the memory available for textDPSERLFDefault printer portThe printer port selected when you start using ProtextParallel printer driverThe printer driver assigned to the parallel portSerial printer driverThe printer driver assigned to the serial portSerial Delay (/D)Default is 1000. Increase this if missing characters on serial printerIgnore Reset codeSet this to YES to cure various printing problemsIgnore Line feedsSet this to YES if all printouts are double spacedForm feedsSet this to ON for laser printers/single sheetsLTCMKChange this if the language shown is incorrect for your keyboardKeyboard TypeChange this to use the IBM keypad layoutCTRL/ALT/SHIFT lockCauses shift keys to become 'sticky' and thus modify the next key pressedMouse on/off statusRedefine Keyboard layoutPress RETURN to redefine any key except shift and lock keysCMEOFBMLScreen ModeEdit mode cursor typeVariable height cursor is larger when insertingCommand mode cursor typeCursor Flash periodFull height cursor onlyScreen Blink timeSets speed of screen flash on errorMono background colourHi-res monitor only - use this to select black on white displayScroll Lock onCTRL-HELP changes the scroll lock stateStandard STIBM keypad layoutUSA EnglishUK EnglishFranaisDeutschEspaolItalianoSvenskaDanskNorskPortuguesIslandskNederlandsOVERWRITEINSERTBLACKWHITEAlways ONHidden until usedAlways OFFdd-mm-yymm-dd-yyyy-mm-ddSingle floppy disc ADual floppy disc A/BHard disc drive CHard disc drive DHard disc drive EHard disc drive FPARALLELSERIALPROGRAMDOCUMENTANGLO-GERMANSCANDINAVIAN011223Full heightVariable heightUse initial screen mode25 lines43/50 linesA:\B:\C:\PROTEXT\D:\PROTEXT\E:\PROTEXT\F:\PROTEXT\Amstrad DMP seriesFX80Amstrad LQ3500LQ3500Atari SLM804 with Diablo emulationSLM804DAtari SLM804 with Epson emulationSLM804EBrother HR15/HR25DIABLOBrother M1109/1409Brother M1224/1724/1824/1924LQ2500Citizen 120D+FX1000Citizen HQP40/45LQ1000Citizen Prodot 9Citizen Prodot 24/124DCitizen Swift 9Citizen Swift 24Diablo 630Epson DX100Epson FX80/100Epson FX80+/100+LX80Epson EX800/1000Epson FX800/850/1000/1050Epson GQ3500 laserGQ3500Epson GQ5000 laserGQ5000Epson JX80Epson LQ500/550Epson LQ800/1000/1500Epson LQ850/860/1050/1060Epson LQ2500/2550Epson LX80Epson LX800/86/850Epson RX80/100Epson RX800Epson SQ850/2550Epson SQ2000EPSON24Epson compatible 24 pin printerFujitsu 24 pin printerFujitsu M3349BEPSONGakken GPR2000QUENDATAHP DeskJetDESKJETHP DeskJet PlusHP PaintJetPAINTJETHP Laserjet (lettered cartridges)LASERJETIBM PC graphics printerIBM9IBM Proprinter (9 pin)IBM Proprinter X24 (24 pin)IBM24Juki 5510Juki 6100/6200JUKI6100Kaga Taxan KP810/KP910Mannesmann Tally MT85/86NEC P560/565NEC P5/P6/P7/P9 seriesNEC24NEC P2200 seriesOki Microline 290 seriesPanasonic KXP1124KXP1124Quendata DWP1120Qume Sprint 11 PlusQUME11Seikosha BP5420/5500Seikosha MP1350-AI/5350-AISeikosha SL80-AI/130-AISeikosha SL92/230-AISeikosha SP1200/1600Silver Reed EX32SIMPLEUKStar FR10/15Star LC10STARLC10Star LC10 ColourSTAR10CStar LC24STARLC24Star NB15/2410/2415Star NL10Star XB24Standard proportional daisywheelSTDDAISYStandard dot matrix in Epson modeStandard dot matrix with rev. lfStandard dot matrix in IBM modeSimple backspacing printerSIMPLESimple backspacing printer with CFGprotext.cfgcfg\PROTEXT CONFIG FILE Ver qikdct%-.3s,%s ESC - %c - %-*u%-*lu...%-.*s%-.*s,...%-.3s%-.*s...%cPPD Protext CONFIG v%s 4.30%.24s %s%04X %5u '%c' %s %d (&%02x) %s ASCHEXDEC U S C A NL CL SA SC %c %04X %3u PROTEXT Doc %u quotes 32K Page 1 Line 5 Col 17 [] Insert L--!---!---!---!---!---!---!---!---!---R It is necessary to relax your muscleswhen you can. Relaxing your brain isfatal. [ When written in Chinese, the word'crisis' is composed of two characters:One represents danger and the other onerepresents opportunity.] PROTEXT v%s (c) Arnor 1989 >CAT LETTER 5K QUOTES 2K NOTES 9K README 4KNVH..N/N0BNe$Hx'N/zPO)@ZJgaaJfa/. /aPOJ,jgbaB,Fa' ,lroLrlF lZ@}Cr HA pf lZp"lZ)}"HC! "qfaHlpaxXOJ,kg(HxNRHlkNvNTNrPO|<p,>fp//r//NTNTO` HlNvhXOBN/8LN^NuNVH/..B.|lT A"HJfS" tF/"n /1/N.A"HJfS rF.Hz/N.OR`A"HJfS* Jgpg-HHxPHnHnN.O Joz.r/gr-fPKp./N-XO(p@Bg&_@gU@g$`|jp/N.fXOra)@l`N=`N.z`Hna>Hx/a O `pL N^NuNVHHzN-XO*@ gb MCfBHnN-.PO @(,C"g/,C$HnN-POHzvHnN-HzrHnN-HxHnaOJgp`vAFC""HzHHnN,HxHna^OJgp`FA(C2Hz HnN-*HzHnN-HzHnN-HzHnN-HxHna L N^NuNVH/4*n./ N,8XO*pfp`HlC / N,$.HxHxHn-@N- nHRHxHzHnN,O Jfj .갅f ,HRtCe"fJ,HRrCe> 'o/.N,HlN-dp`: MCFfHlFahHlFN+B,kp.//.N+./Hx/,ZN,b.N,0O,HRrCe lZŐHxHlF^/N+O lZ"Hp0$H)J^,HRrCe"HŒ)If`)Hf|pl& lZ"H(8GJSf r26R` lZ"H*&IJSf ,fZU6 lZp0"H)IbCHx / N*PO-@Jg @Bp`/.N+PXOJg Hl#NrRXOpL,N^NuNVH7*n,- BNMHnHnHnHnNP./ aO-FN*.J- g fB `/N}XO.  f\ .Э".ҭ$T&-րSҭRHx////N`O-@RgfJ- gB `0,.` f~ //-N)PO&@JgxJgt "-, rNU*56HxNLXOgNNBNLXO .ܼgB// aHx// aO-Fp2mB// aO r3g rNUH*56 r g.gSgSgSg`@Sl<,-S`4Rf,|`( WDHHr/// a>O r3f`( .ܼglB// aHx// aO`NL(N^NuNVH'4*n.. . rNT lZ>-H '>m"<ҵ>AF^-H -Э"-T҇//NSPO rNTJ"56-AJgPSgSgSgSgSgSgSgSgSgSgSgLSgHSgPSgSg,Sgfp"gbSgUg~SgSgSgSg`B// aa rNS.:HnNofO-@oN|k .Sg r gSg&`4HnN'XO n`"HnN'XO n0`HnN'XO n a bNL\BNJ4Hx// aNO`(B// a< nCf rNR.:Hna ORg|kA"nfHx// aO `a&@Jg K"nf|k// aPO fp-@B// aaO pf lZp"n0-H nCf rNRL/5:Hna LPO-@Rg|kpfA"nf`tpf0 .JoHz`HnN%HnN{O A"nf`< .JoHz4HnN%HnN{zO A"HJfS nJfS $n-IC$n/IC",fS// //$-@N%O A"nf .Ѭfzpl4 lZ"HEp0Hܱc".t4ԁ4R` .g\ lZ"H*p0$H)Jb -Ig:RbRf"lfB) lZ*RP lb"HSI ,fbS/// N% O aNIBNGHx// aO` nJWDHH|kHx// aO `l&nA-HJg/ Hz/.N%O ѮVK`A"ngS nBB// a@ rNP.:HnaORgb|kA&n-H nJgFzplp, nf `-HR` nr,g JgR` nJgR`BHx// aO `Jg$ nJf rNOh uF S n`$S` nR rNOF uFp"nmB rNO, uFp"n"H"hJg|kHx// a0O pf lZp"lZ)}"HC "qf lZp"lZ)}"HC! "qf`p. nf,`|kHx// aO `+G rNNlJBg /5BaXO// atPO`ba:a// a`PO`Nan// aPPO`>a&H-m '>m"<ҵ>AF^&H -TЇ//-NKp.aPOp*f HzN!XO`/.HzN!PO rNL0/52N!pЭ/@ rNL u2JfS2 /".aXO rNK"56 d"A2;N r||p8|<X8p//.Hz,N!O *`p0//.HzN O *`//.HzN O *` lZp0&H KJfS ."Sc0Y KJfS" KC/ /HzN O *`T/ /HzN xO *`>-K nJg0 .Yl$Jg Hz|N HXOڀ nJ(g .]mHz^N (XOڀ`/HzRN POڀV` m KJfS ."ScY/ /HzNO *`/ /.HzNO *`JgA`A//.HzNO *`fJgA`A//.HzN|O *`Bp/HzNfPO*`. rNI uFp"H/(/.HzfN8O * ./aXOJgHxN@A.Hn//NDa rNI uJJfSJ ".䒀Rp./-ANHO .Jo/a\XO rNI@/5JNdNB@BN@:XOaXL(N^NuH./,/*/(/ Bap.///NwdOLNu/./ SJg Hx NbXO`.NuJ,Qgp` p lZ(A/NCXOJ,Qgp` p lZ(B/NCXONu// Jg*J,Qgp`p/NCXOJ,Qgp`p/NCXO`(J,Qgp`p/NCXXOJ,Qgp`p/NCtXO.NuH*o./avB,Q/,B@// Nf ,.Nqa.N@N?.HlNPONx fN@/N>rXOL NuNV/aHlNbHxLHnNcO . Rg0Sg`a`$HnaHx/a~O Jf HlafXOa0N@*BN>..N^NuNVDH'4|E lZ(r:f"p(/Nnp.//BN:HxN7(HxHxHxBN9HxN7p.Hx/BN9ODHxN6p.Hx/BN9BN6HxHxHxBN9a O NuHxN6HxaN8PONuHxN6XOJ,Qgp` p lZ(E/N:~XOJ,Qgp` p lZ(F/N:N8Hz.HzNBHx(N>HlNOJ,FgAF`A>/HzNHxN6 O J,Qgp` p lZ(E/N9XOJ,Qgp` p lZ(F/N:N8BHxN>8HxHxHxHxHlN(BN5ONuNVH./|BaN7XOxp$lj ІA!JgZpop(`p/@ rN*///N=Ba ІA!.Hz"NO *p#np/a6XORR` LN^NuNVH7~|zBN7*HxHxN=\HxHlNXHxN4HxHxHxBN7O$ A!JgR`BaXO,p-E-@ror(`" /ArNT///N// NV"p0r2./Hz`NO p @e Gb r/HzRNPO`p@db @g.S@g:S@gS@g`@HxHz(NPO`FHxHzNPO`6HxHzN|PO`&HxHzNlPO`HzN`XO` HzNTXOp0/aXOL NuNVH/x lZJ(ffJ(egp(fr(e//N?POBN0N2HxHx N8p lZ(er(f./HlNHxN0naHxHxHxBN3>HlNN3O,NmRgN3NvV~>BaN2LXOx*lbJUgp0fxG``//HlHzN`OJg HlNPXO|pl6"ҁ$ԆԂA0>=(Jgp03 g Ѐ=R`Hl&HzڮNp0..Hl]ap0..Hlsap0..Hlap0..HlaO0. @fr2.`r2p0/HlaPO0. @fr2.`r2p0/Hlalp0..Hla\p0..HlaLOJg Hl N FXO` HlDN :XONi/N_2XO*/HloN rPOJf f/N_XOr gr6gUgLg`PJgJA ,f" r// /N O pf lfUHBP|kx`Jf: lfUH 0 ЀA0>Hx/,f/N rO &lfpѬf lfUHBPHna4XO|pl Ѐ7R`|k`BN-L(N^NuNVH~HnHnN1bPO/./.N6BaPOJ$fAت`p$fAؠ`A؞/HlsN HzؔN O |plWDHHr/aXO ,$Jg Sg8SgP`h Ѐx n80p mrFo( r/HzZN tPO`6 Ѐr n20/HzFN XPO` Ѐr n20/Hz0N NN|N(NNNNNHNN–N4NNNZNNpaH./ NwF/,H/Nl,Nw`gA4`gA*`A LNu/ *op0-fSM`p.-fSM *_NuNVHK / /.Hz=a.N# L N^NuNVH*n)MHG/ /. Hzha. L(N^NuNVH*nG/ /. / aR. L(N^Nu oH pNu / oJfpL.NuNV .4o nN^NuNVH . n"n g>nS""""""""Q`S# # # # # # # # QLN^Nup)@B)@B)@B#%?<?<NMXJg ?<?<NMXH0<adf?<?<NNX#%?<"NNT#%/@/9%Nu y% @| y%2(hgXAher"h 11AF&HCC"|&10$HBJgJ,Bg///NP"  Af lB`< Af lB`, AfBHK0@|a8F#%@| y%CAHf&/9#&?'`2'`&'`'`'`H'I,p#B~p</<O/</</Ny<Nxxx9'E nE //Hl?NT "lE i"i'αno'`Hl@#NTX0U@@A'/0Hl@PNTP&lE/+/+Hl@iNT J9'g /Hl@NTPL'//Nj/ // /I,Hl@NTJ9'gv flH@HJfb/././. /.Hl@NT/./././.HlANT/.HlA@NTP/.HlATNTPHl?NTXJRgHy%NTHy%NTXNxVN @g@ @g8 @g @fL'JRJgFHyRNZNNp9' @#'L'/9'NupaNVH@I,/.NfXLN^NuH# ./,/ "??t?NN\OHLNu/./Hx/aPO.NuNV/~pl&"A(B/0//AaPOA(B"/!R`|(S.N^NuH aJKf0| ,K?//r?NNO LNuNVH/AH-H n-HJgp'fr l("*H`p l(*Hp FL?r?NNOHnHlKHl'N]O p0.Rr2.R)@(H(J,(4g d)|(p0,KHl(B/N\p0,KHnHn/N\Op0.S)@L&p0.S)@L*J(0gЀ)@L*p?NNTO)@KNn lZ*P"mL0-PHHK)I(&J,(.fE*R)mL("HxNlRXO&@ g~ d(|pd"҆ $Ԁ l("(R`R`)K("|(.ACHx/ /NkLACHx/ /Nk8ACHx/ /Nk$ACHx/ /NkACHx / /NjO.  @w.Ba.'N/J.BaO J,'gHxHxN5PO.Nu// p ep/aXO`Lp_@m8 @l2@0;N$&& a(` aP`a*`ab`~p/aXO.Nu/,L*BaPONu ,L*Lfa`R//,L&aPONuJL&f/,LapaXO` ,L&S/a\XONuJL*fa` ,L*S//,L&aPONua ,L&R/a(XONuNVHnHnaa,PO ,L*LgaVa`a`/./.afN^Nu/Hxa(.aaXOJgN:.Nup//a6aPOBBJNuHaFBI,,L&*,L*aZ//a POJgaa~pl r*NzAICLp Q0R`J,(.g J,Lg J,(/fp`pLNu|L:NuNuaTJ,L:ga0`aNua>J,L:ga`azNuaNuH./,/*/(/ aJj ,'"RށJj ,'"R܁Jj ,'RڀJj ,'"R؁ ,'츀c(p)@BJ)GL)FL"")AL")AL//aPOLNuNVH*n&n ,L* ,L"& ,LЬL n ,L"ЬL n L(N^NuH*o &o*L&&L*L(Nu ,'RNu ,LRNu ,LRNu ,L&Nu/.//,L*/anPO.NuH./,p̀ ,L.@І*a)EL./a8XOLNuH./,p̀ ,L.@"Ё*a)EL./aTXOLNuH~άL.ppL.,/a.aXOLNuH./a~ )@L.|̀rp*/aV.aXO)GL.LNuaR ,L.NuaHL?Nua<L?Nua0L?Nua$L?NuaL?Nua L?NuaL?NuaL?Nu ,Lg ,'`pNu/./)G'.NuB(6 ,'S)@(:Nu// Jg( ,L&LcaPaZRL& l'R'CH .NuHJ'gF~ l'CH B1J,QXg ,'ĐAp,JfNH~aJgN ,'Ѭ'aB'LNuH./ ,/a )@L&)@BFЬL)@')FL* ,L*ЬL")@'aLNuNuaBaNup//r//a2ONuNN"NNHJ,C5f~p@lA(J0pgA(J0pgvJ,(fpA(B0pNVHl>ONfHl>N^NN8PO HЀA(RpN1@,p g f HЀA(SpNRp f HЀA(Sp` H/ajXORG`\LNuH# /,/plp?Bgr?NM\O`$p?r?r?NM\O ,(prc/NXOpLNuH/ lBdC( J1g:r//aB,aPOJgpf/,BdHx~a$,aPOJg `aTJgp`p/,Bd/aFPOLNu/./)GBd.Nu/./pl /a2XO` W/aHXO.Nu lBdC( J1gp`/aXONuNVH Bgp?NMXOJfp`pLN^NuNVH p?p?NMXOJfp`pLN^NuHHxN]JXO*@Jg:Hx.N]:XO&@Jf / Ni\XOp` / NiPXO;|p;@;@;@ B L(NuH/,/ ЀA(Rp A(t*HJfJ,(faz*f ЀA(Spp`ZJg*U`JmgSmRm A(Rp0- Rmp0- r2-Ёr2-fBm ЀA(SppL NuNVH.. ЀA(Jpf2 A(tJg" A(t*H&M-U ЀA(Rp nJh f8Jf ЀC(Sq`J,(fg*/NhXO U-H`*H-U`/aXOJfp n0(0 pC(1xf0f ЀC(RqpC(x,`/HxaPO,z~`f|`p//aPO,Jg@ nRhSh C(SRhp0( r2(Ёr2(fBhA(x ЀA(SpL(N^NuH./ ЀA(RpA(J0xg A(t*H&U g*/ NfXO&U` ЀA(Bp A(BL(Nu/,BdaXONuH./ A(,0 ЀA(Jpf A(J0xg D` LNuH~p@l\ HЀA(Rp HA(t*HJg* UJh f&P/NfZXO*`,<// N*PO*U` HЀA(SpRG`L(Nu/./ ЀA(JpfA(Rp/a8XO.Nu/./ ЀA(JpgA(Sp/aXO.Nu/,BdaXONu/,BdaXONu/,BdaXONu/ lBdC( J1g"~p@l/,BdHxadPOJgRGa`.NuNVH..,. pmp o.,(p(fabzJkH ,(r NmA/ *Px8Jg$ rȁ/// -@a|O .Ѐ`S`zplF r NlA/ *Px8Jg$ rȁ/// -@a.O .Ѐ`R`pfa)F()G(L N^NuNVH*n.. ,. Ѐ MC`Sd ЀA0> Ѐ"M`Sd ЀA0> ЀC`SdL N^Nu/./ ,(g4)G( Sfp@9rA9@9A9`p@9r<A9@9A9.NuHK;>JGg&p0,Gp0/// a0O Ѐ`L NuJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberNo errorFundamental errorDrive not readyUnknown commandCRC errorBad requestDrive not ready/Seek errorUnknown mediaSector not foundNo paperWrite faultRead faultGeneral errorWrite protectedMedia changeUnknown deviceBad sectors on formatInsert other discNVH..,,A| ,A|f pg `D Jg SgSg&`.HnBNGbPO|QXB,QY`B,QX|QY` p@QX@QY)GA| LN^Nu|Bp)@AtNu)lAlAt)lApAxNuNVH..,. *.(.a S",AxmH Rn@.g S",Atf a <`.g R",Atf a <` S",Atm| Rnt.g U",Axg.g T",Axf a8 <`j.g S",Axf a <`J.g R",Axf a <`* ,Atmoap` ,Axmoap`LN^NuNVH3*naHnHnHnHnN.O .",Atmn$.&,Axmop`:. ,Ax,Jm g"f mЭlp0- ``pL N^NupaNVH*n&n ~p/aXOJgRM`Jg p;gp fp`Dp/N2XOJgp`.A-HA"ndhJgbp/ajXOJfRp/N2XOJfBp'gXOr@`p. ?Hnr6?NAPO .".Nd0".Nd(L$N^NuH./*o(BznN!/NXO, f* `pp fpf"* `\ fpo"*SSNpFn0AC0hg$ r/N XOp0r o_"*ݕ,R`r L NuH |~pl: AQz"HAQz pJfSEQz R// NPOJg|R`JfLNu// p/NXOJf N!Jgp`p.NuH/|p dp g p gp fNJ,Bbgp/ lQNXO @`*H g z SJg"p/aXO,pf`p/anXO, L NuH/|J,Bbgp/ lQNXO @`*H g"z SJg$p/a$XO,pf`p/aXO, L Nu// p/,B^/N\PORfp`p.Nu// p/aXO.NuNVH!$*n MCfHnNBEN:LHnpA?NAO Nn.JgJEg/ N3dXO L$N^NuNVPH!4*n&n / N.fXO-@Jfp` nCfA/ -HN.N3p`BEN9B/.N1\PO-@Jg @(g/ Hl>N3p`VN9jJgp`JBEN9T/./.BgpV?NAO Nm .N9N2Vp`/ / aPO. TgUfp`tp`pA-H"KfHz>/.N*BEHnpA?NAONkJgp$Ef BN1p`*Hn/ aPOJgp`/ / aPO.Jfp`pL,N^Nu/./ "<N_&Jfp`" rdN_Jfp` rN_JWDHH.NuH./,/*/ AB"0҇(/aXOJgpoR LNuNVH*n.&nHnNBHnN_BPO|-@pd$ HxAA/0/.NChO JgR`&zp d( nXH HxCA/1/NC6O JgR` n Jg-M nPH-Hr gr0fR n"n-H-Ip nAC0fA"nf A>/0/ NC nHx// NBO` n p"MQB- .L(N^Nu/ *oHx?/ NC:POJgp`Hx*/ NC&POJgp`p*_NuNV n 0( n2(@dp`, n hcp`0 n2@dp` n Pcp`pN^NuNVH|~ Glb HARP*p gLz ЀRr25 fڅ HARP//N,POJg| lBf HARP)pBRG`JfL N^NuH*o/ N)rXO&@ fp`*BEN4/ NG^.N4XOJg~Jg/ N-XO L(NuH*o/ N)(XO&@ fp`*BEN4/ NBT.N4XOJg~Jg/ N-XO L(NuaNu..\..//NJ. Gf `>p0/aTXO.p0r,>gp0r,>f r/adNXO .NuH*o>/p @dp @g p @g0<`0 Gb(p0/a.p0./ N@PO&@ g " ` L(NuNV/. p/ap..N^NuH~plSg@_g(Sg.Sg&Sg(Sg"Wgr f`Nb ,At",Ax$.&.(؂S-@HfR ."҂R(.fS".(S .fR .(R .fS Ѓ(.f .ЁS$.fRmjnd .m\nV/D$Nڞ"/$NSNЮΐHm,n( .Qla` .QoLaJf`@p@BP*`4z`.JgFaJfaJgJ,BOgHx aN״XO` lQBB . g f` . !m 9n B/N2PO .r grgJgrgrgrFl ,QҰQnvf lQJf6 .l^ lQ"HRI/ /axR . lQB/a\O `V/a XOQ-@ro lQ"HE/ / a2PO .S . lQJ,BOgr/aN֎XOa^`F r@ҁ)@B@pBa0NN!NuNVH*n&n ..-U np gp fR`Jg p gp;f *p`Bp"gp'fB*R nJg(p g"g nR Sl nRH*p`lf\R`V|JfP np-HJ@g@ gY@g@g@ g @fS|` nR Sl*p` * .B3L(N^NuNVH*n&n -Kp:-f KRKp//HatXO oTM` KRK/HNrAЁ o:p/NXOJg nTH"Mf`~NrAЁr ngN.p nrA/NXO nHxO/aPO nHxHzh/ N,O JgHxHzV/ N+O JfVMp,C"//.N+PO @B-@`/.ar.NXOJf/,C$/.N,PO/ /.N,POpg/NRXO/ apL(N^NuNVH#$*n.. NrAЁ@|:BgHnpG?NAPOA"HJfS, op`"Mfpf /,C$/ N,PO L$N^NuH' ./,/ <"NF(* rF@Bi @Bk @BHlBhp ?NN\OLNuNVH*o&o ./$ SJg8p/arr./@adXO"/,Jg `Jfp`RMRK`pL(N^Nu/ *oA *_Nu/ *o MSH *_NuNVpN^NuH./,/*/(/ B////a OLNuNVH/..,. *.(.-l'N//NЮPO-G .nHx aXOR` R-@ .l,//NxHx a./NfHx aOR`//NLPO-G .nHx a~XOR`A//HnHnN&R ".Ё.[҅*Z ".Ё".ND".$Ђ, .ЄNDЂ(.///N.///N.///N.///NNLN^Nu/ *oJfp` MJfS 5*_NuH~pl AQz*p g/ N;XOR`L NuH*o.//N/>XO&@ g, "l  A"K`Sd/N;JXO*p` / N;a d gp`.a ~Jga L`Na B.N WDHH@TP.NuH.,TXa, ggN`NHLNuBBNu/./)GB.Nu/Na$.pfN` .Nu/ *o)MB*_NuNV/a&. g f0 WDHHrA///HlR0NZOAR0)HBpFo0 l( ANPJfp`* ANP)pBBlBp`JBg / lBNXO. .N^Nu/a(.pgJfa.pga .` .Nu/.,Bpg)@B `LJBg$~ lB)HBSBf/,BN7HXOBB `"JBg/,BN XO.`~pfa .NuNVHJ,TWgJBf JBfNx` ,Brg .)AB `JBgp lB-@HBf)HBJBg*0,BRlBr2ҁ lBp0-@ fxBBJBfJBgJJBg a-@`$JBg lB(g aHp`:a-@p|fa-@r^grf: .` a~./NXO.r@opn r N=/N\XOp` nC9H J1g/NXOr@-@`T@~plaxp|6xfB6x`R`B.A-HHnHnNPOpfp-@ .`bp fp -@` p f(a,p g pEЀg)FBaJga0p`" .`J,Bga`aJfp`aLN^Nup)@BJBgBB/,BN4XOBBJBg/,BN XOBBNuJBf JBfp`pNu/~p@Ѐl, ARPJgARP/0N4XO ARPBR`BB.NuH#~p@Ѐl ARPBR`BB~ ЀAB<0JFg p0 GRrCB$1(//aDPO`J,BfaLNu/~p d  rAB0x//a POR`.NuNVH...FB.Hn/a LN^NuNVH..|p΀ ARPJg, lBCRPfBBARP/0N3XO ARPB n Jfp` JfS "Rҁ//@N'(XOARP"/!*@ fHlo `N*a.pfN``N* :m8 l0@0;N K;d`K;q`K;` K;`K; rHn/ /NO ,pfp.` L N^NuH? ,B",Bβfp`T ,B"AT\*0RB Bmp)@B .Hf* "BAHAtF‚/aXOr2 `,pF̀"€HR,pЀfJ,Bg <`,R/fd ,R,r~fxx",At$,Ax&,Q\)CAt ,Q`)@AxHR$HR(J,Bf$&,Atff ,Qd"Cv(SDHH(JgBC`)lQdCp@BJg|B <`DJTRgp,BB,B//,R,aPO~> f JBgSB ,BʰBfBB LNuJBVDHHNuH./ ,pF̀ JgQg8Ug:rg:Ug00` 0<!`0<`0<`0<`0<` LNuH! p??NMXO./anXOr2 LNuH p?p?NMXOLNuJ,Bg aB,B` |BaNuNVH..,. x r fp` rggx`lgx`bx`^gx`Tg(`Jg ЀA0H20H Agxpg"g ЀA0F20H Agx ЄЀA0>:0 LN^Nu ,R,Nu|BNuB,BNupa/ *oJgp:-fA ` *_Nu\<>|/[],:;{}*?"^H*o p,C"// NPO&@JfHx:/ NPO&@ f&M`RK L(NuH*o / a*@Hx./ NjO &@Jg ` B/ N*N bOJggzgJEgBazXO "N1L(NuH*o./ ,/$&o( "N1(Jf `>BEN / /Hx/ N#j*N OJggzgBaXO "N1L(NuH*o./,/BEN /// N%*N O JgzpfJEgBaXO L NuH*o BEN f/ N%.N `XOJg~pfJEgBa|XO L NuNVH*n&n BEN / aXO-@Jfp`2/ /.N,-@NPOJg-HJf /.aXO .L(N^NuNVH!$*nBEN gJ <@Jg/0(/Hl?IHlW(NPOJC6gHxHlW( lC6NPO,p@fVN Hl?VHlW(N HlW(NNfO N,pa@e pz@bF @gp0/Hl?kN POJgNp0r,?kf H-@`p0r,?lf -|`p-@ .)@C0B,C5LN^NuNV .9@Z . 9@Z .9@Z .9@Z" .9@Z$ <lNN^NuNVH*n&n .9@Z . 9@Z <xN g:Z> g6Z@*n g:ZB*n g:ZD0,Z n 0Z@ n0ZB n0ZD0,Z?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}NVH/4..,./N XO*@ f p)@Ep`:-H-gJDgHzHxp?p@?NAO -gHxB/N)O Jjp`&n g// /N)@O .`~-Kp@Ѐe^.,Dl. O ",E.p@Ѐm*A`:HxpH?NA\O.p@Ѐm$(؄c. m.</pH?NA\O*@ g-M (Hļd ` H" KCAN-@" ." (JfJg,// /N(xO `// /N(hO Rg -M&n` lEg/ pI?NA\O`|/Hx / N O *@-M f// /N(O K-H`J " // //@,N'O f,HxHzF/N'O UfR ."$ &@Jf .쐮 .JEgp` L,N^Nu NVH;*o,HH.O"</@N$S"//@ rdNr"/jVHH/@ /A"<mN"/Ё"/ "/Ё, rf rdNJf "<NJfp`p@CB-HH.S`AC@0xHH܀SJn-HH-HH-HH-HHS(؃/@ /ArN*Ђr?NAXON$ p` < f ?r>?NAXON#p)@Ep`.gn ?r>?NAXON#p??/ rC?NAO N#?/ rN^NuL0/ 2/?`QQ4 /NuL / d2H@`!QQ /Nu2H@`L0/ 2/`QQ /Nu o"BL Q Qp$ NuWWf S$ NuJZgBa &XO /f )|EpNuH<0V@nబDn&,[pg"Cn^$i &JJRkx8*؄؄oJx8*k ؄؄EH`Eg(JRkx8*؄؄ox8*k ؄؄EH`&gd"C`Gzg4"Yfz`((Jjj*7A65Ef7Hz&)JEgY#C #J XL  m + ?@H" M"k`Sd2/ k'HH *MJg / N XOJg ЇS"N 8" `JfP L(N^NuNVH*o-gd-g/ N HxB/-N6O.`l MHxB/(/HNO o "(.*h,` r fS SJf`,HxB/-NO .-g - ހ` L N^NuH*o./,/-g/ N XOpf / N&XOހ|+mp+@+m B- -g rí+@ ///-NPO Rfp`pL NuNVH*n&n .,E| nJg/N tXO+H@+g<@6g S@g@fN~r++WDHH,`:.<r++WDHH,`"|+H@ag S@g @f ~`.<H@ag@gN[@g`Jgp`p@/,E// NO *pfp`Jg ,<@`,<@`zJgp`p/,E// NFO *pfp`Jg|@܆`F|`BJgp`p@@/,E// NO *pfp`@Jg|@܆`|`p`.f"n#H#H#E#H#H #H#F L(N^NupaNVH!4./ lE"P&Q/H f`X K f 'm ѓ`&M*k f*o KYH"Uf* S  f/ pI?NA\O lEǓ lE L,N^NuNVH*I MYH~|-H`R lE&P gB*ne: lE"Kлc`*XM ndb&M*S f nB!S&/aXORXEmL(N^Nupa ,Z)oZJfNuYH<0",[pf)|EL m +?@H" k"M`Sd2/ k'HH*MJg./ NXO(pf ЇS"N|" ` S*MRMJf L(N^NuNVH..*n | @S m4 mR -gp f/ NXO,Jg `& ` p3UgVpLFr@ҁf -+@ `6-gp`pnFrnFf+m ` p+@ `-g8B HxHn/-NO ,pf `pg|`tJf$/ N dXOJg p`b -+@ +m - Jn/ NXO,Jg `:J g mR S -gp f / NXO,Jg ` L N^NuNVHKE `&M*S gJf f"Hx"NRXO*@Jfp`&p!r MQ/ /. /.NL(N^NuNVH*n-gAE fHlE.HxN POSm mRp`p3Sg$pLFr@ҁf` p+@p`-gPB~- JgB- `HxHn/-N>O .Jo ~.`Jf`~`jJf/ N XOJg p`P+m/-/-/-NO +@.JoS mR~`Jf` B~ L N^NuNVH*n g-f*+mp+@B- +@ -g`pJgj - Jjr+A - .Jg,//-/-N&O ,pf` g+m-gp+@ rí`+m p0gp`(p`$~KE `Jg/ a*XOJg~*U f L N^NuH*o~-g / NXO.p fJg /-NXOB/-NXO,pgJfpL NuNVH!$*lC` mN*U fKE `,pUf -.Jg//-/-N O *U f` lDXH/pA?NA\ON lD)PDJDf~KZ`JUg0-H/NXORXMDm/.N JL$N^NuH0$&HBHCCHBBBЂL NuJjDJjDaDNuaDDNuJjDaDNu/HA4fH@HAHB4g0H@40HB2$Nu/v|dQC|dYC| dUCJAkSC4HBBBHC604HAdSCЁr2HCH@A&$NuNV/.N.N,N^NuNVH $/.NFXO*@Jfp`.-gBUp` 0-?r>?NAXON RBUJEgp`pL$N^NuH./ p)@EJkDl AZ*HJUg `p )@EpL NuHE0/?@A0ACA`d2XH`"Q)_ENMLE"lEN½NVHx B/.NN^NuNVHx B/.NN^NuNV/ <l nШ"($(///(/(/( AC\/0(AC/0HzHlZN8AZ $.N^Nu%s %s %02d %02d:%02d:%02d %4d NZpaNV/ HzNXO*@ fP ,F d@@0;N""4""""".(""."K`K`K` K`KUZlmZmmZnB,ZoAZl)HZdAHn/NPOV ."<N)@Z`JgUZpmZqmZrp@Zsr)AZ\`B,ZpBZ\AZp)HZh*_N^NuTZCST6CET1???2???3GMT0 o /H0 HxCCr1fJm$nf Bt`<-fP`<+fJfp <0f8p<Xg<xf(p`"<f<0f xfRH` xfRHJgt<0mT<9n0`<Am>7l4&gHCHCJCfԃek`PPԁek`PP`JgD"/g"ASH"" L NupaNVH#4*H&n-I g0Bg/ p=?NAPO.Jk g BgpE?NAXO6 ?BgrF?NA\OJgp> nf<~p&(fCp?/ p=?NAPO,-H`FCp?/ p=?NAPO,`0~p&fCBg/ p //o/@?<@NATO`)_EHE2/.?o ?A?<BNATO`)_EHEJfp`2/> o/o/H?<?JAk f)H[x?<?B?<BNA/@?Ap)@E?@>B??Hx?<BNAO Jf|O )o[tNATO l[xJk"g fHyHx??<@NAO p`([tg. RAHyHx??<@NAO /,ELENu  f `NAO NATO` ?/HE?<?/B?<BNA/@2/ ?ABo>BBg?Hx?<BNAO rJWD?A NAO p0LENu   /"_` "lELEJj$AD)@E|ClApfp)@EpNBEN /Jkp)@EN/2H@t `WWf(CQQ`дWWf CQQ g$Nu// "QS@t `| SAgU@c дgSAW  _ $NufNo room for configuration fileInvalid configuration file<< No File >>Protext CONFIG (c) Arnor 1990Abandon changes made (y/n)? ON OFFYESNO Bad filename%s. Press ESC to continue: Name of CFG file to load: Load failedName of CFG file to save: Save failedPrinter driver '%s' to be copiedInsert printer driver disc and press a key...Reading '%s'Writing '%s'Insert program disc and press a key...Failed to copy printer driverCurrent file: Use %c & %c to select options. RETURN, %c & %c to change. ESC to quit menuPrinter drivers. RETURN to select, %c for more, ESC to edit name directly.Change keyboard to language %dExpansion tokenCommand tokenIgnore tokenProtext keyboard configuration. Keyboard type %d, language %dPress key to redefine: Key number REDEFINED IN CFG FILECurrent settings: hex decimal ascii functionUnshifted: With SHIFT: With CTRL: With ALT: With NUM LOCK on: With CAPS LOCK on: With SHIFT + ALT: With SHIFT + CTRL: Type E to edit definition, C to clear, ESC to quit: Type E to edit definition, ESC to quit: CE Editing mode: %3s (TAB to change)Monochrome mode - cannot edit colours. Press a key ...Colour Selection This colour represents boldface This is how underlining will be shown And this will indicate italics h%22 f7f8f 9f(3f.H 8N}Db25f f,'w*d v"2 df2 rf2Hf2,f2:f2f2f 2f2Vf ()6,Bb ~$p./0 81F|234(50P60Xp .  8df9f:f<f=f >  Tgf ^hf r 4  ? .<z @ ~  @ 'z 4 R p b  4 N     N : ZO h O h O" h O$ h O& h / O(FPXHfbHj Ov O^OxO[O'w*@/ F jZ n r v8~  : d| Oh8jOX x N`7 = f, e&P|d f6  A5f" '~f. 't\Dt 'u\DS z HXf f &,6HT^hrfff f&(*,0268DTlvPROTEXT CONFIG FILE Ver C B .@2d,(>-------!-------!-------!-------!-------!-------!-------!-------!----R*8EXFILEASMBASBATC CVTERRH KEYLSTMAKPASPPDPRNSRC DOCTXTarnorengarnorenguserarnore2user:BT\pTT*:LRd~LL 4LDPbpxpp<F^d^| 2L^fx &4>HZblv ^ . J R Swap Edit Pen Edit Paper Command Pen Command Paper Status Pen Status Paper Ruler Pen Ruler Paper Inverse Pen Inverse Paper Restore Colours Finished$J$P$_$p$$$$$ $ $ $%  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRS;<=>?@ABCD^_`abcdefghijklmnopqrKMuvG   bbcc cc$c0???????OL|2@3#('")`~+\|&1|2@"3#'4(5[6^7` !8 9{ 0} )>] -_}aA)ACzZBZ\=<[$*]qQ9QS'mM 5MO(%'>+``<>\,wW?WY2,?3;.4:/5=+~2"@36&{7/ 8([ 9)] 0=}+*])`'+#^=`<>\3,;4.:5-_V<>\ ?\ :;zZBZ\['|(,yYAY[1|2@3#6/:<[;=]'(;:{)`'+}`<>\3,?4.!5'"36& 8({ 9)} '?; ^=[+*]'@(#)`'+2"@3#6&^7/{ 8([ 9)] 0=} +?\ [{]}'(`~)'*+\|^@`<>\|3,;4.:5-_V<>\|4$'(('1!|3#4$ 8({ 9)} '? +*[:;]'()`'+=  -_??'('<:5(((((()@((*+(+((*,(-H((-H.(-H.(*.(*/z(1!2"34$5%6^7&8*9(0)-_=+ qQ9QSwW?WYeE-EGrR:RT tT<TVyYAY[uU=UWiI 1IK oO7OQpP8PR[{]} aA)AC sS;SUdD,DFfF.FHgG/GIhH0HJjJ 2JLkK 3KMlL 4LN;:'@`#~zZBZ\xX@XZcC+CEvV>VXbB*BDnN6NPmM 5MO,<.>/?  !  " !#"$#%$&%'&( ') (*---+++!\|\|(())//**77889944556611223300...              !     $(,048<@DHLPTX\`dh  $(,048<@DHLPTX\`dh T $$$xx<< NA"j)IA W*j,Jf J-gRMJg"RH AfR&MRM Rf Gf Vf =fp#@JgN &IMaJf"JfB` _fj Pfd Bf^ PfX =fRYIJfLrpg:鉰<0e<<9dҀ`<Ae(<zd"<Fc<ae Ҁ`²$W`.Jfg&BN&IAp<}bB0,Ha,N"@$ p lPep@)@@)I<"`BQ)I8`BQ ,o2V@l$)I B"Y"XI#I2B"2P)I0l" XA"AJ fF" lPeT)A ,D0BAHAR@&,DHCBCHCFC׬D.I/ S// / ?<?<JNAO NN  _N>`> ,g/?<?<NMPO?<LNAJ =f8RNrtB0m| nҁ&ҁҁ҃҂`.g f Jg)Al NNu ,H",e ЀЀNuNNN@NHH.J,,WDHH@,B,$J,,g4  f,AMN rgSg SgSfJ,$gp,$rN|`` ,DrgSg0 rbҁa`Fprbҁf paЀrNJ`. r@Fa`"prbҁf p>FrN&` r&Fa ,rdr`U" ND`J,$gp,$rN`v ,DrgSg6 rbҁat`ZprbҁfpaЀrN`@ rmҁaL`2prbҁfp>FrN` r`ҁa$` J,$gp,$rNj`` ,Drg4Sg rLFa`FprLFf pLNuH.,N*@p@g.S@g&@ g`S@g`S@g\S@gTS@gU@g @gJS@gB`Hz`Fpfp-ANoJfz`*pfp-ANnJfz`z` z`z`*prNL NuH.,N*@p@g@ gS@gS@gS@gS@grS@gS@g @ghS@g``fx`dxpf$N|Nz @Nh AxNnhJf&NN\N?FNr/ *HJ,gJ,НWDHH@НB, MNt*_Nu%s %s ...J,HgACXf`A/NlpPAXNmJjp`J,Xfp`pAXa:)l)@ NuJ,HgAKCϩf`ANlTpPAϩNm4Jjp`pAϩa)l)@NuHlHldHzXNl(pAЦNlO Nu/ *Hp" Ma<*_Nu/ *Hpr Ma**_Nu/ *Hpr Ma*_Nu/ *Hp" Ma*_NuNVH*H.,G @!gNp@Ц@@@$J,Hg`aJ,gp`p)@J,gpe`p)@A6Nw2 g aJoJ,g aJkld!|`nJg>B Ma , Jn aXJoJ,g@J,f:aJkaJj(`a,JoJ,g ajJkaJk~B,a.J,g$ cA=NN , cAPNe N NAa\J,МgrRJ,Нg ar`ar.JfN|J,#g lCf` J,gA!`A//HnN\O >e Nj N AaN|S@g@g<@"g&@g,`Z DR   DR  R`z`z`z`z` z=`z#`z* DR  DR `PANpA90g6 KSHN DR"-@r fRpA90gRK`prA90Jfp@f. DR  DRp/HN[lrPҁЁ"/` DR `pf DR  DR `Jg .)@`)n L(N^NuH*H.|lp5hfR`p5hNZhR`L NuNVHJ,РfBJ,!gNNNLN֬NNNNL N9NN8N9NLLN3N7N?N7N9NBN7NVH'-Hp@@@pACNY.plAPNXpANYrmpA7N*@Jf AN)`| MNX*p`gp$fAN) MNX`p FR "pfz hJfACNfJf6 MNXD"BAHA$҂$҂-@H@B@Ҁ-A r MNYNYJ,Hfp Ny:Ny MNX*p`gpgp$gpf MNW* g,_gJr frJ.gNx`Ny6J.WDHH@`PJ.gN`NJ.WDHH@`.J.gN`NJ.WDHH@` r Nx MNWd*`H MNWjNVJ,HgAuNVNy` MNW`lL N^NuNuNuNuNuNuN4N(N^NLN@NH.Nx,Tpfp`p()@x ",xNW*)@|LNu*.* %s%s %s %d %-8s%-3s <%s>%4ldK<%s> %7ld %02d-%02d-%02d %02d:%02d%s.%s* %s .. :\ %-13s %6luK %6u %s/ *Hp Ma*_Nu/ *Hp Ma*_NuNV H'4*H.p@T@UN'pf a MC`fA`N'f,Jgp:g pN&JgJfpf "<NQ*J.UfJtgb/,tHzNQ>POptfA얜`A얡Nr/,pHlNs POp'`fp Nr\/HlNsPOpfA`ANrN`AqNPa L,N^NuJg lNQ8BNuJfp}ЀrNQL)@JVDHHNu/ ,tr}ҁmp` ,trNqt l*HRt *_NuNV,H*H.p)@p)@taJfp`` MNq-@2 @C7f n2Cf Jff|`|JfJfp`p* MCfANqAl"@fpFAN &@N!Jgp` gB.-+gPBp.+f$+f\JgXACf||-`>JfAC7aJfr`rA-`JfAC7a|Jfr`rA-J.-gR+fJ+fBa-@.Jfp`BA"n.f n.k +!@1k1k +ѬpN d&@` a pL(N^NuJtg ,tr lCNO$NuH*H&I- + prHҁfp`.pfp`"g fp`gp` M"KaL(NuNVH/*H&I@JfJfr`r `J.fp`pNNr./@ NN"/*p.fr`rtA0"..r.fr`rpA0",gJgJf ` `JfbJg\ L(N^NuNVH?*H.- MCfJfWDHH, MCfp.ANNv&@ gBHnHzNorPOJg.A"HJfS rc"HJfS r N`2Jgp `p.r Nnv gA/HzNoPO`ANnjgp*`p r NnBpf<gHlHzvNnPO` <Э"<NMN/HzXNnPO`p0-"t‚t4văv6pPր -ArdNMp0-&x8p?Ȁ-A-B-C-DgHlHzNnNPO`/-HzNn>POJg pN`NJg$SgSg6`L/././.HzNnO`2/././.HzNmO`/././.HzNmOpf/./.Hz~NmO `gpR`p-r NlgpH`p-r NlgpS`p-r NlgpV`p-r Nlgp,`p-r NlgpA`p-r NlvL(N^NuNVH*H|,h|haNx.p//prNlpPOJ(g l(NlNl)@(NNlxHxHxprNl>NlS/@NlS.//p"Na a Nl)@рNkNl2O Jf6|J,gK`(J, gHl Hz:Hz0HnNJ&OK`K Ma&@ajaJf A$CfJ,(J(g l(Nk> l(NkB(`Nk NkEh L(N^NuNVH*HpOAфNAфNB@r:gr NJf Aф"lƼNAф"MNAфNIAф"HJfS *TNNPp/HxrANjNkPPO( "JjR.,Sm pbЀNj`HlфHzNkBPOSm pbЀNj`L N^NuNV/. ",рNI",xNi/@ ",рNI /Nj.N^NuH.z ,р",|Ni(N^a Nj|lP a ",2Ёtl0pNi l rNi a рlpN\R` ,xUNNR`|% LNuH*H.p MaRfp` a J aZL NuNV$H?*HatJfp`  ,a`a \ MC$fA$ap*)@2 ,A$a.-EFB,% ,tJoT ,2rNh l rNh&H KC-HLfJfWDHH@K aNHH , KaNhaNh, NH, fA촬Nl-@BRg,.B ,tJn g ALNH@Jga\a< r2 ASN|< JgSgSgSgZSgdSgSgSgSgSgYgvgr g6UgZg&SgJrgSgSgSg[g8SgBSgSghSgrgrg `p`Pa+ gTJ.KgAmN Ьрlf*` .BJjN ,рo` .>Jk8",рl0 .B",xN@",рNa Ю>",2Ҁ-@&tl*`ND` ",рN@|R",рN`",2Ё$,tlj ,рڀ&ց(So*S$SoJѬ2 ,a.р|%`0 ,2"҅$,рm lJo2 ,a.ڬр|%adJ,%fj .Fg`a.N` ,2rN`4 l .FrN`$ ,al`0L(N^NuNp/HxrAN`PONuNzHxHxprN`rN`2PONuaN`(N`NuNRp//prN`LN?nPONu/aN`.p"N`pPmp N_AN`NprN`pPmp N_A]N_Nar.NuNV$H4*H&I-H(-H, MCfACNpFAC4N-@0J0g n0(gp.(ga-@$JgJ(f-@( n0"@f n$!K&Jf'HJ,g "n,#H"!I-H,"ME`f n0C`INA`"lƼNtA`"n$a n$ (ѫ (ѫ`(f(f R (ѫA4N-@0`L,N^Nu/ ,4r*N^* l,*HR4 Ȁ4e A쵛N=p`"+H+H+H"+H&p+@+@R6 *_NuNVH'N^J,&fJ0f < N=n)@0J,fpdЀr*N=T)@,J,gJ0fAxN*@A`"MfN<:rAЁprN^VA쵩N]N[ lƼ"Map)@: MaN[|&N n-@"<N<-@N]~|aprN]/.HlbN]a azPO-Fzp"N] ІraN\-@Np NZ8`ANZ@R`Jo"J"gp"HJfSE> 2,ƺf"HJfSE> B2A> L$Nu/ *HJ&g m&aA>"MN A>"lƼN ~` MC>f*_NuaHxHxHlN7NXavO NuB,&J,g l,N7B,J0g l0N7B0NuNV/-HpOACN8.plAN7pOAN7.pm N8AN.N^Nu/ *Hp" Ma*_NuNVH4.,-HpOACN7*JfplhAN6plB.pOAN*pmpOAC\N7v*plLA N6ppOA\N7P*pgJf,pOA\Nh` pOAC\N74*pl pOA\NFA\ClfAl"HJfS $H-JNAl"HJfS@f.mr:fp@`&J.g ,ƺ n(gAl"lƼNRAC fA NWL&@AN^Jg A완N`pA Nj*@Jf A&N` gN5JfA"KfA N5J.g A"nfAlN5jA CNVAlCNVACfJff AbN&`"pA ClaJgNT*@`rp`pL,N^NuNVH*H&I.|p=@=@Jg KCN MCƥN5-@fp` MN@-@ MCNJgACNPJn nN4p`N/ / Hl6N4PN`,* N4O -@JfAGN4" nN4tp` KCƨN4-@f nN4z nN4Np`nf4 n (" nN4*pg n (" nN氅gB. nN4 nN4 .r  KN< KCN nN4.L(N^NuNVH*H.N4 MCfANU @C-@f"Jffp,ɜANKr2p,ɛfZp MNht&@JfJgH MN3J/ HlN3PO`4 g0N3LJf(A"nfN4ANJf p MNh&&@`L(N^NuH*HzN3 MCƥN3&&@ g>NQN2Jg~` KN2. Rg,Sg^[gZYgSgFWg$r g r NSR` KN2NQ` KN2.p gpEЀg  KN2p NSz` KN2h. r NJgN r Nr N8`P g.Sg2Sg6Sgr g `4p~ЀNS(`6pNS p`FNS`&p NS`pNS`pVFNR` r NRR` CNNx,چ SJgp NR`L(NuNV`H $*HN2vJfpOANbJo>AN1<`4 MNJfp.g`* MC`fA`N1RHn`p;?NA\OJfNefp` AHN0pL$N^NuNV/-HpOACN1.plA옚N0pOAN1.pm A"na.N^NuNVH*H-IpOACN1z.plA옰N0tpOAN1T.pm,N1~pANeJgHnHl6N0PPO` MCN&L N^NuNV-HpACN1rlAtN0 pAN0rlp`p.N0|rANdN^NuNVH*H&I-M-K nJgzp* nfR nJgp.gR` nr?f RR`r."nf JfR`p-IN/r n/@-H N/"/gp`$ nr.fR nJg p*gp`pL(N^NuNNLNNNDNyNNN̾N4NN&NzNN"NDNDN`NxbNjNNNFN,NN>N"NNZNpNN NbNNNN2N2Np6NNNNNNp0NN./ *H MC Nk *_Nudct%sqikaw%s %s '%s' : %lu%lu %suwfold %u %s '%s'%s '%s'H~J,]fp@\@VJ,g l,N-B,~J0g l0N-B0~|ld rNNJAJgA pN- rNN,AB~ rNNAJgA pN- rNMAB~R` LNu/|cB,V~l< rNMAJg&AJgA pN- rNMABR`.NuH$J,fap)@ lJPfp`~pl l"H ЀJqgp0$HJgzC Ѐp0a *@Jfap`hR ,rNMA!J,\f n\H)PP n. L,N^NuH#*H MN#. MN#b, Sr MN$J a@8 MN#nrWDHH L NuNVpH*H Ma/@ p o NUB-@xg @CƥN#X&@ fN#/ Hl*Hn|N"A|Nz\p`P Ka`Jg6p: nx(fpN#..rA`N"h. N#z,cAc `A쬙Nz KN"pL(dN^NuNVH'4*H&I.|)H:-HaB,Nw JfA?Nyp`a JfA?NyNwlp` MCƥN"~-@JfANy|`* Ka-@g @an KN"x)@:JfN"ANy^|` l:aN!tALN! ,JR*r2p" l"nN_x)@ lNy l)H ,)H ,Ȱf ANx` l)lNyJgzA쫀N!: ,Đr lCxNzrA쫥N!Jg n"l:aJf`< n"l:aJg, ,Nx l:a l:a: Ka l:"@N B:J:g l:N!Hl pA?NA\ON z|Jg nN Jg nN NuaVJWDHHL,N^NuNVH4*H&Izpr~@@AAp2lAJ xR`B lYH)HJ.gJ.f J.f4J.g.X lJWDHH@fAJ$l"RNJgB.J.f4J.g. MCa8JWDHHAfAJCNJgB.J.gJ.g`|`J.g|`"l QCNf,Jj*AJ$l"RaZ*AJ$l"RN |`RJf*AJCa.*AJCNp@@`$AJCa*AJCN| ,rNJfAJ-H KN l~ ,֊ֆ l~1@\~p nCJ1g8"l֊R֊p-H/IN o-n l֊֎cANv`f l֊B)H֊ l~ւc ANu`Hz  KN+gp`2AJNwAJ/HzP/ NRNxO Jgp`pL,N^NuNVH*H&IzxB.p)@.p2lAJ xR` lYH)H MCa2JgdJ.f4Jg0X lJWDHHx@J.f"l QCNtJkJ.f"l QCN\,Jfx`JjxAJCaH*AJCN ,rNJfAJ-H KN" l~ ,֊ֆ l~1@\~p nCJ1g8"l֊R֊p-H/IN o-n l֊֎cANtb`f l֊B)H֊ l~ւc ANtD`Hz  KN+gp`2AJNvAJ/Hz/ NRNO Jgp`pL(N^NuNVH4-H-H-HpOACjN(,plr l"HJQgp0$HCjf` C"EjB lJ(Pg>A}NpOAjN,JkJf l"Hp0CjfAjN=(GjJf A쬋N`Vp2ACN,pl0A찚Np2ANf,Jk^JfAC2ANrA` rpFg*,"RApNJgp`p,rFf|apNuNV`H$-H`p2A`CNB.plA쯙NA쯇NpOAvN.JkJf l"Hp0CvfAvN2KvJg Bd Ma`)@:gr-@lAdaJgFNtp N2ANFp N2p)@)@JgAd`CIaJfATNJdg ndNJ:g l:NPL$N^NuH/*H.p)@)@JgNp MaJgN&Jf ATN(`Ac"HJfS* V",D^n V"(N/ ,풐8"ZSDHHp/ ,"ACcN7B,N/XOpg& R)@`JfNRJgp N1ATN1L NuH*H&I.zAJ"UNsAJ"HJfS)Ia)@|ap)@Ba,JgnN"JfhJ,gpAֲa^JgP gpAֲ"KaHJf`8| ,rm l rN0~ApCֲIaJgR`z L(NuNVH*H&I. M"KaJg ,Rr#op`|l& r3N0A"Mf Jffp`R`Jf@pNgN/*N ,r lr1Ҁ`r8Ё"pN0* N/p N0 MN0* ,r3N/A"Mf ,r3N/A"HJfS ,Db ,r3N/vA"HJfS )@D ,"/Ar3N/NAC"/#RpL(N^NuJzg lzNJֆg lֆN)Hz)HֆNu ,NrNg`)@zfp`N lz)H~ ,N"SpN )Hւ ,NN|)@ֆ)@֊",N @"HSI)I֎Jfa~p`pNuNV/ *H MN )@֒ ,~zrN )@֞r lz"MAN -gp`-l֒BnprA"MN -gp`p MN 4)@֖ ,֊ֆr lֆ"MAN -gp`D MN ֒)@֚pr MN ,֒ MN  ,֖ MN  ,֚ MN -WDHH*_N^Nu/ *HpF MN p l(raЁ MN *_NuH*Hp l(raЁ MN ~pl p MN R`L Nu/ *Hp r MN v*_NuHJ@g0 ,֮@. <A@NAbJg l@"H)I֮C)I֪J*@-fd MN f,AJ0hf-g-fB~AJ0hg GR CJ" MN (,`AJB0xAJ-HAa>Jf|b g MN pL(N^NuJ .rN@ sJfS-H-gR .κo"`"*R`ZTp-n2-H҅S-@-A .మmS` ."R/./-A ".NNNPO-@gN/Bp"aHNmXOB .rNJg8 .RrANz .rNn Kp r/ ra|XOR` .R/p"aXO&H-HJtfBJ,f< f m&Hp2-HR)@t)Ap`Rt KaJf JfBtNm". Gg G f J.g|` Gf@ f m&Hp2-HR)@t)Ap`Rt Ka$JfJfp)@t` GflB l f&0-HR m&Hr)At)@pJg Rt` g( mf p)@t`St KaJg`R` Gf(p2-HR)@t)Ap$,o)@prA` Gg Gfp",t)@t)ApB` Gf$p2-HS)@t)Apl)lprA` Gg GfpB,)@p)@t`-mp @g G gaJgp|`h gdp0/ KCaXOr2-A+g<+g,`&N|N-jp r/ r Ka.NkVXO|`,`Jtf0-H",pm 0-Ho|` ,pol .",tom`pN m&H" WDHH@ KaJfJg,g&NN,p r/ r natNjXO g6g0 ,trAN0N,vp r/ r Ka:NjbXO-K`a6AaL L(N^NuHxHxp"NpPONuNVH.,-HK*U"n Qp-fJg-Sf` n&PJ. gn(g"p(",pA°g`H `BJg8 hNJg. n(g hNJf n(g` p `p S SJgLp:f@ KJfS Sg Sf MRMp>fpPF`pJg`z`S`Sg Sf BapN@pLFN!"n iNJfa`JgaKJg pN!v`apLFN!hN!RJ.gNhL(N^NuNVH.,*.K(U MRMJgpmЀ`p`Ѐ SJg` MRMJgp@F`p&FBp"NapN:K@Jg pN RM`N J.gNh$L N^NuNVH?.NNhR|N]JjV*VN(Y V//-@ "NNxPO)@PJfaxNh Hx/./ "N PO R"R$S&.S//NPOJfNLN^NuNVH7*H&IB. m|-HN B-@NM||ja@a aX -"- ҀS$-&-ւS//"NX KN-@aNgP -"- ҀS$-&-ւSHx//"N -"R$-&RЭ UԭU./ "NNOJg@ab/HzNbaN -"R$-&TЭ UԭU./ "NO `* -"R$-&RЭ UԭU// "NPOHnHnACNhPO m-H nJgaZ n (SghSgdSgSg[g(Sg$UgrZg2`d nJ,gZ h,"n`L nJ,gB h,"n (`4 nJ,g* h,"n (` nJ$g-h$-HN4-@p0Ѯ`XJ.f$~J,gp>< @@`FJ.g@ nJg dlp0Ѯ` n dmJ(g>(p0Ѯ`B.JGf\Jg8NʰlNd.p@gp0N*.B`,B n>(`J,gNb.`N.p0N. @ g@g@g`|`|`N^ ,,* ,0 m|-@-H nJg (o<Шl4 (".o(Шl p0""MIaXJg n>(|p0ѮR`-mJg. nJPgp0N0r2f|`T`J.fX m|-H nJgBp0(Nr2f n (rf" Gd:p0A90g*p nfp0""MIaJg|`p0ѮR`JgN nN$ f nN .NB,jJ.ga p0L(N^NuH*H&I.,Jk(J g" Ы r0N mp0r"MIa `pL(NuNVH7*H&I., +SgSgSgSg$[gSgUgrYgSgp`p@J,g k, Ka m-H nJg lPN 0 lPN BPNu/J,Nga NB,NJJg N 8. lJN lJN BJ N .NuNVH*H&I MJfS. Xrm X", ,`c,R.Y KC쀶p""Q)M)F" UJjR)@N JjR)@ ,"UJjR)@A"naL(N^NuNVH?4*H&I. MJfS, Xrm X"* n ("+$Ԁv ԃc$`Ҁ҃$* ,`c*R,Y"KEbp$$Q nC쁒p""Q)M2 U)@@N 萅)@)E "xU)Ap"UЁ)@Afp`p)@Jg:N2( ,",ҀS$,&,ւS//"N N )@X N p` A"n aL,N^Nu/ *HB B MCa$XO*_NuB /,XA?Ca XONu/ *H)| B MCaXO*_NuH*H. "< Ma L NuH*H. r MaL NuNVH*H.,J,hfJg|GAFp,ɛ-Hf|'F$p!@$`p@!F$B$J+WDHH@ g MCfAC엹NZ gA` MB/.p"Ka` g MNA엹N0N@NLNNNN^NN\N>&N$N.N.NNdNNRNXNQN"NNNNN$NvNN:NNN=,NN,NNNN4NNҰ,jNu%2u %sJ,jWDHHNuJ,jWDHHNupNu,WDHHNupNu,WDHHNu,=NuJ,=WDHHNu,Nu ,NaNu ,~NaNuJ,jf aJgr`r Nu,Nu,mNu,nNu,lNu,6Nu,kNu,Nu,oNu,,NuJ`WDHHNu,gNu,fNu,hNu,eNupNu *dTDHHNu lC[ 1Nu lC[ J1WDHHC[NuNuNV-HN <NON^NuNV-Hp'`gNO|HAN S-@`2 .ԐSl B`B`0.r1Ae"t1҂v9n"҂&r2nr2-A-A nN nNn .Nl .L(N^NuNVH., R-HrAN` R" n/0/HzjNXNGLN^NuNNNVNx~N&N>N NN>paNV/ *Hp fRM`prA90Jg*r:-f"J-gr -fr NJrAa`:p Ma\pOANG*ANG(ACfJfg ACf*_N^Nu.TOS.TTP.PRG PATHPATH=%sNVH*H-@~|,6r*gr#fRM-MpOACN Jo nr gr fR`aaNzNXN0J,6gJgNFNN,A-H-nBCab.NgNJ,6gNFVp l(NnNENN NFVNоg ANp` JjANb L N^NuNVH/4*H&I~~zB fp`p. MN4JWDHH(B.v| JgJJo AvCNE /@ Av"/ "sNF  sJfS Rl~R`Aw"HJfS @vpKA&"MNJg SA&C "qNE`zA&NRfpf`/,HnvHn&BgpK?NAO)@L,N^NuNVH*H&I M"Ka.pfJfp: MN*Jfp,ƺ MNJfAN-@Jg nJgA-H nJg6r;g r,gr fR`A"nd n-IR`A"nc,ƺ)g-IB"MNDxA"Ka&.pgp L(N^NuNNNNNNJDg ,2ADNdNNNuNNuNJfp`pNuNVHJfl)|&l*S g MJfS RѬXK` ,NЎ)@g6&l-@*S g"p= MNJg n-H MRMJfXK` nBL(N^NuNVH*HJgRalJgnp= MNz-@Jg\ MJfS .R N-@Jg< M"@f&lJgj-n-KJgR nfFr=f8 KRKJf l " n"KN(<&nJg" KN" KRKJg`RKR` KRKJg` nJ(g|A Ї,eR r@ҁЁ lN-@f nN`)n r@ҁЁ)@ nJgN nRJg`&n n"KfB3x KN` nN~ nNμ`(-l n&P gp= KN&Jg KNX`L(N^NuNVH*HJg/ HzHnNAaNO `*AN &@ gJg/ HzvNPO` HlNXOL(N^NuH*H.p l"MIaL NuNVH*H.&IJg8p MN-@Jg( MNJg nCfA` M `p,ƺ MN:Jf p: MN.Jg$ MCfpANj-@Jg`A `Z-K nJgLCIaA"MN@pAN0-@A"na-@Jg nCIN@`pL(N^NuH*H.p Ma&@Jfp` KCƥNL(Nu/ *H Ma @CƨN*_Nu/ *H l"MIa*_NuH*H&Ip,ƺ MN4Jf p: MN(Jg `A"KaA"MN?L(NuH*H&IJg RKp;g`,ƺ-gB L(NuH*H&I MN>.Jg,ƺg M"lƼN? M"KN?L(NuNVlƺpOAN?AN? @CfJfgACfp@+@*N^NuH.,*/*Hc(.,Jfzc N&@ g* ``pL(NuH. Nr,Jf AN`B,)p@+@* LNuNN~NjTN|NN2NLN`NNNNptN lh@p l(SN lC f lhQ5|. lJ(bghb lCN< lCN,p l(dNJ.f. lN,ƺ-@ @fR nJfp@p l(drPNChp. IN l"Hj)Q, ln)P0a l"Hr,pc)FJ l"Hv|<c)FN l"Hx|<c)F4p l(|)@~ l"H Qdp@Ѐ`Cp0)@2JDg lDNx ,2NǠ)@DBH lzp0)@lp l(N lh lhB .rlA["lR`p l()@rrc`e)Ar lh,p@$ lhX lJ(WDHHAirA@@@ l(3B:J(3WDHHB A@@J4gp l4(d)@Np l4(e)@ l4hgR l4J(jWDHH@@p l4(n-@rg rgp`p-@Jg Jg ",dt*eJf *deNBp l(NRp` KN~VJgAN}pL(N^NuNVH-HJ,HgHzHnAC)NPOJfH`tpOACN.plA)N}pOAN~.pgDJfa`:ACNpAN**@ fHnHlN}b`p MaJgazL N^NuH l"Hz:) JgP*H>JGgF|pl, Ѐr25 fr2҆ҁAC;R`p0r MN`L NuA잮N|alpf lJ(?WDHH`p,jr NpNXJg4a4pf lJ(?WDHH`p,jr NpNXNu/ l(>Jfp?`p)@`hNkNNN$NlNpaNVP/-HPpOAPCN.plALNzVpOAN{B.pmpOAPC`Nš.plAdNz$pOA`N{.pmZB,N^Jf A?N `DNprAC`NbNAXCTNN5 .TR".XAN{2N5:N5N~.N^NuNVLH4-HLpOALCN.plBANypOANzt.JkJf$pATN*-@Pg @CfAN.KpOALC`N.plb l"H(JQg p0$H`E4-JPC`f lJ(Pg0A쯇NxpOA`Ny.Jk*Jf nPC`fA`NG`Jg p M"KNL,N^NuNVLH4-HLpOALCN.plA NxpOANyz.pmKpOALC`N.plb l"H(JQg p0$H`E4-JPC`f lJ(Pg0A쯇Nx&pOA`Ny.Jk*Jf nPC`fA`NG`Jg p M"KNL,N^Nu/ *Hp MN*_Nu/ *Hp MN*_NuNVH*H&I.Jg M"Ka.Jg2 KN#6pN nR` M"Ka"Jg KN#pN nRpL(N^NuNVH *H&IBJgpAJ0gr*fNRMJfp`pN&(r/@ N&"/ gpAJ0fp`zRK` MSHRMRK-H`r?g2r N%r/@ N%"/ gJg*n``p`.RMRK`TpA0Jgp*fJ-gp`pL(N^NuNVH*H&I-M~|A"KN!~G nJgp?fR-Hr*gR`|d` KJfS˱dp`pdl KJfS"MJfSͱgp`jAalJgFr?gr*fp`LpN$r/@ N$"/fRMRK` SJfp`RK`Jgr?g r*gp`pL(N^NuH/*H~ MJfS;dJ5x*,R MJfSͼd$p5hrA0A0c(*R`xXxR`L NuH/*H~ MJfS;dJ5x*,R MJfSͼd$p5hrA0A0d(*R`xXxR`L NuNpa l"HWIprGҁf YHpfNtNu*.*%s%.41s %s%lu ? %s%6lu%s%6lu%u %s %lu NV-HaN^NuNVH-HKB,J,HgN "ACNN/,HzNӄ .".NkdNjPOR`J,f*Jf*A]Ni n (", lN zRf`:J,f4Jg lX"KNiBX` Jg nNiB n"MNiBJ,g lSHpNENi`PJg JXg8 lXNiHl pA?NA\ONEJ`Jg nNiHl pA?NA\ONE*Jg nNipNp N/,HlHzN~.HlHz|Nh.HlHzlNh.Hl.Hz\NhO$J,gALNhpL,N^NuNVH*H.<<zxpfx~Jg MaNiA"UNACJf UN)@>A"HJfSȳgx U"Hr f8r)CJ1g("Hr)CJ1fpCJIN#T>xA쬭NhNp2AJN-@NβpgAJ"HJfS)IB >)@Fp Ma Ma:`AJ"HJfS)IB" )AFp Ma MaJgJf mCNJfAlNgTA엹N,N8, Fgnp0r,ɛfH UNJf UNJfr`rAXMJg$ UCNJfp Ma0J.g*fR`pcHl/HznNfO L N^NuNVH4*H.|Jgh UpNtJg| URHpNbJg|AJCf JgSgSg`*AN!t` ANd`p.Nf@ANLJ,g& ,FJob UNgH`HJjDD UNf`: ,ЬF",JRb U"HB ,>$H",༒R  I"JNJgA`AJCJ$IJfS "UINr ,FѬѬJg&|&lJg S"lfg c ,FѓXK`RL,N^NuNuH/*H&UJ,g"p +gSK`p+g:UKp +g0SK`SKr fSKr fTKr g rpEЀfRKNf~pldzfNezpfprGҁf KNL&@`pNJfpNdJg`prIҁf|-`zprHҁg prnFf| `^prlFf|`NpNJg`>pr`Ff2|`.p fr gtpEЀfRK`pgxp grJgRpA0Jg8p'f2p+AJ0g r Nrsfp+AJ0fxJfN̲zp f pa:`pN̤`JgŇpgNp N̈R`L(NuJ,g0 ,ЀЬJjV)@RNdN)@^ @R)H`, ,JNd6)@^",J @"H)I)AR"@)I)I)@JVDHHNuJ^g l^NcB^NuH l)Hpf)Hp=f~0pAJ0gpAdpA90gP l)Hpf )HprGҁgpNJg"`pAJ0fpA90g`p f lp g prEҁf)Hpfp`NJg2p lNz&@ g)K`& l)Hp gpg pfR`S lrfp`jpfp`^S*l l)Hpf")HprGҁf N,)@`S`pAJ0fS ," r2n| L(NuH*H&Ipf&prGҁf MN*@`pNJgP`pAJ0g@p'f.pAJ0g,r N4rsfp-AJ0g p KNab`L(NuH*H&I U"SN L(Nu/ *HJg MNpp*_NuNVH*H&I U*&L(N^NuH*H MCƥNa<&@ fAa L(Nu/./Hz4N`POpfA|`A쯁N`ANX.NuH*H. SJg JfRM`L Nu/ AnN`Ha*@ g( l )Hıe A쫼a2p`N`rJgp` lBp*_NuH.|] N`*@B,] L NuH.,|] "N*@B,] L Nu/. aNJf Na..NuH.N, Ї"N`<"N,p?oN`` N`LNuN4NNQN&ZNƲNNNrN&NN3BNNNQNPN @gnN Jgf lN7l-@` nN7(*@pfp=-fJf<` MN Jgp -fSM`p -f-M`Z MN Jg-M`HBJgZJfV ,r N[JfHN VJ,dgp"N\ANÄB,dA쮉Nx` .rN[/,HzNN N6PONZJf: n-Hpf2-Hp=fz0`>prGҁf`pN JgR`pAJ0gpAdp gpA90g0 n-HpAJ0fpA90fS`dp f\Nu"Jf N PN`NJg&p lN*@Jg M` nN5 @-H`-l` nN5r-@NA"na|-@fr2nh naJfZ nNJfL nNJf>Jg nNJf, naG=A"HJfS KJfS "Ё",U^cGOA"HJfS KJfS "Ё",U^cACkf`Hn/ HzHnkNsOAk)HNr op`p)@A쌸N-@^N4N" .^r2 A4Nr2Hb fN4`N2 .bNXJg0SgSgBSgr g`NLAN`N4l`N4ANJfN4R`NN3-@ @aNpAN: ,Jo",Hbtmnp3NA"HJfS-IZ na".Z-A na| nNW@ .Z nNX`-@ .br3NA .Z"n`SdJf nZNX2N3N3NZNB,IN6N3-@Jf N3f`&Jf" 2foAU`A쮚NRpdNNJJg n-Hpf-HprGҁfV`pAJ0gFp-f nr fp(rEҁfNqJf NNF`( lNW @NB-@` nN2@-@R`b .L,N^Nu/ *H MNW8NB,INHN2,*@ Ma|dNv*_NuH'*H&M ,풐8,NW&*NpfprGҁf~-`pAJ0g RnpNnp-ffr f^r+tEԂfPTKJf KN1 @C IN KNZ&@ KNVx ,풐8,pl, SNN ,"RN1p'fRp+AJ0g$r Nrsf0p+AJ0fNV MNVNVL(NuH*H&I~pfprGҁf( KN&@`pAJ0g GR p2m5xp'fS`psgpSf p'5xfUB5x L(NuH*Hpf&prGҁf MN*@`pNzJgN`pAJ0g>p'f.pAJ0g*r N rsfp-AJ0g pN`L NuH*H&Mpf"prGҁf MN"*@` " U`JpAJ0g4p'fpAJ0g r Nrsfp-AJ0f " SL(NuNVH'*H&IB][p.~A0r.|A0t'gfrAAf>pAJ0g r Nrsf p-AJ0f|SM~| p'.f>pAJ0g r Nrsf p+AJ0fpSK|| @J.gJ.g .`LJ.gJgp`< .`4J.gJgp`$ .`JgDJg@ f p.N0r./@ N "/*JgJf-E`p.f4prGҁf(RMp fp-rEҁf AN*@]`|p.f6prGҁf*RKp fp+rEҁf AN&@@`>p.AJ0gp`Dp.AJ0gp`0p-r+tA0pA0.Jg ` .L(N^NuN/N&N N&N%N6NǾN=NN%NN$@NNNXVN?"NN&NNL NGNNBNNMN=N7NVH'.-HB.ANaVJgFACƥNP*@ g4G KpF"MNPJ MNPnJgr gr f B`RK`zlT A"HJfS" tF/@ "n"/"qN FA"HJfS rF CN &R`A"HJfS, Jgpg-HpPACN`Jo.r/gr-f^A-Hp.NOr@A4g$AgSAgSAg[AgpUAgSAgSAg]AgB[Ag`|6`~AC,NNJglAC0NNJf)l,0NӬ`NACNOVJg<)nJ`2ACNO:Jg )nN`N `ACNOJg )n4`)|4` nCƥNN)@$` nC fA C~N_,pA NJg|`p)@~` nr0fp')@`` ,8rlt/@AN .A"/!gVR8`NL(N^Nu cfgoptkey$.TMP$X$..1991%s NVH.|h-HNhNNap@@@c@d@9@:@e@f@g@@@@@@@@…@e@c@9A`NANANNNF)|4p)@,)@0ACfAC$N]ACfACN]ACsfAsCN]ACfACNACfACN]nANɮJg|  naJ,fAad lN~Jg lNnJfA$a< lCtNǴ lCINpp@t@s@raJ,6fN J,6fNpAsNŔ*@ g MN7nNNN|NJ,f|Ny`JjV 'l <'`Nzy`JjV o <`4NXy`JjV 'l <'`N6y`JjV)@,J0f)l,0N.prN*A\CDp|""Qp",,NJfAa )l,|-AN JfF|8lF A&p RrNJg/ HlNJ KNNprNPO Ka2R`prNB,- lJ(gJ$fCp IN>)@$AvNp)@N"AN|Jgz`zB,+J$fJ,@f|+NNlNp//prNJPOJgpNr ,>NJhpNI`N(N&4za`H*H~ lNJd lNJ\ lNJTJDg lDNJFJg lNJ8NNNN g Jg MNI~ NfL NuNVH4 ,dЀrNJL.TNN$p//prNI UrANJN*NPOJ,)flƺpOAN$AN"|)K MJfSC$IJfS ",`p;cH MJfS$IJfS ",` r;ЁAp,ƺNZT @KACf`B.A"MNA"HJfSA$HJfS ",`p;cA`A&H lpP`pS,NI/Hxp"NHN.Hz/,HlNOp'`g*pJgA컌`AHn/ //Hl[NxONN.p NL,N^NuNVH#aPANp@(@*@hJ,*fN2Ndp l(N NG\p@+@H@LJ,IgNNHnHnACN`ACNҜp./prNGO JfU .Jjr-A .".NHNHNX"Jg"N,p@gpf|` N`p@J,gNWnrAЁr NpPFNN.NpFANG.N$J,g < Np@*`pf |*`NnNJ,gNG,r*gt#fA`A*Hg*r#g$AC5NJf@AC7,NJf. MJfS r|cHlHzNF PO` JgANxB,0`DL N^NuH.< n A8NG"R`K Jg MN5 MRMJg`L Nu/~LFpmЀn8 r Ah rNF r A rNER`.Nu/ *H MNE*_NuN~N 8N8N#N`NrNBNNHN.N0NN$NNN̾NpNN<^NaN`NjNHNNͪN#LN=N(*NXNmNONN?2NЂN͖NONhNTMenusMENUSText handlingTEXTFile handlingFILEFilenamesNAMESBlock operationsBLOCKPrintingPRINTBackground printingBACKPrinter driversPPDMacros and exec filesMACROSDictionary commandsDCTThe quick dictionaryQIKThe user word fileUWFThe search pathPATHExternal commandsEXTERNALSundry commandsSUNDRYNamed subject ...Load file ...Catalogue files ...Save fileSave as ...ASCII save ...Merge file ...Name documentSwap files:^Y-Create new documentClear textSpool to fileClose spool fileSplit fileRun CONVERT programCommand Mode:ESCDesktop menuQuit ProtextAcute:a'Circumflex:a^Diaeresis:a"Grave:a\Ring:a%Tilde:a~AccentsChoose character ...Add accent to letter:>Find text ...Replace text ...Next find:f6Previous find:f5Swap characters:^ALower case letter:^\Lower case word:s^\Upper case letter:^/Upper case word:s^/Count words in textSet Marker:^ZClear Markers:^KMove Block:^MCopy Block:F10Delete Block:^DELUndelete Block:^UCopy other Block:^OSave BlockCount BlockFormat BlockFix BlockNumber lines in Block ...Remove numbers in Blockto start of text:^[to end of text:^]to previous page:^(to next page:^)to previous paragraph:^<to next paragraph:^>to start of sentence:s^to end of sentence:s^to start of line:^to end of line:^to previous marker:^f5to next marker:^f6Goto line/page/col ...:^GLast position:^LInsert line:^IDelete line:^f3Delete to start of line:^DELDelete to end of line:^EDelete to start sentence:s^DELDelete to end sentence:s^ESplit line:^*Join lines:^+Add line numbers ...Remove line numbersCentre Line:^CIndent paragraph:aTABFormat paragraph:s^FFormat to end of para:^FFormat textFix textDefault ruler:^DCopy previous ruler:^RSoft hyphen:^-Footnote marker:^@FMultiple marker:^@?Non break hyphen:^N-Non break space:^NInsert Date:aDInsert Time:aTCalculate expressionPrint text ...Print a file ...Print block ...TypewriterLoad Printer Driver ...Pause printingResume printingAbandon printingEcho screen to printerCancel echo to printerCheck from cursor:^SSingle word:^QSet ignore marker:a=Check whole textCheck current blockCheck a file ...Lookup wordList dictionaryFind wordsAnagramsMake dictionaryCount dictionaryJoin dictionariesBuild word fileInsert wordsDelete wordsBold:aBCondensed:^XCElite:^XEItalics:aIEnlarged:^XLNormal (pica):^XNProportional:^XPQuality:^XQSubscript:^XSSuperscript:^XTUnderline:aUDefine macro:^f1End definition:^f1Load macrosSave macrosList macrosClear macrosMacroView Codes:^VVView Spaces:^VSView Tabs/CRs:^VTView Ruler:^VRView Page breaks:^VPView OptionsDocument modeView Options:>Macro menu:>Auto Reformat:s^RWord Wrap:^WRight Justify:^JOverwrite Mode:^TABTyping check:s^SPage Mode:^PAuto Indent:s^IBox Mode:^BLine drawing:^f725/50 line switch:aFEdit configurationLoad new configurationRestore default configurationFileTextBlockMoveLineSundryPrintSpellStyleOptionHelp Continue Yes No Print Skip Abort Retry Find string Replace string Word Global All ignore Spaces Backwards Case specific Number Marked block GO cancelFIND AND REPLACEReplace and continue (Y)Replace and stop (X)Skip and continue (N)Cancel Store Ignore Change Lookup SKip Line Column PageGO TO LINE/COLUMN/PAGE First number Increment OKNUMBER LINES PRINTING OPTIONS Printer: Destination: PrinterScreenFilename: Options: nlQSIngle SheetContinuousWhich pages?ALlOddEVenStart At page: Number of copies: End at page: GOAbandonedMondayTuesdayWednesdayThursdayFridaySaturdaySundaySTIBMMM6ptFAaHpFЀAa)lNN`xa *N3.,, ,a*Jg8a la*@p g$Jfp-NJf ,"N Ma`ptFAa pFЀAa N N1L NuaJfANLNuNV/aN(J,og a ,N0`fazN1ACa(Jf( lUH .U nTH N1|N b` .T nN0B,N N 6NBfN.N^NuNVH $ACPNBBN1pAN:JgXpN0*@||a8NpN1pFN *@ gp MN0lAN6HnpA?NA\ON raL$N^NuNVH*H&I. M"Ka4,NK-@ , aTJg `(Jf ` nc "STIe ` ANKpL(N^NuNVHavNNAJ,og a ZN`N0N pACafJg ..Tb0 N/*@ nb߮  n"M`Sd  nN `\ N0<&@ gF  n"K`SdNJ*@ nd N  MN0V*@  K"M`Sd KN/` aB`aACN?N.NpAN8Jg0aNDAN46HnpA?NA\ON a:N$N N?DNL,N^NuNVH'$N|pN N-ACa,pN Jg ..UJg*b$ N-*@ nTH "M`Sd  MN `@ACN>pN xpAN7P*pN fJg$AN3rHnpA?NA\ON N N N PNL$N^Nu ,~aJgN>J,Wga`a"`ANHPNuH ,aJfJ,BfNJ,g , aJfG`J,Bg ,aJfG:`G: KCp""Q la *@p g MN-|`NGJfL(Nu/ *Hp[@gQ@f" `"p-@gS@f ` MNG*@`RM`*_NuNVH*H&I ,aHJgp`2ptFav*fp`"pFЀaf&fp` S"Uc&*-HpL(N^NuH#ptFNN,)l)@pFЀNN,",HH$,c .)G)A",c ,)F)@pLNuHN,f.,,aJgh ,N+ la*@p g MaT Ma*@p g Ma@ ,NpFЀNv ,NtptFNf ,gNFLJfN2 N+D NJB,>L NuNVH.N+,*,B.a*lx MaV*@p gRpf>p-rtFf0g MagJ.f| MN:*@`gg`B. MNv&@p+rMҁf Nz*l`zp+g8TKJf ,R@r g[fprFҁf|`p@J.g Ma`*TMpFЀAax`J.g ptFAabJg NEJf N* NL(N^NupaNNu/,oWDHH@oNJg avJga` ajJga.NuNVH.,ptF"a*pFЀ"a@ptF"a(pFЀ"a@f.gJJg Jga`NuJ,lgp,ɜANr2p,ɛf paB,>Nup,ɜA4N\r2p,ɛf pa`B,>NuHJ,lgp,ɜAN*r2p,ɛf6pN .,,,a, N% N&(pNpa"aN,NLNuHJf <'N&V)@fA?N@ap,)@ la*@p gAa &@p f AYN@`R " .U І 'eAMN@ lC `Sd܇ KNB&@ FR"l   FRp+rEҁgr N@ @a@p@+@*NҤN#dNu%08lX %02X ? %f &%lX %%%s %f%.*f%u %02u:%02u:%02u%02u-%02u-%04u%04u-%02u-%02ukey*.KEY^766^MM^13^onoff%s KEY %3d%s "%4s %03d, %c%u%c%s%s%s%u %s %s %s %dPANIC %u laDNuNVH -H nJg ACN]0| "le Hzp&?NN\OLN^NuNVH'*H~|zN"p//prN"vN#DPOrLmPN#N! MaF g4Jg r<Ё` ЀІt^DHHЁr ЁrN#N". r g\gSgSgSg.`V Ma` Ma`Sl| Ma`~Rpot| Ma`dJWDHH*`T gJJg, r Ny2 h Rpo*| Mab`pFnA90xg N۶pAN . g .h Rpo| Ma`L N^NuH*Hp"N"~pl/ Hz4NxPOpfN!>|pl"p5h/HzNxPOpfp NxbR`p NxX|pl 5hpcp`p.r Nx4R`pfN!0N,plp NxR`hL Nu/.pe a rr0Ёr Nw.NuNVH*HB.JgpFA"MN0(B.NdJ.fAVNpFAN |J.gA-HHnAN:XO&@J.f^ +"+//HzHnHN:p.AN0O-@g @ANLN[./HzNw6 aPOB.`VL(N^NuNVH*HpFA"MN/XB.NJfAwNpFAN,pmA-HHnAN:(XO-@J.f @ ("(//HlHzJHnHN9p.AN/O&@ gANFA쟜N>N. gdp f~0pFnNA90xgBp0/././HzHnN9`p.AN/O&@ gAN|*`JgL(N^NuH.N9>*@p[@g Y@g:Y@gn`p-@ g&@gY@fp MNn `Jfb MN8*@` MNNv,  M"lN* MNx  MN^*@ SJg `N8JgNJf*lSMRM`dL NuH.,,*,NpN8xJ,HgAFN8Xpa" ND Np@+@*NLNuNV-HpaN^NuNV-HpaN^Nu/ *Hp MaN*_Nu/ *Hp Ma>*_NuNV/.GB.Aa.N^NuNV/.GB.Aa.N^NuNVH.-H-l-lp@@@pACN-,JopACN-,JopACN-v,.JfANpANJkp.NX*J,Hg,pAf&p )@l)@hANj gN`p@Ag @gp`.JfANjpANVJk|.JfANJpAN6Jk\J.g AN`p )@hJ.g AN`p )@lpN6N6 @NB*@B.J.fpAf8/,hHzHnN6>, NO *@ A"M`Sd ,lѬh`:pA90g*|p5hA90gR`p 5hfR  MN^B.J.fvJ.fnp[@gQ@g$`VJgp-rFҁf| MN5*@`NJg lN5N5~JWDHHAfN*l|`RM` .NX .Np@+@*L N^NuNVH*H&I-MACNXJfp`& nJgpC91fR`ACN Jfp`H n nJgpC91fR`ACNJf n B` n pL(N^NuNVH3$*Hp,?NATO~>p-@,Jg&HnHn MCa"POJfA;N`AN r$v?ă"vƒҁ///HzNpOpcA;NANpAN,pe r-@ r-@ r-@A왹NNSJg$SgSg6`L/././.HzNoO`2/././.HzNoO`/././.HzNoO|JoA.NfAN^NS:JgSgSg`ANo``ANoV`ANoLpAN,pmXHnHnACNPPOJg |a`6p(o0p]l*rB^DHHJg|sJg U` rЁ@NN Jf gV-K|p n0 gTr"Af|` JgA`A//Hzr/ N O-g`8 /HnHz^Ne6O K"Ma$ g Hz>/ N ZPOR`NL(N^NuNVH*H&I>p0 gp@g.p @g(p @g"p@gp@gp @gJGg Gbp^@f6p0r^///HzHnN'O g A"KN `ANdr` gp0 KN `v r NdL`fL(N^NuH*H.JgAe`Ah// HzrN O L NuH*H.// HzZN O L NuNVH -HHlHz>N N POJfHlHlHz&NcAN O ~plD l"H ЀJqg0p0Jg pN l"H Ѐp0NctR` lJ(gC/ HlGHzN DO A9N , l"H(JQfCp0$H` C(p0$H JNcp l(,AWa lJ(~gHAuN l(~Ugp(~SJjR/Hz8NbPO l(~fpTFNb`p(-AuaN Jfp l(.A졓atp l(/A족abp l(0AaPp l(1Aa>p l(2A a,N xJf&p l(3A)ap l(4AGap l(5Aeap l(6A좃ap l(7A좡aN Jf lpC["1Aazp,A좿al l/HlHzN HlHlHzN zN OJfhHl HlHzN ^ ,ЬA7aF ,JAUa: ,NAsa.N zO Jf$ ,2Aa ,|A죑a ,A죯aLN^NuNVH-HNA줠Np'`fN HN HN.p@gNp0r2/@/A N Zr2/////HlN`O Ge* Gb$p0A|*p gHlNr MaXO GfpL N^NuNV-HACNJfp-@ cp-@S .N .rPNC lChp INJf pApNN^NuNV-HACNlJfp-@ cp-@S .VN .rPNC< lCXp INJf pANzN^NuNV/-HpACN.JjA4NTpAN@Jk AC f.N^NuNV/-Hp-@r-A.p@ЀlAN-xR`|>N| B, nJgz nr gr,fR` nJgr*fRACNPJf<``ACN>JgJg .r@ҁdAM!`ANxp`( .Ѯ .r@ҁdrg AM!`p.N^NuH*HN!&@ MaJgp@+@*p,jN| KN0L(NuNVH-HpN6*@NX g"~ SJgpNJfN*JgL N^NuNVlH*HN .J,pKAN*.pmA`CNJfNNVNpN8NNPNdNN`N:N3N7NNN;Nz^Nz8N"NN,N(NNNNNNN NN.paNVH*H M-HNJghN Np nN-@N:NJgN`@Jf J, g nNx @Jf nC N MCƥN&@ g KNXp`pL(N^Nu$M$$T$*.*NVH*H l"HG[-IJg:pA"KN6B.p ANB-@g @B MCNJgp`JVK` nJgfp`( SJgp fp+rEҁfp`RK`,jL(N^NuNVH*H&I lCIN < lN A"@NA"KNTJfp`J KaWgSg`p`6p`2 g Ma@`& KCƥN*@ g Ma(. MN `,jL(N^NuJ,pg$p,ɜAFNr2p,ɛgp`NpNuH*H,RB,R Ma GRL NuNVH-HKJ,HfJaJfjpOACN Z.JnANpOAN.Jk>JgAN ZJgK` gA"MN Jga@Jf AaN PL N^NuNVH*HaJf MaJg MCN AN ".pfHnHlN4`GDA\g8J+^g2A^CNSJf" ,Ь["RmNAN X`Ca@jNJp`AaAap:-gp,NpL,N^NuNVH#4*H-@N MCfAN &@A"KfANp,?NATO=@Tp*?NATO=@VA\CTNNV*@`L,NN N@N:N~NNN&2NNN@NTNFNNNBNNbNNN7NpNvNvNNp6NNFN:Np0N"Nrpa/ *HpA"Ma*_NuLOADLSAVESCLEARFINDFREPLACERFINDBFBREPLACEBRBPMPRINTPMERGEMGOTOGSAVEBSBPRINTBPBTABCALCCASWAPSWNUMBERNUMNUMBERBNUMBABANDONABLOADCFGLCFGPRINTERPR?COUNTCTCOUNTBCTBDOCPROGFIXFIXBSAVEASASAVEABSABPRINTSPSPRINTSBPSBPRINTQPQPRINTQBPQBPRINTPPPPRINTPQPPQPRINTFPFPRINTFBPFBPRINTPSPPSFORMATFTFORMATBFTBMMQUITQSPLITSPLSPELLSCSPELLBSCBMAKEDMKDJOINDJDLOOKUPLKBUILDBUINSWORDSIWDELWORDSDWFINDWFWANAGRAMANLISTDLDCOUNTDCODTYPEWRITERTWSTATUSSTATHELPHNAMENEXTCODEPAUSEMACROKEYPHRASELMACROSLMLPHRASESLPCLEARKEYSCLRKSAVEKEYSSVKLOADKEYSLDKTYPETACCESSACCPROTECTPROTCHDIRCDEXECXEXECSXSSTOPSTCONTCOBACKLANGKEYBSPOOLSPONSPOOLOFFSPOFFPRINTONPRONPRINTOFFPROFFPANICCONFIGCFGFSORTCONVERTCVQWXCLECHOFFSYMBOLSYMTOUCHDATETIMEINKPATHSETA:AB:BC:CD:DE:EDRIVEDRPARALLELPARSERIALSERCATALOGCATERASEDELERARENAMERENMKDIRMDRMDIRRDDIRCOPYUPDATEUPKEYDEFGAUSSGALOISGDELCLS '%s' onoff/ *HpA"MaH*_Nu/ *HJgp,6A"Ma,`$p,6ACaJfpANN*_NuNVH*H&I-@Np MNv-@f M-H nCfAC`Nx\A"KNxRpANb.JjANw L(N^NuNVH-HNw~pl2 NJg$p,ɜA짶N&r2p,ɛf N R`J,g.p,ɜA5N, Fgp0r,ɛfA췘NhJ,pg p,ɜAFNr2p,ɛf\NJ,Xg6A[NvpJ,gHlHzrN@PPOA엹N@4NZr2p,ɛfN~pN,NtpN"ANLN^NuNVH*HJg&M`ANvpANvJkG|* KN8L(N^NuH.Gjp@B@NNp>fN,,pNv Nvp@+@*LNuNV-HJ,jfpaN^NuNV-HJ,jgpaN^Nu/ *H MCvN?*Jf|` MCdN?JfB,*_NuNV-HNv` fN2N^NuNV-Hp N2N^NuN*NjNNNN&N)dNNNiNN$N*$N&NNN/ *HprAa"*_Nu%lu %s/ *HprAa*_NuNVH.,zB.-l-lpN,pNJ,HgA:NlN*@ MNtZJgp MN&@ g*K` MNt*@J.fp[@gQ@g&`Jgp-rFҁf| MN*@`NJg lNNJWDHHAJg , NJgp@J.f*l MNsJgzp MNv-@Jg*@`d MNs*@`XpAJ0grAdrA90g(pAJ0frA90gRM`R` RM` .Nsn .NrNPHlw/HzdHnNANsNL(N^NuN-NNNRNNN9NtNVH4*H&I)KtB,_ <N)@NJgt @C)UJr)@V)@R)A`)IZ a @-@J,_f> @a)@pJg0 @JPf"hE`fC`!I lpCx"""Ax)Hp lNNd`A?a ,_ nUg ,`ѕ ,pL,N^NuINNOTINROUND%.*f/.p fp` r WDHH.Nu/.pe r%SDHH.Nu/ J,_gp`*lVpѬV lVZeACa *_NuH.*Ha&@J,_gp`&A "M L(NuNVH.*H&Ia-@J,_gp` n !M!K L(N^Nu)l8`NuH)l`8J,_f l`R`"lJ q^p,^aJfp,^J@g@ g@gS@gS@g*S@gS@gbS@gS@gS@gS@gS@g\S@gDS@gS@gDU@gT@ gS@gS@gS@gFS@g S@gn@=gHU@gl`p)@4`8p)@4`.p)@4`$p)@4`p)@4 l`R`"lJ 1@^r=gS`` l`R`"lJ 1r@^A+f p)@4`S`Ava ` l`R`"lJ 1@^r&f p)@4`S` l`R`"lJ 1r@^A90gS`aRp4)@4`RAZa P`F l`R`"lJ 1@^r0gr1fS`ap4)@4`A첤a ` l`R`"lJ 1@^r|gS`p)@4` l`R`"lJ 1@^r=f p)@4`p)@4S`` l`R`"lJ 1r@^A l6@0;N&****&&&&&&*****&*&&p`p.NuH*H0J@gS@gp`n mJfBB:`X ma Jf Apap`B: mC`f,r.gr A`Nt&@ g.A`NVHpL(NuH*H0J@gHS@fDBU0-H/-/-/HzHl`N. RaO&@Jfp`A`"Kf+KpL(NuNVH14*Ha-@gp r4gSgSfA "n"""`H ma&@Jg@ n01k rgYg6`X KaJgLNJWDHH NF nH` KaJgLN. nH` ma@-@g @2(4+AoH`H$ n1B Sm "l@0;N|BBB||||||BBBB``B KaJg2 naJf` Ka:Jg na,Jf|`JSf kaJg nJPf( haJf KaJg naJf<` KaVJg naHJf ` KaJg naJf` Sm~ "lt@0;NB"fFf&\fBf<fffffffffffff`JSfv kJfS$n"jJfS " Ё. c A첈a` Ra-@g k"@f n$n"jNb nBP!n`L nL N nH`L nL N nH`hL nL N nH`F n (㈀f Aa`0L nL N nH` nL$<@4vN.l n ("(` "tvNm. nL$<@4vN l n ("(` "$& "N/+/+aPO nH`JSf. k$n"jaJWDHH N nH`PL nL N xWDHHN ~ nH`"JSf. k$n"jaLJVDHH N L nH`L nL N VDHHN  nH`JSf. k$n"jaJ[DHH N nH`L nL N ]DHHN nH`bJSf. k$n"jaJ_DHH N nH`0L nL N X_DHHN ^ nH`JSf. k$n"ja,J^DHH N , nH`L nL N ^DHHN nH`JSf. k$n"jaJZDHH N nH`pL nL N \DHHN nH`BLN /@ nLN "/ N h nH` LN /@ nLN n"/ N 2 nH`LN JJg nLN 8Jgr`r N nH`LN Jf nLN Jfr`r N nH`b"n i"ka<-@fr` nR" N nH`*"n i"kaJWDHH N Z nH .`pL,N^NuNV/./. /./HzHnNAN 8..N^NuNVH/*H&Ix@AfJf$`t `xJ.fp`npNΤr./@ NΔ"/*p.~A0p.|A0gJgJf ` `JfJg ` Jft(`nL(N^NuNVH*H&I KJfS.Jg8Jg4pNr/@ N"/ f  K"MN Jf `RM`pL(N^NuNVH*I&n-H~ nN/-@ @pNͬ,pWf~RACaJfAa< n,fRp nC91gR` nN/&-@ @-np:fRRp-@ACaB n,fRp nC91gR` nN.-@ @p]gA처aRJfB`Jg. . Ma-@ . Ma-@ naJg0R` . Ma-@ . Ma-@ @JgNR-@ .*Jjz  n"K`SdB3XL(N^NuH*H~|r-gr+fRMpA90f,f,fJf~`|RM`JgJfp`pL NuH*H&I~ UN-*r- @f~R M"Ka,JgJgD L(NuH*H.JoJJg MaJf MNj*@`Sg*Jg& MaJgRM`Jg MaJf MN<*@` `R&MJgRM` RJj:b `8 MNX*@Jg Ma~Jgb ` MNXx*@ MadJf` MNL(NuH*H.JoSg,Jg( MN*@`&MJgRM`b ` MNX(*@Rm L(NuNVH'*H&I U-HN,z @r-@A90gNp.r0 nRHN.* @r-@A90g r NbrЁ.r0`*&p`p&gp#fvz~R nN- @r-@A90g>z r/@A90g rt0`r Nr7" /Ё.` n*Jg& `*pL(N^Nu/ *HpJ@g@ g@g @ gU@fp`p*_NuNVH*H&I.z UpCJ1g Adp`: Upa8Jg$Snp`" ERp/HN2"/R`B3X L(N^Nu/.prA90Jf*p_g$p.gp?gpAJ0gpAdp`p.NuH*H&I/ "MaXONL(NuNVH'*H&I nB fp-@-@-@` HnHn MCaPOJf nHnHn KCaPOJfp n nJgp`/. .".Nh./@ .".NTXO"/. .".첀gbot`t*$ "<mNހ . l or N JgR .Ѕ, .谆g NJgR܅` L(N^NuNVH'4*H&Iz nB-MACNUJf`f&p nCJ1g rAeR` nJg*pC91frCJ1grAdR`ACNU8Jf8z|pl(p nCJ1grAe"FR" R`B6h` n nJgpC91fR`ACNTJf` n JgB.|p l. Aɞ pCaJf R n |`R`J.fL|p lD A"HJfS/@ Eɞ"/"rIN,Jf R n |`R`J.f6|p l. Ał pCaJf R n |`R`J.f,`NJg SgSg`. n& ` . n & n rdll n r nhUf n NJgp`p-@` "AŲ$0-B n0 n " ft nf totm np`pL,N^NuNNNNfNNNNNNNN N"N.N\NhNNNV/ *H-I nN&JgAj < "nIN'`rB.pPACa na~-@p nN(fJgRJJg lJNap nNQrafAƫ`AƨCINa)@JfNI*_N^Nu%s? SYS_TIMESYS_DATESYS_LDATESYS_DAYSYS_MONTH%02uSYS_DOCSYS_PROGSYS_LANGSYS_VERSYS_OSVER%1u.%u%u STSYS_PAGE%u%.*f%s = %s NVHJJg lJN`BJN^Nu/. lC J1g C`AB0.NuR mANH lC B1 lC 1NuNV/ *I-HaJg Mar a*_N^NuNV/-H-IaJgH nN$j-@pV m"Ka < U"Ka/HzNIPOJ-fp"Nd KNdJ-fp"NR*m`L(NuNV HNH|HlnHzVNI^ lCaN^NuNV/H.<'JgA"NAJzfHJzf" e NY)@z [)@`Jzf ,ZN=)@z)lz~)lvR.N^NuNV/ *I-HJfA;NA MaJgS lzNX)HzB,` )lz~|*_N^NuNVHaJgaTJWDHHpa|N^Nu|DpNu/.)GF.NuHJ,Dgp`.,Fp)@Fg ` l8NH^. Rg Sg [g[gDWgDr g gn`ha`l l8NH*.pfa`X r NGJf Z`@p `< l8NG,p gpEЀf ` pgpfa8` a: `pFLNuNV/J@gH l@a)@@pOA@Ca.Jo(ACƥNW&)@8fN?p@Dr)AFp`p.N^Nu/J8gJ,Dgp`&a.pg ap` l8NVB8an.Nu/a. r grggg .NuNV/ *I-Hp Ma"*_N^NuNV/ *I-Hp Ma*_N^NuNVH?.-HJ8fAtN>aFJfA웊N> nNt-@p na -@BB.a2*pgp fdJfHnBBpACaO nr gNr;gFp na *-@`x r NJg(aD*f,a*p,fa*p gpg a `pgp gJkpFoA"HRAR  m` aB.J.fra* Rg$rgrf a*p g pg ax|`0JkpFoA"HRAR  m mA웰N< r NJf .rmArfApNT\Jf^ .rm.Atf"A"HtvHփgt fU` .rmAt gt fS`|pf.r$fp-@A"HB/BBpACaO nr gr;fBajJfaLN^NuNV/HJ8fpFACa .JjAN;AAN? Ua*_N^NuNV/ *I-HN>N Ma*_N^NuNV/ *I-H Ma*_N^NuNVH*I-HN MaN@.Nh fN>dL N^NuNVHN>TN@XpFACaJo AN8 `AN? pN> N^NuNV/ HpvfAZN7DpOACajACƥNN*@JfN7`Rv ,vAV!*_N^NuNVHHJJfA`N6pFACaJk"Kp g pN`p Np NL N^NuNV/HpЀACa.pm"ARAN3d AN3n)@.N^NuNVHACN oA욡N6:N^NuNVHpOACaRpAN>JfN6 a\aa)@ja>)@fN7A"l"N rN^NuH.*lfJg*U-f `pL Nu/ p N2D*@*+H *_NuH.*lfJg*U-gJfAN2l `a*L NuNV lf-Hg0 nJg-H-P nXHN26AN2.`AN2$BfN^NuH.*ljJg*U- f `pL Nu/ pN1*@*+H+H *_NuH.*ljJg**U- g rpFfAN1AN1 `a*L NuNV lj-Hg: nJg&-H-P nXHN1r nPHN1hAN1``AN1VBjN^NuNVHHACaJgZpFACa. @Jfp.a@*@ gp@` p.ad*@Jo RAN0+@nL N^NuNVH-H-IACaJgp.NyrPҁЁ@r N;Jg.p.rpҁ@pFACa. @ n-Hr;fpFACa, @`|JfJfp.a*@ gp@`4p.a,*@Jo RAN0+@Jo RAN/+@n p",AN;HJg pAN@L N^NuH*H&IAjp"KINB-mfmL(NuH*H&IAjp"KINL(NuH*H&IAjp"KINL(NuH*H&IAjp@"KINL(NuH*H&IAjp@Ѐ"KINL(NuH*H&IAj <"KINL(NuH*H&IAj <"KINL(NuH*H&IAj <"KINbL(NuNVHACNJg Jg)nbN^NuNVH*H&I.|lr Ua* @p gp;f ``pNJg K "MIa-@rg0܀` MCNzJg FR ."` FR R`AIN1pL(N^NuNV-HN7N9pFACaJoAN1nN^Nu/ *H MN *@p@,g@fRM` *_NuNVH*H&I MCNJg .`. Up fp`"pNJgR UR Up gRpL(N^NuNVH*H&I.xB. URJ.fV URp[@gQ@f$S|`Snp`: DR  URf|`Snp` DR ` H L(N^NuH*H&I.zB UN * @p gp;fp`tpN Jg  M"Ka<*JoB3X `P Up[@g:Y@g.Y@g*@g$@ g@gU@gSnp` ER `B3X ` UN *`L(NuH*H&I.z Up@ g@.gSnp` ER R` X L(NuNVH*H&I. U-H UN *r @ N Jg  M"Ka^` A"KazL(N^NuNdNN"N\N.NNNҰNVH*H UN &@p@A@@ KN &@p>fRK KN &@@r gr Nt@@RK KN &@@r gr Ns@ARK KN &@r g[fp+rHҁf KNž&@*|~anF Ї* AD)H\C@fJf!HH(Jf ,\`Jj,R`.S`pL(N^Nu%s '>%s'NVH4*H-UAa&@Jg@+pp- fg lC J1f`Df> k/H M"n$oN`(pp- f Hl@HlHzHnNrFAN,OL,N^NuNVH*H-Ipp- fA"N)+m  U+H &HNrP M"Ka,pp- f l"a .B"  UN))@"L(N^NuH*H&I|z-lgpp- f Jtg.-t`~+G|p+@+@Jf\p[@g8Q@g @?g>]@g @g4]@f8 Ї+@|`,pf Ї+@|`pN Jg ` R+@ڇ`L(NuNV/ *H-IBACNJg+nt M"m a2*_N^NuNVHN^NuNV/ *H-Ip+@*+@&+@b+@^+@Z+@V*_N^NuNV/ *H-IAVCINڊ*_N^NuNV/ *H-IAZCINj*_N^NuNV/ *H-IA^CINJ*_N^NuNV/ *H-IAbCIN**_N^NuNV/ *H-IA&CIN *_N^NuNV/ *H-IA*CIN*_N^NuNV/ *H-IA*CIN+m*&*_N^NuNV/ *H-IARCIN٤*_N^NuNV/ *H-IANCINلJ2f Map*_N^NuNVH*HA"-ICINVJg -"Ѐ+@".`~ na @p gp;g R+@"L N^NuNV/ *H-IACNJfp` -T2∰UDHH *_N^NuH*H&I M"KaJg8pp- fp",:AN1rAN`J2g p"-" MN1n MaL(NuH*H&I. M"Ka`Jgvpp- fNJgp",:AN12rANb`Rp",:AN1rANJNp",:AN1rAN0` JfRNJ2g p"-" MN0 MaL(NuH*H&I -NNXr  M"KaRL(NuH*H&I -NN4JWDHHp M"Ka&L(NuNVH3*I&n|-Hr ft(C91(gRp nC91gt,v0R nfRpFACN.Jj~AR  MN$ /@ AN$"/+pf l"-Ha,. KN$  nN$&L(N^NuH*H&Impp- fHl KCaXOL(NuH*H&Impp- fHl KCaXOL(NuH*H&I KaBJgAjp"KIa` M"Ka M"KaL(NuH*H&Ilpp- fHl KCNaxXOL(NuH*H&Ilpp- fHl KCvaLXOL(NuH*H&I KaJgAj <"KIa` M"Ka| M"KaL(NuH*H&IAj <@"KIaL(NuH*H&IAjp "KIaL(NuH*H&IAj <"KIa M"m a-lg|pHj` B,mL(NuH*H&IAj <"KIadL(NuNVH*HJ2gR.-lgm`m+mN6 -R+@:"-V+A> -b+@J"-Z+AB -^+@F"-:>J.-mgB-mg Ѐ+@B2pp- f|p l AN" ANJg0/@/@AN paAN"/ pN!A"/! AN! AvJg0/@/@Av pa4Av"/ pN!A"/!R`\AFN!tJg la lN!r)@FAJN!RJg la lN!P)@JJf p)@)@L N^Nu/ *H MN*@p[@g Y@g,@g&` RMprHҁf`r f` MSH ` `RM`*_NuH*H Ma*@pN+rofX MNr*@pN+p.p@fgQ@f8|`| MNL*@pN+J.pff MaX @p gp;f `pL NuH*H&I. MaxSgSg` ` FL(NuNVH*H-Ipp- fZpFACN8.Jj~AR GnJg&S`p N&p r SQJg'G AN'@L(N^NuH*H&Ipp- g MNN` K"l(Nxp l(NL(NuNVHACNN^Nu/ *H MN*" T*_NuN+NZN /.WDHH.Nu*.*PRINT$$$.TMP%s '>%s' - %s% %u%c%c%u%c%c %c*p+%uX%c&a+%uH %s %u%c%c%u%c%c/.p'g p"gp`p.NuNVHzHn"HN8POJg pAaN^Nu/ *Hp Ma*_Nu/ *Hp~F Ma*_Nu/ *Hp Ma*_Nu/ *HpAЀ Ma*_Nu/ *Hp Ma*_Nu/ *HpvF Ma~*_Nu/ *Hp Man*_Nu/ *Hp Ma^*_Nu/ *Hp MaN*_Nu/ *HpBЀ Ma<*_Nu/ *Hp Ma,*_Nu/ *H < Ma*_Nu/ *HpPЀ Ma*_NuH*H.N)HJ,Hg fp`p@J,HgH @f>A씼Ne gbGJ,gJ,gJ,gJ,gN{  Ma2N{N(J,HggJ,|f AuN'N(N(NL NuNVH'$.-H,,*,a&2| lj)GAC8f,gN':B,A,g a"Jg)H8)HN)H4)HJ,gpOACN7R-@rl(AJN'NzpOAN'-@Nz .JoAN&JgAN'xJg6A잾CfACN'p,ɜANr2p,ɛfFAC\N6A\C fA N6-@A"@fA CƨN6`)@4g,g.J,Hg,׈JgA׈aJf`Aa$JgJ,Hg)ld` p)@,fAaJg| nJg`pOACN6JoACƥN5)@NJNgnAa$0 lNCN@p" lNN&BRAa*p@ J, gNH8NN%NyFJ,jf|-l nN%Jg@AN`*@Jf2HlrHl@HlHzHnNc||AN% nN&<` nN% @C-Ip n(rMҁgrfJ, f.J,g(ACƥN4)@Ng~", )AR r lNN%J,Hg ,ga#Nxza#RANc-@faH N$| N$`zJov,gH lC[ J1g8N$`Jg>N%p,ɜA짶Nr2p,ɛfN$`A진N$F`|| lN$J, g ,N$pN#NbN$aA(aZ lN"HN2AaBJNg lNN3J4g2 l4N3,g"J,fHn\pA?NA\ON#A C\N#JJg lJN3Jvg ,vSvAV pN3f`J,Ag lC[ B,*L$N^Nua|ANaJf&aaaJgp",:AN#rAa B,NJfSfNu/~p l: 們Cv#CN#C#C#C#C#R`)H)H)HJ)HF)H)H)H".Nua)H<)Hz)H)H)H( <ax)@()|0NuH!aLACp""Q|p!J,HgJ, g`J,ng,fBp)@bp )@a Jfp )@aJ, g l`J,gAN`A켙)HAN^)l(p)@)@,)l )@,WDHHAJ, g l t f(tfr`r`rA|JNgB,",R lNAN"~B,p)@v)@,gr`"Aap@`@aJ,Hg2)l\J`fp` ,`)@"J,gJ,g`p)@)|"~plAxR`BB,p)@fp-N twVDHH`rJg2|Jf,p[@gQ@g@rg` |pajpa``L NuHJ,gZ ,voa`*l~ l~N} @C)I~ " . Ь,0ea l(, "M`Sd߬,`v,,v*,,JvfRJ, gJ,f JvfaV`axJgB ,芰f: ,,( l~"lz肱eA짣aF l( "l~`Sd٬~L Nu/J,f. l )H p[@gQ@f l )H p@ g(@g@pg@f|a`| l("H,R,p  l(,R, l f(rf|` l )H pN}Jg:,gbprFҁf p@@`JprtFf>|p)@,`0 l("H,R, l(,R,` l(,R, ,,0ea` l("H,R, l(,R,.NuJvg ,vAV p` lN NuJvg ,vSvAV pN-`|pNuH*H MNj. RgSg"[grg g `a`P `LpF`F MN6.pfa`4 r N|JgJvf,gptFgpFЀf ZL NuHa.*@Jg Maf. Rgr g>Wggtgx` Ma8. Rgr gg  MN l("H,R, l(,R,  MNd.pg  MNx`a`z|B,`Z| l("H,R, l(,R, `DJkpFo l("H,R, l(,R,  ,,0ea`L NuH.*Hp[@gQ@fp`-fp` MNzx*@`RM`L NuNVH*H. lC J1f `JJfNJ,`fD|`apf.p-N{Jg p-AapJfp-aTM`pa(aJfaJ,&f J,gp`p,Jg Map gJgaDJ,g pFaB,J,g pqЀaB,Jg0,| p g MNxJg Ma *@ MNyn*@`DJ,g p Fa>B,Jgp gT Ma *@ MNy<*@`r g:[f,p-NzJg p-a`p-rlFfR MNx*@`pa *,: ,JЅ",6Te p"a^`@۬Jp"AN-@JgJrAa8`Jg"-Afp a ` a6 L N^Nu/ *l(J,gjJ,g,J,gD Map g Ma*@ MNxV*@`pa`p>faAN` p Ma*@p gRM` (T l(a*_NuNVHANpp)@JRfB,& ,N"cah ,Nd|&aJg,gp@&`,gp@&J,&fJ,g,g*,f" lC[ J1g,f ,g,f,g,gt/,NHlHnNUO J,hg.|B,NkBHlpACvN~>NkPO`HnNN.NvFXO fap gp@&J,&fJ,agB,aN<,gpa\,gp`paJ ,Va2,gv ,NaxJgA`A*H*,Z|p lLJgH ,NaPJg A p` A p&H fpfp K"Ma*paSR` a,gpaL(N^NuNVH*H&I.-M fA-H nN l("naJgA""Ka|`| f l("HNd\` p" l(a*l( MaJfXr gPr%fF-f RMp Ma `/,NHzHnNT* S MaO A"M`Sd`RM`*l(p g Maz*@ MNu**@`Jg A""Ka (T l(a L(N^NuNVH#*H&I MN. ,Rrzҁ/t////HzHnNS^, Їa -@ A"n`Sd n "M`Sdp n"KaAa L(N^NuNVH.,JJg*,JBJJ,&fJ,fL SJg8Jng lnC"""RAna JAra BACn"""`ANv`x ,6T-@ ,NaJgAF`AJ*HJgJfpappajYB l p_aR` SJgTpa>YJng8 lnC""" lr"MazAna Ara ACn"""`A"MaP`Jgpa,gJ^g .a ,^Sr-A-@ l< ,NaJg ."A p` .A p&H g SR` .Jjr-A .aPp-@ lZ ,NaJg ."A p` ."A p-HfSf"p"MadR .^d paR`aJfpa~`aJf .a~aJgJfp ap a` ,baB,g& lC[ J1g,f,f|a,g@J,eg:-lN-@Nq .SJg pxЀNh`p NL)nANL(N^Nup"gp`pNu/. Ѐa.Nu/.pf p"Jg~pop a:p a4U`pf p a$pa .NuH.|̬gprpҁr N&@ g k`prpҁr N"r @*H gp",ANy(Jf&z g k`prpҁr N" @*H`z Ma0pAN"` pAN"vAC",gpr Ff,gN`N`prqҁf,gN6`dN`^prFf,gN`DN`>pr Ff,gN`$N`przҁf,gN`NL(NuH*Hp[@gY@g@vg\`-p@ g@gv_@gp@gh@Qg>U@gS@g,S@gS@g@ g<`DR`Bp aD`8p-a:`.p a0`$p -fp-a`pa`pNoJgJfapa`pa`Jfa^ , MN`,,gL MNn&@ KNyJg ,І KN`x܀*K`p,N_x8fx "Nc* "Nc,`z۬ ,brc ",bNb* a SJgBp,aB`zp-fRRM` a ,brc"Nb*۬`pa L(Nu/.p@ g(U@g$S@fB`JfadpN^r2Ӭp"g` ,B.Jg SJgp aB`p)@.NuH. N*@ fB,g* lC[ J1gN JoN N*@ g`NwVA?NvFa L Nu/ *HJg UNB*_NuH*H. a" M"@`Sd @ L NuNV/ *H-UpACNJo0A-HACN Jg nJf*)np`p*_N^NuNV/A"af~p lX AaP AaB Aa4 Aa& ANa Ava R`AaAaAFaAJaAaAaAzaN2NjJng. lnC"""AnaAraACn"""`.N^Nu/ *H MCƨN)@4f A[Nu&p`p*_NuH*HpO MCN*.JoAa`NANu6pOAN Rfp`4AaJfp`&A*NupOAN .pfp`A*pL Nu,f,g ,^ЀѬ6,gp`Jgp`p"gp`p@ЀNuNVH*H.&M l(, " ,-HJg  M"KNp,L(N^NuH#*H. ,, l(&H" $ ,Ї0eaHpc M "MN*߬, L(NuH*H&I.  Ma" K"@`Sd @ L(NuA+aNuNV|H*H&l(NtNr gJg MC|f`B.|A|"HJfS /,HlBHz/NEOJ,Hf g JgA|Ns| Ka&`|| g JgA|Nsa.L(N^NuH*Ha"Nevp[@gQ@g0`$p@g S@gS@g`~ ` ~-`pNЦpNО`L NuNVH1*H&Mr fSM-Mc: MNe @-@r g"r gtft(vHփgfe*@` nd " MaL(N^NuprAQNu/.pg N @a.NuNVH*H&I U*&L(N^Nup@Jg lUf(Wg(Uf(Uf(UgrAr()Afr )Ar()Abfr)Abr()Ar()Afr )A,g@`B,NuNVH lC[ J1gЀALJpgN,JjDJgN/HlHnNBACANp,ɜANqZO ~> fp`p,ɛfN(`6p,ɜANq&~> fp`Tp,ɛfNv`ANh@ ,A8Jf*/@N\A8"/!f lC[ B1p@ApLN^NuNVH*HpzЀ/r//,//HzڪHnNAO.R e|  MCa0 M L N^NuNVH4.,-HJ,f~"lE J2gl*HB.J.f^J,gV|p@@ n-Hp gp&gp!fE&HSKpf(-HAN*@ gn-ffpr l(a `Xpr l(a,fD l(r>g8,fJ,g pA(NF`,gp l(NJbp l(NJ*_N^NuNV/ *HACf MN$AC8fACf*_N^NuAJ)H A)HA)H,VDHH@NuH*H g0~pFfp-rЁ.TM SJg pa`L Nu/. AN.NupaNuNmlJ,g,Np//prNFNN_PO,gNB,Nu/.,gp FaJg|,gpqЀaJg|,gpFapJg|.NupANNuNzN4NrNDNkN;NeNk NVNNNNҀNǾN4N%NN&ZNN^N(N7NNNNdNjN/N&NNN+NRNNfN~N"Nk*NkNLNNN=N@N"NPNNgNNNNNNN7NNN,NNNNNH*H.p Ma,J L NuIFELSEENDIFWIDTHWRCCCREMPPFFMSMCABCPSSPSCODEHLSIMPLEMMMFPWCWWIDTHS*.PPDNVH*H. MCfAN AN AN @CNzJgJf a p`DAN Jfp`2AC|N pAN x-@g @CNN ANCFN Jg"ANN l,pgANCƥN p&@ f&Jf/ HlHnN;&ANhO p`AFCN JfANC컕NiVJf KN p`a LBp)@ TN~-@f r)A`` +" nN[J-@J KN Η .Jg r)A`4 n"H-H-I nd8p[@g&Y@gS@g W@fR` n ` n `RR` n | Hx <"<@A컈N XO)@Jf r)A`a쐬)@r l`Sd)A|-n)A ndn np fR`p gH n)HLCN Jf&A ,J0g nC:N lJfp)@Jf lL-H na-@`Nh0 g KN zJg nN}JJgaB,* ,SmX lP@0;N (2N^NuNV-Hpa,N^NuNV-HpaN^NuNV-H l|paN^NuNV-Hpad lLr;fRLpaNN^NuNV-Hpaހ`0ACNhJgA"HR .`ARRpFmp)@pLN^NuNV/~ lLp fRL`p'gp"fdRL~ lLpf:RL~ lLr`Ff. r NXJg RLr lLЁ.RL lLr gRL `ALCNJg pF`p.N^NuJg lNu)H)H)H)H)H)HA aB,NuH*H MN&@p@+@*p A컌"KN1.B,A컌NFp.A컌N&@ gBL(Nu/ *l)M)M)Ml)M)M *_NuJg ,ANJgaNuH*H lLp fRL`pA90g@p.r0RL lLpA90g r NF^rЁ.r0`*p`pL NuNVH-H lLa)@L lLr g*lL~ lL)HLpf~)HLr`Ff.Aa>Jg| Ѐ l .0 lLr fRL` lLr g~RLpf~ lL)HLr`Ff.Aa Ѐ l .0 lLr fRL`)MLSSL lLr g`L N^NuNVPH-HPpOAPCN.JopAa`N, l(r:fp(N/*rA Nj`zpOA\NA\N @C\fA\N],ƺf(A\"HJfS rc"HJfS B( lNA"@N\A"HJfS rc"HJfS B6NHz|HnAPCN4POJg pAaJk NA\N NLN^NuNN~NN8NLN2NXNN.N̾NpNNlN>NNN`NNN@NNg0J,jf*J,g$J,mgJ,3fJ,pg,&f pN1|N`Nu%s%c, %c, %c, %c%ld%c%ldNAaNuHNZNNVNjNl*@ ",ЬrR)@pf:-pNN6Jg*pNNJgpNMJgpNAp MNM*@`)lpJ,IgN,J,vgN+J,JgpNstJ,KgNqN+\N~N]L Nu)l)l)lNuH#|hA,N+|(NqBNqbB,*l6LaJ,+gB,+`Z ,톐JnDrm)l~)lz)lv)laB, lNP@p lNPF@rNY8av,NYB, lt r g$Ygr g:Sg6Sg2Sg.`BN@la `N@`J,lWDHHr ra ^`hJ,,g N*|`R r rN,*`@ gTSgSgSgvSgSgLSgXSgnUgSg SgSg&Sg"SgfSg4SgSg@Sg^Sg(UgSgSgSgSgSgSgPSg`Sg\Ygr^gr g|rgSgYg(SgSgSgSgSgSgSgUgSgSgr gUgxSgFSgPSgSgSgSgSgnSgSgSgSgtSgSgSg8SgUgSgSgSgSgvSgUgSgSg~YgfSglSgrSgxSgSgSgRSg@SgSgSgSgSgSg:SgUgSgUgSgWgSgSgSgSgSgSgYgJ_g8Sg&SgSg@rlg4SgDSg\Sg[g`|0|+B,*a2`a"`a$`NW` ,8rdt`S$ Nz`j ,8R",풲fa ,8RNz`Ja*a `>aa `2N'`*pN,`` aan`apa`J,jfpGЀapGЀrN(`a`a `a4`p=ax`Na`Ra0`Ja`Ba`:a`2a `*a aX`aa`aa`J,lga`pN_*@ Nfj`ana"`a`aa2`aN`aFNU`N&`a,`a~a` lNF6r @(g~ ,>fNZNNZdNk`d ,@U",펲fN[.,hN\J,-ghg ,@Y",펲oN[NkN`$N:a`N:ap` aa`aa`a `aF`a`aX`a`a `a z`aHa `aJ,jg8aR`2J,jf,a0`& N"` !m 9n  rN#~J,fBDpfJ,pgNi0NP4p@@J,og ,",N#`L Nu/apg0.,@U",>c NY ,br`" NYbNh.Nu/aV~ ,@UlNW@R` ,Nh.Nu/J4g~ l4)H4JfB4` NB.pg .NuNV/~NT`-lHn ,rACNZ\XOJ,%gJg4p nN^n`( .rgJg nNNZJfp nNN~`.N^NuNV/ -@aNb*@p MNN\*@ MNN@Nb*_N^NuNVH.Nb`*@ M/H Nc o "lNE, SJg8p f MN`pa`* MNB**@ MNMJg MNM` MNBx*@` MN_L N^NuH.,JfJg paH`pajLNuHpgnJ,6g J,jfp`p.JgNb&@ ,SNcNa*@ MNM8Jg MN_lJg,pAJ0fpAJ0gJ,Bg KN!NB,BL(Nu/ Na*@pAJ0fN6* MNLJg MNL` ,RNc*_Nu/ NaNa *@p -f&J,lflp-gdJfBlB,>a@aT`La Na0*@J,lg MNA4r @f MNb` MNLXJf MNbpNY*@ MN^zN`,*_NuHN`*@p f-rgJ,lf l"5g Na2N`*@p MN[ MN@ @C IN]lprEҁf,AN", SJg MN@:*@ MNKJg MNa`aN_`N`N`H*@ MNa MN]N_vL Nu/ pNX*@ | N_*_Nu/ lN?r*@-rgrpMЀgp MN[2 MN?L @C IN\N_\*_NuNVH~J,lfN_^*@ MN_&@p -fg MNK:*@` KNK0*@p  g MN"J,jf~J,jgJ,gp gx lN?$-@ nr gr f nN?L @N?-@`p ngaL(N^Nu/ lN>(*@p-f MNJL*@ | N^(a*_Nu/ J,jgtJ,gn lN>N*@r gr f MN>~ @N>2*@`p g MN[an lN>*@r gr f MN>F @N=*@`p g MN[`a4a*_NupN_Nua aNupgaaNupa NupaNuH. lN=8*@-Jfpf,Jf lr g@ MNIF*@ | aN]`prEҁgaNQprEҁfaL Nu/ lSHprEҁgaNRprEҁfa.Nu lN< @NZNu/ NZ*lUM MN<*@UM lSHpgN]fa` MNZ| ,@UNaNa*_Nu ,@UNaNaN1xNZ8pNRbN1RaNu ,>Ь@UNRLNu ,>NRBNu/ N\@*@fpfa`NMrapBNaX*_Nua`NaTN1pNQN0Nu/ N[*@ MN;" MNWN[~*_Nup"a"NupraNupraNup"aNuH.,xN[&@*KJf, MN<0*@p -g MaJg MN<*@` MN< *@zJfp[@gjQ@g@g@ g@g`LJgHp-rEҁfTM MN: @C INXV`r fJfz`TM MN: @C INX2`Jfp -gxJg MN;P*@`lp -f*p-rEҁfUM`Pr fJfz`@UM`: MN;:*@`.RM MaJg MN:*@`z`JgJg " KNV`" MNXL`cJg " MNU MNX0JgJgNdaNZL(Nu/ NZ**@ lNUadNY*_Nu/ lN9*@-rgrpMЀgTM lNUNWNY*_NuH!*Hp g0p g*rf -rtHԂgrtnFggp`pL NuH*H MN9&@ KaJg KN9*@` L(NuH*H MN9\*@pAJ0g>rAe8 MN9*@ MN98 @pAJ0gpAdpA90f`6 Ma4Jf, MN9f*@pAJ0grAd MaJfp f MaDL NuH*Hp -f ` MN9B*@ MaJfpfp-N:JfpAJ0grAdrA90gRp -f ` MN8*@pAJ0gpAdpA90fpffp-N9Jf`Vp -f `P MN8*@pf p-N9fJpAJ0gpAdpA90f MaJg MN8(L Nu/ NX *@p fa` Ma: @NUz*_Nu/ NW*@p -fa` Ma @NUT*_Nu/ NW*@p fa` Ma" MNR MNU&NV*_NuHNW0&@p +fa` KaV*@ " MNR MNTNVL(Nu/ lNB*@ | NV*_NuH. rPgUg,Sg8SgLUg^gSgSgSg`J,jfa@`J,gWDHH@gN[`J,fWDHH@fN[`|NW , ,N:Jfcp?`fB``)@` NVN[j`FJ,jf@J,eWDHH@eNAN[R`&prN`prN`prN`prNLNuNVHN ,N.pf Nr nN5*@eN@N_ MNRlL(N^NuN))l~ ,vNVT ,zNJ^NYN)JNuHJHgFJDg@NWv. ,HNMJ*@ ,H lD"M`Sd ,H MNSHNWJgNYPaNSL NuH.NS*@p[@gQ@f.NGJfp`&*l`-f MNQ ` MN40*@`RM`L NuHNS*@p g MN4 *@NgTp[@gQ@f>NG~Jfa`4*l`-pN4~Jgpa` MNQ@` MN3*@`RM`L NuHNS<*@Nfp -fNHJfap`8 lN2*@` MN3*@pf-pN4 Jgpa MNPL NuH .p",NUJgzp",NUJfJ,BfN1.J,gp", NUJg>J,Bg&p",NUJfA:C$Ip$$Q`A:Cp""QapaPLNuH.pa>p",NU2JgN'0paBN' Ne`2pNT&*@N\prtFg prFҁfNL` MN=L NuNVH.N,p0ЀAC&H:8+=kB l| r?gf_gL]g(]g4r gUg`hptFa*`pFЀa`J,jfa >`J,jfa 8`J,jfzplFrN2NQ`jpa(pNS8*@N[ MN<`PpFnA90xg rPЁr a`*Jf~>` .rf~>` Uf ~>.B.J.fR` r2 N=TL(N^NuHN,Nz.pf N֐rXN6. aLNuNVH1NP*@p g| MN0&@r glrf t-vtFf[fp+rFҁgF KN0~-@" .  KC`Sd  KNL  MNI*@ A"M`SdNOlL(N^NuH*H~lpA90frRM N. MN,Jf|p@cg(@ gY@g&`2N$ NEnN$^Nc( ,NT` NO`N$\ a N$:L NuH .J,jfrJ,kglpbp>fJ,BfN-J,g ,e6J,Bg ,pdA:C$Ip$$Q`A:Cp""Q ,daJfLNuNV/J,jgp`p)@J,jgp`p )@ATN . GgHp0A90g/,HzdHnNmO `p0/,/HzLHnNmOAa|.N^Nup,ɜAN3rr2p,ɛfN>\N=NRNuJ`gB`NSBNuH.pN/jJg pN/, ,`"†g "Fì`NSLNuNVH-HNM&@p +gR KN.@*@pgBp nCN ,Jg, MNO  MNF&@ A"K`Sd KNKHNLL(N^NuA¤aNuA±a~NuAatNuAajNuAa`NuAaVNuAaNuAaNuH*HJ,jfbJf l*&Up gRK` . l"HSI T lNE&@  U"K`Sd x x  KNKNLab L(Nu/ N`RN@Jfap`@ lSHp f lN,*@p fp-rEҁgN@FJfanp`a&p*_NuH.NO*NL,b ,cNA lN,8r @f ,cNAJf lSHprEҁf ,cNAJfaLNuJ,jfJ,kfp`,N_tN?Jfap`Jf lN/JgapNuJ,jf(J,kg"aNA6JgJf lN/JgN_Nu/ *HJgprPҁЁr a`*_NuH.J,jfpN,rfr,cgjNK&@*Kpf0p-N,vJg"p-N,Jg-f&M` MN+L*@`pf+f MNL`pNL*@ MNHNJ`pNL*@pa MN6^NJ.L(NuNVHJ,jfN -@N V.pfN r.` .rf~>.` Uf~>.z` rPҁЁ,JfR`p g JgpaT r2 N6,L N^NuH.J,jfZ r gr gg Qf@~ z`~-zpN*, ,`"†g "Fì`NNhprN  r2 N5LNuHN T,J,jf2N.pf N NuJ,jfJ,nWDHH@nNMNuJ,jf.J,kWDHH@kN3nNMNMp@B@ ,N>PNuJ,jfJ,hWDHH@hNM\NM|Nu/ *HA)H4p"MN*_NuNJNHxNu ,NHnNuJ,jWDHHr NbB,+NM NM,NuJ,WDHH@NM2NuJ,WDHH@NMNuNVHB,8NNHnHnACN PO ,0lJf <N4`zJ,jfJ,hg .S",0f ,,mNnF|8",8ҀR)A$)A a*@~ d& MN' @N'*@p fp)@$)@ `R`@r>f8|La*@r g$rlgrLf|-` MN'& @N&*@`p@@a`aN4` ,0m a$N` ,,oN `r ,8RЬ,, ,0",>ANd*JfN`H NH" N<.J,f*N &@J,of KNJgkp@`|)l,)l0L(N^NuNVHJ,g$ ,,)@)l0 ,8Ь,R)@$NK,`J,fnNptFN'R`|NE/@p oN>*@p|@|J,ogNF )@)@ ,)@)@|NNO`dp,a`.,NE8*@p,N'8Jgpf,-g MN%~*@`pf,-fp MNAHnHnACNZPO ,0l N:Nj`hm N8NZ`X ,,oa\`Hla`< ,8RЬ,* ,0",>ANb(Jg NFZ N:D)l,)l0,,NDX/@p oN=*@,@J,og,p,rtFfND)@)l`ND)@)lNdJ,og ,",Nb "NbNbL N^NuNVHNJ,gaR*@p g> $bp,NDrRg$S g MN$ @N#*@` MNEp- MN/\p$gRa0*@S$g4 MN# @N#f*@p f ,$r- MN>*@`pNrRf` MNE0p, MN/NHhNHTp@@p)@$)@ `NF2Jg,,*,N0N&@ KN#R-@p nfB(pN$@Jg2pN$Jg&prtFgprFҁg nN#-@` KNLJg nN@Jg nN KNJ,og NEJgNn N80 ND:p@@L(N^NuNNGZNGzNTN8NuH.,,J,8fJ,jf lN&dJgNBb*@`2J,8gzJkzެ8az*@ SJg MN"N @N!*@p f`RpNbr!gr grg.[gr g$]g ` |.` |C`|-`|! MNCp MN-dNF`NL Nu/ lN%Jg*l`*lĻDf AaL*@ MN!P*_Nu/ lN%Jg l` l*H MN!,*_NuNdN~NNN2NTNNNxpN:N&NNNNXNɐN?N N^NEPNN8N~NkNTNxbNHNN N.N6NpNN*@J,lg MaJg MN*l*@` p MN7*@pf`pAJ0fN6RM MN< *,p g J,jfJ,mgN*Jf N>"RbN=`NH~ MN)*@| MN*@-Mp -g* MNn&@ KaJg l"MaTJg *n`*K`p -f*na Maap la N=nNpFN|*@ g MN?pL(N^NuH*H(-*-|&m ~|b8p[@g&@g$@ g@g@ g@g @ g`RK`R܅` L(NuH*HAa. r MN8LL NuH*H la|. T M"l N*@  SJg ` L Nu/ *Hp[@gY@g,Y@g(@g"@ g`p-@ g @gU@fp`p`p*_NuH*H&Id MaJfp` MN*@`pL(NuNV-HpaN^NuNV-HpaN^Nu/.J,jffNpN J,HgA,N ,&g N`Jf `$aXJgNJf&JgpFЀ", N>JgpN p@+@*N.NuNVH.J,jfN(:Jf,,*,N>f-l",6-@-Afp-@|3N; @N'T*@| lSHprEҁfJg ,reU` ,>N`N(,a N)FaNEDN:NJpFN*@ g MN<溮b& ,풰c lNr @(pEЀfN܂p@>@3L N^NuJ,jfaN?NN\B,>Nu/ B,>N'*Jg lNJgaJ`N4B,>p`6pf N@N:V*@ l"MaJf la0appAa*_Nu/ J,jfTN&Jg*p lN$n*@Jf B,>N`2p MN% @K`*la M"MaJ,(gNDRB,>Nۖ*_NuA2)H A5d)HA)HJ,jf ,&gp`p@NuNVH'*H. l( rpf J,fp`p UadzJfp-@&Ua l-hB|Jfr@[AgYAgYAgAgA g|`prMҁf> l( rpg0Jg .-@NN&@N*DJg l-H`r grfz,`pSKp Ka KN&@`Xp.a r2Ӯ .R".첀c|`2-K`*p.a r2Ӯ-K` KSH .a Ѯ-K`@r f KUH .a fѮ-K`r NJgTp.rGҁf( a r2 .Ё".Rc|`-K`t NJgp.a `rp.a r2Ӯ .R".첀cP|`Jp.a r2Ӯ .R".첀c(|`"Jg l( rpgN`JfJg U"naJg KN-@p nfp(rFfT nar-@  U"na l( rpfN`tN*JfNp`K`\B,pL(N^NuH*H.&M l( rpfJf,,,,N2 ,,f|`rAN> @C IN3p M"lN MN*@p f p M"lN`pfp -f p M"lN`p Ka l( rpf pr KNdL(NuNVH *H-@p[@gQ@gx`p MN&@pfXp+rHҁfJAN-@ @t g[fp(rHҁg-f p K"lN`p K"lN ` MN*@`RM`~L(N^NuNVH7*HH l( rpf*(lgTJ,gLJ,gDJ,&gJ2g `4J,ng,|-Ma l-h|p-@&n*~JfJ nr@-H[AglYAg"YAg Ag:`J.f-FR~` nSH a܀|p-@&n*`J.f|-FRp ar2܁` n@-Hr f"HUI  Ia܀`p.rHҁgr NJg2p.rGҁf: nt g[f*r(vFf(fp.ar2܁B.`2r N.Jg$p.aB.`p.aLr2܁B.b`p nrEҁf l (-@ꐮRHo(zg,g( tpf-@Jg`pgV-K)E(lgf( rpfp"Jf,f:p ar2Hfp-@ .".N-@ .".N-A`p".-@-A` .B-@ .".N-@ .".N l( -ArpfrpJgh,f,gX(lgp ar2 .NNѮ` .",N<Ѯp-@ .".N>-@ .".N.-A` p-@-@ .АRR-@ na-@ na:-@ @a-@p ngS .HJg .JnRS l( rpfB .H",btcN-@ .",bNӮ ,b".eR`p-@ .ЮЮHgP nN/@ . o"l N-@ .SJg n-H` .SJg n-H`L(N^NuNVH*H&Ip)@ Ma-@" K"lNp ga~p a@r2p)@-K-A na.,-@ @av-@p nf l (Ш,Jo(lg6Jg0 ".NN* ".NB( ,brc ",bN,(`*x  K"l N-@ SJg n -H`Jg4 l( rpf&  n"l N-@ SJg n-H`L(N^NuH*Hp[@gY@g Y@g@fn `-prHҁf `jp f ``TMpNJgprGҁfp fpa8r2Ӭ`pNJgpa `|par2ӬRM`fL NuH*Hp[@gY@grY@g@gR`x-pNJgTM`prHҁfpar2ӬTM`p f , MaѬTM` `*pa*r2ӬRM` , MaѬRM`n L NuH.J,g&Jgp"Hҁ lp0` l (t`p,,g l( rpfF LNu/.p@gU@gS@gS@gS@g@ g `,~ `(~-`$~` l( rpfp`p1abr2 `paR.NuH$*H.J,g  Ma`  M$l"j NpL$NuNVH'*H-@ l&h ~l*(tBpfpNJfp g:prg2pRg*ޅR⾮c .➅S-@ޅRp[@g>Q@g@g@ gL@g@ g]@g,@g@ g]@g`pNFJgS`ޅR| MN *@.gxp[@g Y@glY@gh`>p g^pN JgpN Jg0paB`&paFr2S`par2Spfp-@Jn..)n .޾c " `)np` MN t*@p-@-@p[@g Y@g\Y@gX`@p gNpN LJgpN Jgpa`par2ӮR`pa*r2ӮR` .".$.━-@갂c-A` ."ށ".$ԁ-@c.``L(N^Nu lxC"Nu/.pAN.NuNNNNLNVN/ *HJ,(g$N.N?^NNN ~ MNJ~p*AN- MN *_Nu$L$Internal error NF2$T$/.<}J " KN"-@N nNXOpf p-@` K-Hd2pJ@g [@g@g `|RK` KSH -@-H` .d|P`H-@SSJg p nfJf& .Ѯ-@SSJg p nfJRf+nZ .ѭRJg . n" N$P .L(N^NuNVH*H&I.,-KN%D r M"na6* SJg~p nJ@g"[@g[@gW@g8@ g0@g`H nan-@p nN"`. n`"R nSp gprEҁgJga"R-@p nN-@` na-@Jgp nN @C-I`SR npNJgpANF@`pdpNJfrpglp gfpf S na-@p nN!R`@RS nab-@p nN!`" naJ"R-@  nN"|PzR`|N#Jg lSHJ-Pgp`pMЀL(N^NuH*H&Md ,R KN" L(NuH $ l"lcd ,"R"lܳc ,RN#, daFN *lUM <ЬrA"MaJ, gJ, gHlpA?NA\ON( L$NuH , l&H KN*@f KN @K lcJ,g*HfAa MaL(NuNVH4*H&l " .N rA"Kaf-lL-lD-lHljlkl-lB,jp@k@1 l:dC:INJfB,1nk.@jnJg)n lDNސD,T N'$-@Jg,  lD"n`SdJ,sg nN&|s)nD lHNH,T N&-@Jg,  lH"n`SdJ,tg nN&|t)nH lL-H f l-HN:,T N&-@Jg,  n"n`SdJ,rg nN&F|r)nL,lB  lN @nB)l: l"ngd "lD)I`柬Jg\ ldAWa䟬 l"ngd$lD)J lH)H` lȳgd $lD)J` lL)HJ,BgX l:dB,B`J: lD"ngd$lD)JD lH)HH`D lHgd "lD)IH`H)lLLL,N^NuNVH!4*H&IJg J-Pfan MCp ""Q2 ,@r M"lJfpaJf prGҁfp`p.Nu/.p@#g:_@g6@g0@Ng"S@gU@g@Tg _@g@ gS@gS@g`p`p`p`p`paJgp`p .Nu/.prFfp`pa",`€ .NuH*HJ,-g pAN N NJ,(gfNqJ,hg MN `H|?N!N"p"Ny0Hl;/ Hz`N=FNrN 6O N . Gg Gg GfpA,N l`N!< MN pAN VL NuNVH*H&I.,(Bp[@gQ@g$@Eg@ g` pabJfRSfxp[@gQ@g@g@ g0@gh@ g]@g@gV@ g]@g`RRz RMgp[@gY@gY@g`paJfp gnSSf`nRMBp[@g Y@g Y@g`paJfp gR` .Hd*`patJfRR`)n `)npL(N^Nu/ *H Ma@Jfp`p MaJgp`p*_NuNV/ -HJ,jgp`AN*@ g -gp`p*_N^NuNV/ -HJ,-gaJfp`$AN^*@Jfp`-gp`p-*_N^Nu/.Jg NzN` NhpN.NuNV/ *H MCfACNSdACkNSXN|NAN*_N^NuNp@N@dNuH*H.  MN^L Nu/ *H|?Np"Nv>p gp N:, MN:,NpNN*_Nu/|jNNN. o l r2 aB,jN .NuNVH0*H&IA"Mf MCNR|B.|. ,\r l $Sv0ԃ`rAЁ$B MCNRH M"KNR@ L( N^NuNNXJf NNN9PNu/.J$g p gp fN1J,.gN@pfVJ,g$NX ,,f ,0g.<`J,gNW ,,f ,0g.<` fJ,=faX` g f*J,gN WDHHr N~>` g fJ,ifJ,jg N4.<J,ifP gDJ,=g@ g g NJf& , ЀR "A 1 , rFm fJ,jfJ,=g8 , ЀR A 1 ,r@ҁN ", A N|`Nn`A즠NNDNn:N>)@Rg gNn6 , gb m n fNk`p)@ ЀR J,(g"<`"<A 1J,=WDHH@= <,r NNFN-ZJ,(gNn`NX .Nup l(NuH*H.pA"0L NuH.,p"A°gp`pLNu/ *H MNlJfp`( MC NPA N0A"@fA CƨN*_NuH*H&I g MNRgA "KNz`r `pL(NuNVH*HA"MNANX,ƺf$A"HJfSȲgh"HJfS B6.r:f$A"HJfSȲg:p.NrBg*pFAN&@ g+fN&@` fp`pL(N^NuNNNuNV/ *HprA"MN .*_N^NuNV/ *H-@prA"MNP*_N^NuNVH*H.GHpfp-aJgTM`Aa*@UAa*@UB.po.Jg A"KNJfA ` KRKJg`RKSlpL(N^Nu0|. NuH Hzp&?NN\OLNuJ,jfJ,eg J,kgp`p@-NuH*H -ЭB.[J-fJ-^g -ހ L Nu/ *H Ma*_NuH*H.&M ,풐8,Nk*N)N SJg Rn pN4`N(N&L(Nu/ *Hr g[f-gp`p*_Nu/ *H Ma @N*_NuH*H.p MN H*@ L Nu/ *Hp MN 0*_Nu/ *H MaJg MaV*@` *_Nu/ *Hp fp-rEҁf Aa @` M *_Nup@BJ,pf@pN|pNup@B@pNu/ *Hpfp-aJgTM`r>WDHH*_Nu laNu/.J,=gJ,if , ЀA1.Nu/ *HJ,hg MNp` MN*_Nu/.r^DHH.NuH *Hrf"r-tGԂgtrIҁgr`r`rpA0" L NuNNxN^NrN\NNNN"NHNTNPNNNN:N0NNNFNnTNNNtN2NuNrNVH4*H&I MC$Ip|$$Q K$Mp|$$Q Kp| QL,N^Nu/.\fA\`AD .NuNVH., a*@Jfp`pf&Jf"N&@Jg lN)KA)HN0A\"MaTpfVJfR*, 'e0 Nb-@g lNB n)H)HN`` 'dA\"Map`pL(N^Nu/.p",DAa4.NupaJgp.)@.NLNN`A0NNuNV-HpaJgp@+@*p.)@.N`A0NN^NuNpa)HJ,jgCN`C켙)I)I)ICIN)lNu$I$$T$/ p)@",[)A*lp r M)Hp)M| ,@B )lp)@|)@NANp)@)@(aRaaa*_NuH NNapp)@r)Az)Av)@~)@8)@)A)ANNNN/p@@@qNJ,gJ, gHlpA?NA\ON8ANp@~@JrgHlpA?NA\ONANB,LNuJ,rg lLNJ,sg lDNJ,tg lHNAC:p""Qp@t@s@rNuA:C:p""QNuA:Cp""QNNuJ,f ,rAaNu/ *HJf+m  MNRNp+@2*_NuH*HJ2f Ma.-"߭2 -2"-Te MNV`p" MaJg MN@L NuNVH*H.,Jng-kgp`^ -T2* Ѕ(Uplp`@YY -n"HcJg-@` p`"-App- g .n .L N^NuNVH*H&I-UAxC"Jf ,Rp[@gQ@gT`prHҁgpN^JgpAfN-`pNJg p MN`prlFfRn`pSK@g @fJ,1gp`NT&@-U`xp +gbSKpf+prHҁgpNJg,J,ogprtFgprFҁgpAfN|`prlFfSn`AxC p`XJ,jfF nJf ,RѮ n*NJg p nNJf AxC MN` MaA*RpL(N^Nu/A"laj.a .NuA:"l:aRNuNVH*H UUH-H| n(r gS n([fprHҁglpNJg,J,ogprtFgNprFҁgBpAfNZ`4pNJgp MNJfp`|`prlFfSnS`` UN~Jg AfNN n*J,jfj nNzJgBJgp`\AN &@ gHz+g J,kgp`8g,AfNp`"J,kg(-"2 -2rnp`SpL(N^NuH*H.-pfp`4J-g>g MaJgAfNB- Sr MapL Nu/Aa.a .NuA:aNu/.J,fa rAaHa.Nu/.J,g ,da rAaa.Nu/. rA:a.NuNVpH*H.,Jf~>eJ,BfN"A:-HJ,g* ,b"(cA-H`" g"+dGJ,Bg& ,>bcA:-H`" gdG:AfNj  n( gV +* ∺dF MCxp""Q K"Mp""Qpc MaJfS`JgPAx"Mp""Q n"Mp""Qpc* M"UaJgJg UJfNb @C IaS`L(N^NuNVH7*HH|z&U-llrA)H-@HHJ,jf ,&gp`p@SB,%p f . n `Jf p n `pfF+p gDpN`JgpNJfJgSRR`SRR KN(&@`p f  KN܀ ,RH".аc$. n ڂvC%`fbSR`*$H&.c n ڃ|%`8*-A"HlBpfTK`RK`SRRRK`*  n )nnL(N^NuNV/.aa/@  oa.N^NuH*H.Jf `|>  Ma&@N L(NuNVH/4*H.Jf `ڻdp@»:dB,Bct MNZ&@ lc&H ",* d&Nzc MSH` M-Ha n-HN&@+r g rpEЀfB , l-K-H nTHN&@d+r g rpEЀf-K` lUH ."(ANbACZNz rA"nNfACNbAN2AC.NJHlpA?NA\ONJACNgn| AN)@  na lSH|` lN &@ " , KNR l*H` lb"M " R MN&߬`CE " A"JNǟ߬ L,N^NuH*H.,Jg  Ma*@p" M`Sd L NuNV/.ar/@  oa.N^NuH*H.JgN|>pclJ,ff)GH2cDJ,(g.pN#p,ɜA{NZr2p,ɛgpA,N"`AN& ,2)@HJDg ,H M"lD`Sd&M*JgndSgdpNJgNJgNpAN`8prlFfN`&pNJgpNrf ,cgNS`  MaL(NuNVH*H.Jgldp@»:dB,B ld$-M&M " ,R  K"nNF`"G K " ,-H "KIN߬횟L(N^NuNVH!4*H:bB,B lb$&M "$ . ,C M)H-I` "HE "$ .&M߬-H  K"nN lBL,N^Nua lN @C IapNu lafNu/ *HN Ma*_NuNVH4*H-lA)HeJ,f4:eJ,BgA:C$Ip$$Q`A:Cp""Qc ,R lNrda`&l|zdp[@g6Y@gY@g`p  KNӺ܀ ,"RbR`*RpfTK`RK`+p gpNJg$pNJgpNpN0JfR`RRTK`xRRRK`n)nJ,jf n(lgp`p@ aL,N^NuH*H. SJg\Jfpgp f MSHpaP`>pfpNJg&p",NJg UMp Ma pAN :S`L Nu/J,pf lNJfr`r.JgNxJfJ,rf lNJgN p`N .NuJ,pf lNfJgN>N LNuNVa^-lHn ,rACaZ .N^Nu/ *Hpf p-N8Jgp-NJgTM` *_Nua @aNuNV/.a-lHn rACa naVXO .rg ",Ҁ a@.N^NuNVa-lHn ,rACa .N^NuNVH~a,av-lHn ,rACarXO .rgzJgv .d6 ,풰e.NtJf& nNnJg nN`Hp nN-@`J,jg J,gJf la*Jg N~`n .r na`\LN^NuH!*H MNބ @p gr g rf-f MNި*@` MNXt @WDHH L Nu/.Jfp` )@.Nu/ *H MNh" Ma*_NuH.aa*@prtFg prFҁf p Ma*@` MN*@GpN޲Jg pANZ L NuH.,Jf|0<rA\Q N|)@fp`2 l)H lJ(?WDHH@j)l0)G\NjajpLNu ,NuNDNrN,NnNNN$NjNNNNNNNNH.Jf` N| NP*,pf* ,N)@JNfNW|`J,lWDHHr NGr LNu %.8s %uK%-4u %-6lu%-7lu %lu%u%-5u %s %-15spaJNupaBNupa:Nupa2Nupa*Nupa"NupaNupaNup a Nup aNuNVH-@a,,dJ,jf J,hgp`p. ,dЀrNW*RJ,+go,`J,igY)GDop)@@`/Hxp"NQatPO R)@@LN^Nu/NM.,dp anaa HxHxp"NQ|aaap.HxrANQ`a pa2O .Nuaaa Nra0Nu|KNu|JNuBlaNu/.)G|pa.Nu|INuNVHp@K@J,jf~J,hgvap"NVN"*@x&Mzr g"rlgrLf(` KNڮ @N@&@R`-l8 .SJg2p[@gQ@g @Eg@ fSMB`pNpJgR`pNFR.*,8R f(,$ Ь`R-@溮dpfpN(Jf⺬ f|-p@ g4@gX@ gR@gL@g@g@g`$|C`4|R|`*SMJ.g| `||R`cp-` dp `pL,$fNQ,pNT6aB`pNT(pRgR`DNNJgNL(N^NuNVH'. @mJ,Bf ,>NA:Cp""QJgaa"B,Ja,,l ,>)@lJgP"SfpaX*, p la*@J,-g0A"MNJg gHnHnACNO8 .R./.".ANNpa./. .".NNpa8O` >RfpatJf praZ`a ,@S",>Ҁt-B-@-A .la8JfSR` .rAN .JgSg6`FJ,-g ,Ь >h".g a` . la` .a`praL N^NuH.*,`Ra: NC,p"NR SJg pFNR`NLTJgNNNN(Sg raS` raLNuH.*,`Ra rad NC&,p"NR` SJg pxЀNQ`JgNvLNuNVH.,*lJf ,R  Ma&@R@g KN"r @(HpMЀf& " (p"NQNK~NИ @-H&HNp n(g:*, A"KNtJg(J,-g , g aR@g ,ఆcX` ,@g aN.L(N^Nu|NuJ,(gJ,Jgp@`J,faB,N ,raNNuJ,JfACp""Q ,< laNuH.NMz,NM*NNTa pNPN NM NM$LNuH!.p@g@ gS@gU@g@Rg`p?`Rp[`Np]`Jp-`Fp@`Bpr@ҁmptvFn P`"ptpԂopt}Ԃnp` LNuNVH*H&MB.-@J,ogJ,gNJg ,BN:Jfp`p@N> .",aJf ,R*K MNA)H@J,jf ,Hgp`p@NJ.g ,",d -@-A`-@-AaN&JgNL-@NKNL-@ .NKz|J,jfX,cg,Uf ,Nr g>p g8 KNNJg  KN܀ ,c*`R` p fRR KN&@`º8dp[@g0Y@gY@g ` KSH NŌ܀ ,c*`R`*,8SK`p gpNԘJgBpNfJg pN`pNJg pABNpNJfpR`jprlFfRJRR`RRR`J .N?@p".NNRNJg&ptF",BNJgpFЀ",BNJfp@.8g&J.g .NJRp NMjSfJ.g .NJ:8J,jfR,cgJJ.fD,gNJR,gNJ^,gNJj,gNJ,gNJNJ-@J.g .NIк`bNJ.g4edJ.f" .NIp@`J.g .NIB.p cpNLRR`p[@gY@gLY@g*@fJ,ggp,`p r NLbRR`nJ,fgp fp,NL@` KSH Nd܀J,fgp,`p,Nr NL., ,8ЅRJoSg R`bp,NNK`p gpN8JgpNJgpN|pNѲJgTpABNZprtFg prFҁf0NJg(J.g .NHR` .NHHJ.WDHH@pNLJfpar aR`FJ,jfpNdJgJ.g .NGpr Ff,gNH`NH`prqҁf,gNH`dNH`^prFf,gNH`DNH`>pr Ff,gNH\`$NHb`przҁf,gNHT`NHZNG|-@J.g .NG8prGҁf\p fTp-NJ:R`Hp@gS@gS@g2S@gL@ gV`\p NJ`\,cgp `p,r NI`>,cgp-`p,r NI` RJp,NI`pNI`pNIRR`pNIRR`SKJ.gLp MNJf@p[@gQ@g0`pNrJgpABN`prlFfRJ`SK` ACT"NG2J.g@J.f .NFNCa8`(p-@ֺ`bdp NIܮR`aNCjJ.fNC`J.gN L(N^Nua ,S8",",e $ԇ&,@(Ub$ԇ)B`J,-g ,",ҀS$,펴c)A` ,"S$,펴c)A",@$U&,펶o J,+fU)AB,p",펰c`pNJ,-g0 ,펐>Ь萬hoN` ,>Ь萬h)@a)l .gZ.,AN"*@Nga,ACN>paA /Hz N2 .".NC N:NgPO)G)nL N^NuNup'`g$J,?fpaNPBgA `ANiTNuHp'`gFNP)@@J,?f8~@΀| ̀paTJg JgAk`JgAS`JgAc`A[NiLNuNVHJ,ifHNO.@g<*,Nfa,ACN=ara@ .".NB N9Nf)ELN^Nup aJ,lgAs`ANhNupap'`fJ,ngA`ANh^`$J,jg ANhN`J,ngA쩭`A쩽Nh8NuJ,jf8paTp'`fJ,mgA`ANh`J,mgA쩙`A쩣NgNuHA\N.pa )@ ` A20HA40H "N=LNuH.N."N9z,So Sa"AaS` raLNuHN-vN9D,S~l Ra^"AazR` ranLNuH.,( a4Rfp`zl a JfSR` ЄLNu ,<ЬDNu/.ެDpdl AL"0`r .NuH.,ެDpdl AL!LNuH.,c*.,J,vgxd)GxJ,vg|c)F||vLNu/B,vJlgvJ,Jgp)@l`h ,l",xd )@x|bR~@lJ a>",xf8 rAN ,|xSfN ",|aNl` ",|a`R`.NuNNNNN\N.N NNҰpa4.37ANbTpNp^NuStack space exhausted Program aborted NV4o nN^NugLn$2H@`""""""""QQ`$2H@`# # # # # # # # QQNup)@d)@`)@>#?<?<NMXJg ?<?<NMXH0<af?<?<NNX#?<"NNT#t/g")|:",`dg)Ad#>`HK0@|aJF#@| yCAHf/9#?0Jyg,Hx o0@ @@fLx/9pNuHxI̤p#~p</<O/r<NRPNx9E nJyfE //HlNҰ "l i"ino`Hl#NҰX0U@@A/0HlPNҰP&l /+/+HliNҰ J9g /Hl˄NҰPLx//Nj/ // /I̤Hl˘NҰJ9gv flH@HJfb/././. /.HlNҰ/./././.HlNҰ/.Hl@NҰP/.HlTNҰPHlʧNҰXJgHyNҰHyNҰXNjNp @g @g @g @fLxJyf 9g ``\`Z0/@r< @ gB<< @pg6<: @g*< @g< @g<\ @g<I̤JVgFpANpN.NXp9 @#tLx/9tNupaNVH@I̤ .N LN^NuHJ,f~p@lA[J0pgAVJ0pgtJ,efnAVB0pN&AONVAɃNVN)FN' HЀALRpN<,p g f HЀALSpN&p f HЀALSp` Ha4RG`bLNuH# .,plp?Bgr?NM\O` p?r?r?NM\O ,4rcN:pLNuH. lC[ J1g2rAa0,aJgpfp~",a,aJg `aFJgp` p",aZLNu/.)G.Nu/.pl a*` WaH.Nu lC[ J1gp` aNuNVH -@Bgp?NMXOJfp`pLN^NuNVH -@p?p?NMXOJfp`pLN^NuH <Ni*@Jg6 <.Ni&@Jf MNhp` KNh;|p;@;@;@ B L(NuH., ЀALRp A8*HJfJ,ffa*f ЀALSpp`JJg*U`JmgSmRm AhRp0- Rm mfBm ЀALSppL NuNVH. ЀALJpf A8Jg A8*H&M-U ЀALRp nJh f4Jf ЀCLSq`J,efg*Ng U-H`*H-U` a Jfp n0(0 pC`1xf,f ЀCLRqpCVx,` p"a ,z~`f|` p"a,Jg0 nRhSh ChSRh hfBhA`x ЀALSpL(N^Nu/. ЀALRp ah ЀALBp AhB.Nu ,aNuH. Ah,0 ЀALJpf AVJ0xg D` LNuH~|p@l^ HЀALRp HA8*HJg, UJh f &PNfR~*`*<  MNdJg~*U` HЀALSpRF` L(Nu/. ЀALJpfALRp a6.Nu/. ЀALJpgALSp a.Nu ,aNu ,aNu ,aNu/ lC[ J1g~p@lp",aJgRGa~`.NuH. A8*H&U g * KNed`L(Nu/~pl aR`.NupaNVH.,pmp o.,|pfa~zJkF ,|r N*AC *Px8Jg rȁ-@" MAav .Ѐ`S`zplD r N)AC *Px8Jg rȁ-@" MAa* .Ѐ`R`pfa)F)G|L N^NuNVH*H., Ѐ MC`Sd ЀAC Ѐ"M`Sd ЀAC ЀC`SdL N^Nu/. ,gX)G Sf&p@ rA@A!@@A#A%`(p@ r<A@A!px@@p|@#@%.NuHK>JGg p0,Gp0" Ma Ѐ`L NuA*aHJf A(aN&*@~plD r N'8At&HJSg,0H2+H4+H6+H8+H///NsO BSR`p lNvpANwNA)H p4Nw0.r Af0.]@g`p lNvN~pl r N&AtHnHn-Hpr ACNsPOJgRJngL0. n00.HCE/J(E/J,E/ //0r I"o0NsX9n t <pNwLPOR`r MNJgN=rN fp`pL,N^NuH~pl( r N%At*HJUg9U t <tNvBUR`L NupaBNu ,rﰁg fp` ,Nu|NuB,Nu/ :|)UAH**_NuH J,fHzp&?NN\O|LNu/ :|**_NuH J,gHzp&?NN\OB,LNuNVH/. H@H* r(|J,gp@fX HrAЁ/HlHlNaO JgpA"lN`NAC6N&ANJN.N1N `@lz HtAЂ$HDA/0(/HlIHlNa~OJgpA"lN,p@fNNtACVNANJNN1,pa@e pz@bF @gp0AkNxJgNnp0r,kf H-@`p0r,lf -|`p-@ .)@B,LN^NuNNH*H&I,,(.*&SfL(NuH*H&I,,(SfL(NuNV<"N#"N" n<"n<$nDN n<*H nL&H M"K$n@NJo M"K$nDN n<"K$n@NJo n<"K$nDN M"n<$n@NJo M"n<$nDN M"K$n@NJf,ŗ M"K$n@NJf K"KI$n@NJfe؛ M"n<$n@NJk K"n<$n@NJnb M"K$nDN` n<"K$nDN "< .L$& o n<"n\"#K-M<` n\ !@-KLP\`&n<*KŻLd0 K"KI$n@NJo K"KI$nDN.Jf/,pI?NA\O)H+H`Jo//,BgpJ?NAO )GBL$NuNV/ *H-@ Ma>*_N^Nu/. a.NuH.gR a,Jnp` F LNu/ *H Ma6*_NuH., "N* a*@Jg r M`Sd L NuNVH*H.-MgR f ax`vJf Ma`lX MYH&H P-H"e"߮-n n &C Ia` `4 e `*Y a"-@Jg"Y M"@`Sd Ma, .L(N^NuNVH.,,4 ,4f pg `B Jg SgSg$`,pANm|,B,-`B,,|-` p@,@-)G4 LN^Nu|7p)@,Nu)l$,)l(0NuNVH.,*.(. a S",0mH Rn@.g S",,f a <`.g R",,f a <` S",,m| Rnt.g U",0g.g T",0f a< <`j.g S",0f a <`J.g R",0f a <`* ,,moap` ,0moap`LN^NuNVH3*HaHnHnACNPO .",,mn$.&,0mop`:. ,0,Jm g"f mЭlp0- ``pL N^NupaH# ., "??t?NN\OHLNu/. ra.NuNV/~pl$"/A Aľ"0aAľ"/!R`|.N^NuH aJf0| ,?//r?NNO LNuNVH/A<-H n-HJg>pLfr lĞ*H`p lĚ*Hp Fg`p0gprA2QG2,g ,Lrft`tpLfp lĞ*H~SGf``~ G@G H lĢ*H @r @.-lxpr-Ё"Hr~Sf`.,LG2SGf,gR.,LG2 KRK HDcprt‚`" HHdpЀrt@Ԃ‚`pSGf,g.,LK2p"tSGf,g.,LK2prUҁpURMUGfK2&l,,J,gJg ,Lrf@FFFFFFFFFFFFFFF,gp` p$F `Z ,Lrf ,gpF`pR`L,g ,L"S`",L. ,Jg SgSgSg``F``B ,Jg&SgSgSg`U`F@` |`B+J,gd ,Jg&SgSgSg`U`F@` |`B+ ,Jg&SgSgSg`U`F@` |`B+RMSGf2,g ,JgSgSgSf`B ,JgSgSgSf |`B+J,g@ ,JgSgSgSf |`B+ ,JgSgSgSf |`B+ ,gJ,gr`r`rӬ`L(N^NuNVH*l., ,R,-l伬Bf&&M ,F(& .&&&&&&&SDf`&pe gJg-M(,LJ,g BSDf*nRM`\ B@H@".BAHA@A @J,g .@nSDf .gJ,gr`r`r @*HS`h&M*,LJ,g.-K (&SDf nB&HSEf p̀`.-K (J,g &&SDf`&SDf n&HSEfJ,g ` p̀`L(N^NuNVH/ .,*.(. a^p" l 1A&" l 1A*" l 1A(" l 1A,-@gr`r1A l gp`p1@ l 1|" l Bh$LN^NuNVH.,-Ha QgQgp`?r?NNO HnApCN\p0.Rr2.Rt4,)@Ē)AĖ rAN\XXOp0.)@J,İg& Ēd <)@Ēp@@p)@`$rWDHH@",tWDHH@ ,Ē",ĖN ",N r2,)@Ď rAĆN[`p0,ACN\p0.S)@p0.S)@JĬgЀ)@p?NNTO)@NvV l *P"mL0-PHH)IĢJ,ĪfE*R)mLĞ <NH&@ g~ d(|pd"҆ $Ԁ lĞ(R`R`)KĞ|ĪACpNtACpNtACpNtACpNtACp NttApC@QApCQ ĖeJ,īf l PH*P)mLĚ <NG:&@ g~ d(|pd"҆ $Ԁ lĚ(R`R`)KĚ|īA C 0pNsA C pNsAPC pNsA@C pNsACp@NsApC0QA0p?CQ ,Ĭa>papaaL,N^NuH! ,Ь.JĬg R.p0,"R$,ԬR/NXpN[Hp0,rNXN"p0,NZp$N\0XOp?NNTOH",g0|?//p?NNO LNuNuNuH3.pxЀ,J,g r)@`N rЀ$āЂ)@ t&ƂЃ)@ v"ƒЁ)@ r"t‚Ё)@LNuH3.|̬J,ggp`p)@ r)@` rЀ$āЂ)@ t&ƂЃ)@g <`p)@gJ,gJ v"ƒЁ)@ r$āЂ)@g <`p)@gJ,f)lLNuNuH0 ,rf$,<&,F l"H$,8)I`,$,<&,F l$,8,;gS`p)HL NuaNu/ ,ĎND *@ g ,Ď l"MN: *_Nu/ *H g ,Ď M"lN MNC*_NuJ,`f4|`)lDp aVr//)@@paAHaPO`apa NuJ,`gB,`AHa ,@a)lDNu ,JNuH0.,,J ,Jgpnza ,Jr*NNAN"HE&J""""""""""2 r*N"$$$$$$$$$$4 ,",a ,aJga"`a2)GJ L Nu/Jlg&pa@.  @wrAa ,lN8p"aJ,ig <rN>.Nu/.p e pa`Hp_@m8 @l2@0;N$&& a$`aH`a$`an` ~paB.Nup",aNu ,갬fa` R",AaNuJf ,aVa` ,SaFNuJfa` ,S",AavNua ,RaNuNVACaa* ,갬gahapa` .".a,N^Nu/pa.aaJgN>.Nup"aaBNuHaBJ,,*,a$ "aJgaa~pl, r*N>ANC 0R`J,Īg J,g J,īfp`pLNu|NuNuaJ,ga`aNuaJ,ga|`aNua2NuH.,*/(/aJj ,`"RށJj ,d"R܁Jj ,`RڀJj ,d"R؁ ,dc(p)@)G)F")A")A"AaLNuNVH*H&I ,* ,& ,Ь n ,Ь n L(N^NuH*H&I*&L(Nu ,`RNu ,RNu ,RNu ,Nu/. ",aB.NuH.,p̀ ,@І*a)E aLNuH.,p̀ ,@"Ё*a)E aLNuH~άpxЀ, a aLNuH.aJ )@|̀rxҁ* a^ a)GLNua ,NuaNuaNuaNuaNuaNuaNuaNuaNu ,Nu/.a)Ggaga~gagagaga.NuahNua\NuaPNuaDNua8aBa&aRafaaNu ,氬caaNu/ *Hp Ma *_Nu/ *Hp Ma*_NupaNuNVH.*H,,R*,R-lPJg@ fp'g8p"g2p;g,p.g&p f` nRp/HN0p oRM` nB-Mp naJgR`J.fp`.r:f nJgp`r~ r Nw sJg^A"sfJfg r NwA"sf0Jff* r Nw)sH s"n)IL/H I$oNp`R`pL,N^Nu...bakMonTueWedThuFriSatSunJanFebMarAprMayJunJulAugSepOctNovDec /.p@ g@fp`p.NuNVH*H&I MCƥN-@g @ (r Ka\. nN L(N^NuNVH*H&IN MCƥN-@g @ (r Ka. nNN L(N^NuH#$.*H,N~ Nw @2(p??/ tW?NAO N`Jg Njp`pL$Nu/ *Hp" Ma"*_NuH*H.pr Ma pL NuH#$*H.,pr??/ tC?NAO L$NuNVH!$*H gpN-r@`p. ?Hnr6?NAPO .".Nu".NuL$N^NuH.*H(BznNN-, f* `np fpf"* `Z fpo"*SSNpFn.A90hg" r N Rp0r o_"*ݕ,R`x L NuH z|~pl8 A"HA pJfSE R IN5Jg|*R`JfzLNu/.pNBJf NJgp`p.NuH.|p dp g p gp f^J,gp lbN @`*H g8zpFfp-rЁ*TM SJgpav,pf` pad, L NuH.|J,gp lbN @`*H gz SJgpa,pf` pa , L Nu/.p lNmRfp`p.Nu/.pa.NuNVH!$*H MCfAN-BLNbHnpA?NA\ONf.Jg JLg MNZ L$N^NuNVPH!4*H&I MN-@Jfp` nCfA-H KN-@Jfp` nCPfAP-HaJgANp`BLNӺp nN-@g @(gA"KNp`TNӔJgp`HBLN~/./.BgpV?NAO N~z.NfJg~Jg ,Lr$g JLg MNZ L,N^NuH*HpF MN&@ g+fN*&@`" VDHHL(NuH*H MN&@ KChfJfg KCZf Jffp`, MaJgp` MN1r NJgp` MajL(NuNVH!4*H&Ip KNT-@g @(gA"KN\p` M"Ka(. TgUfp`np`jA-H"Kf nCN,pfJfN$(*JgN$* o LNuHNJ,N a.Npf a.pg LNuJ,6g aRg`a ~Jga N`Nu/NZaa.Nd .Nu/J,6ga.pg f N`a . .NuHHxHx NmPO.,p̀gJ,YgJ,Xg )@LNu/a.J,g JgpN& .Nu/J,ZgB,Zap@|J,fJ,4g@4rA| `tJ,6g$J>fp`da. WDHH@|`Ja jJfp`>a 6 gp`.a NJga `N.a .N: WDHH@|.NuH.,a, ggN`NLNuBTNu/.)GL.Nu/Na".pfNl` .Nu/ *H)M*_NuNV/a8.pOЀf~F fa". g f. WDHHrA/ C\IN&XOA\)H pFo0 l( A|Jfp`( A|)pTBlPp`Jg  lN. .N^Nu/a(.pgJfa.pga .` .Nu/.,Hpg)@H `HJ0g"~ l()H(S0f l,N+PB, ` J$g l$N .`~pfa& .NuNVHJ,gJ$f J0fN\` ,Lrg .)AL `J gp l -@H fB J:g$B:aJfJTgaaalp`JTg*0,PRlPr2ҁ lTp0-@ flBTJ$fJ0g>J0g a-@`$J$g l$(g ao `Na.pfN.`N :m8 l0@0;N K¤`K±`K` K`K r  MCN,pfp.` L N^NuH? ,`",dfp`N ,`"A*0R` `mp)@` .Hf& "BAHAtF‚ar2 `,pF̀"€HXpЀfJ,8g <`,[fh ,Xr~fxx",,$,0&,0)C, ,4)@0HPHTJ,7f$&,,ff ,8"Ɯv(SDHH(JgBƜ`)l8Ɯp@7Jg|7 <`BJ~gp,FB,F ,X"a~> f J>gS> ,`dfB> LNuJ VDHHNuH.,pF̀ JgQg:Ugrbg `< H@H,rF́ ЀAK0` 0<!`0<`0<`0<`0<` LNuH! p??NMXO. anr2 LNuH p?p?NMXOLNuJ,6g a B,6` |6aNuNVH.,x r fp` rggx`pgx`fx`bgx`Xg(`Ng ЀAC0H @gxpg$g ЀAC0H @gx ЄЀAC: LN^Nu ,XNu|8NuB,8Nu/ *HJgp:-fA ` *_Nu\<>|/[],:;{}*?"^H*Hp,ƺ MNH&@Jf p: MNH&@ f&M`RK L(NuH*H Ma*@p. MNH&@Jg `p MNIL(NuNVH*H&I Ma-@p. nfRfRK n"KNIJWDHH L(N^Nu/ *H Ma @B*_NuNVH*H&I Manr. @HfRKC Kf MNL(N^Nu/.p\g p/gp`p.Nu/ *Hp Ma*_NuNVH*H.GzxBA-H MCfAN nJgpaJg nƺR`p:+fprA90Jg KaB&@p.f+fp+aLJgVK`Jgp@*g&Y@gS@gH@g<@g<@g(`@Rpc`|JgxJgpf`j-@`z`|`Jf$`Rp(*-@`pANFJf6p c0JgR cj`Rpc^`pcA `pL(N^NuH*Hp Ma&@Jf A%"Ma L(NuH*H Man&@Jf A%"Ma L(NuH*H Ma&@Jfp` K"MfpL(NuH.*HBLN  MNW,NJg|pfa L NuH*HBLNBL MNZB.N~Jg~pf JLgaz L NuH*H.,&I "N]$(Jf `L NuH*Hpa`pfpaPpaJgpa< L NuH*H.J,gD,,fzjnJg Ma*@RR`꼬jn SJg p aRR` SJgNh`L Nu lnJg$ ,fjla$)@nJ,gNzRfp`pNu/Jfgd ,nr.pm p ln(fp(aJgWn`"pmr ln(fUn` pmSnJ,gNSfp`p.NuNVH?4*H.,-lHnHnACN҈ACNҸPO)MrB,N/@$N"/$NPSBf)Mn MJfS",)A)@j-HJ,g*Sf r@ҁr N<`N(Jgp Mabf .jnaJfzJf$J,gNz`NX-@r gdYgg$Ygrgr^gr;g_g2Sg@Sg0Ug>SgBSgFr gr grgHSgBSg,Sg._gSgSg2Sg4Sg.Wgr ggP`\N ,,",0$.&.(؂S-@HfR ."҂R(.fS".(S .fR .(R .fS Ѓ(.f .ЁS$.fRmjnd .m\nV/D$N"/$NNЮΐHm,n( .fla` .fo@aJf`4p@*`(z`"JgaJfaJgJ,gp arN` lnBB . g f` . !m 9n  rNz .r grgJgrgrgrFl~ ,fjnrf lnJf, .lZ ln"HRIa>R . lnpa|`Na n-@ro ln"HE I"Ja .S . lnJ,gr abNa`fF r@ҁ)@pf r Nº` lnJga r&@ n-@ lnC`SdJg~ Ka J" -@ ln"KN;z ln .C`Sdp lna`@a`8a`0J,^g(B fSlp-@`R oB .A pJfR mapJfaJgJ,gp a2N˲` .A-pB nJg@ .l8a b".Ҁ-@n" n"ln`Sd .ѬnѮѮ` lnB`aJgH`aJg<`aJg0 lnJg&a &@ K"lna np lnaD`&lnBJg Ka &@R` lnB n .Aa `-lnBaJgR` . na n"lna .ꐬn`N`|A¤-H`0A±-H`&A-H`A-H`A-H`A-H ,n" -@g2rmp ln(gp ln( nCa-@Sf lnnJ,gNp.aR`apJfJ,^gNJfJfp` ,SA p-H"MfJfgnJgj ,AJg A pa l ,".R/@$ a dA"/$!Hf Aax` M"@fR oB .`p`pL,N^NuH*H&Ic Jg`B` MJfS .R SJgxx`L(Nu/. SJgp a6`.NuH.p~Ff*,`N*l p a a| l p aR`NθLNuH*H MaN. Gf `p0a.p0 MN24Jg L NuH*H Ma. Ggp @e r aNN L NuH.a,ad`LNu0| NuH Hzp&?NN\OJjRLNu/.pFop`p@Ѐl N7` pA0x.NuH.pFo `$p@Ѐl N/`|A0xJg ` LNu/.pFop`p@Ѐl N7` pA0x.NuH.pFo `$p@Ѐl N.`|A0xJg ` LNuNVH*H&I MCa.Jg& L(N^NuNVH*H&I-U nr gr,fR` n-Hp&gp#f* M"Ka^, `NpA90fp`:B r NFrЁr0& n-HpA90f nSH*pL(N^NuNVH!*H&I Up-HA90fp`XB Hr9b rt0`r a@r7" /Ё& n-HpA90f nSH*pL(N^NuH*H&MJg pa\` L(NuH*H&MJg pa` L(NuH!.*H&IRMf-t gp`$p f-r fp`mp`TM`L(NuprA͹QNŬJfNX <NDbNBNjNJfp ap)@)@lı`pNu/.Jg AaN؂aJo `pND.NuaNPN$N״aNZN2NuNVH*H&I.-U np gp fR`Jg p gp;f *p`Bp"gp'fB*R nJg(p g"g nR Sl nRH*p`lf\R`V|JfP np-HJ@g@ gY@g@g@ g @fS|` nR Sl*p` * .B3L(N^NuNVH*H&I-Kp:-f KRKp/Ha oTM` KRK/HNrAЁ o:pNJg nTH"Mf`~NrAЁr ngN.p nrAN4 npOa np MC~Vg gTM`p MCjVgp MCTVfVMp,ƺ nN+ @B-@` nar NJf n"lƼN,V n"MN,Lpg N KapL(N^NuNVH#$*H.NrAЁ@|:BgHnpG?NAPOA"HJfS, op`"Mfpf M"lƼN+ L$N^NuH' ., <"NB"* rF@ @ @ Hlp ?NN\OLNuNVH*H&I. SJg4par/@ a"/,Jg `Jfp`RMRK`pL(N^Nu/ *HA *_Nu/ *H MSH *_NuNV-@pN^NuH.,*/(/B// "a O LNuNVH/.,*.(. -lLN "N`-G .n p aR` R-@ .l$"AN0p a ".N p aR` "N -G .n p aR`A//ACN"R ".Ё.[҅*Z ".Ё".N@8".$Ђ, .ЄN@"Ђ(./ "N./ "N./ "N./ "NNLN^Nu/ *HJfp` MJfS 5*_NuH~pl A*p g ManR`L NuH*H.Jfp`6 a\&@ g( "l  A"K`Sd Ua,*p` Ka pL(NuNVH*H.&Ipr"A"MN.,.pACN(*Jgp`Fp@CgS@gpDbg,p`* gp` .&"Ҁgp` L(N^NuH*H. a&@ g  M"K`Sd K` L(NuH*H~pl AJf A!`R`L Nu/~pl AJg A pN`R`p.Nu/ *H MN,*_NuH. N*@ faJf L NuH., "N*@ faJf L NuH*H.  MN&@ fahJf L(NuNV/ "HJfS R-Ha|*@ g n"Mf M` *_N^NuH.N  lNF,NJg|pfN LNu0X0x-+ NVH*n)MG/ A"n a. L(N^NuNVHN|K / A"na.N„ L N^NuNVHK / A"na.NX L N^Nu/.  l)H .NuNVH*nG/ M"n a. L(N^NuNVH*H&n)M/ -IAaXO.Jj~B5x L(N^NuNVH'*H&n-I~z n-HJg8p%g NJk,R`AB-Hz n-HJg4 r gWg Qg Uf ````p-@r*f(XK KYH"Hl Dz n-H`:p0fA90Xg" .r N:Ѕr0z n-@-H`p-@r.fzz n-Hr*f(XK KYH"Hl -@z n-H`:p0fA90Xg" .r N:XЅr0z n-@-H`plfz n-H`pLfz n-H r%gr g$Ugrgr gSgSgSgSgUg[gSgSgWgUgWg`FXK KYH"P-IJfS-I.gZ .ذl-@ .JjDB`<|%` XK KYH @A-Hp-@`p -@XK KYH HHlr-AD-@`p-@ .".a -@`Rp-@`p -@XK KYH-P`8p-@XK KYH -@.gJgpXfA`A-HA-HJgV .".N8p0Ҁ np9c.gp`p'tԀ n .".N8S-@JfR` n0A -@".ذlto-B".ؒ, SJgS n0`-n`.fp-@PK KQH "(//H .ACaJA-H-@ .".aPO-@ .Jn n0-H .Jo A"nd n-IS-H` .Jn.gb n.-H .Jj&".JoA"nd0-IRS` .SJoA"nd n-I-H` .A-H-@`.fp-@PK KQH "($.R//H ACaA-H-@ .".aPO n"n-H-@-I .Jn.g0.-H .SJoA"nd n-I-H`  n-H .㈀gS .Aa .A-H-@`.fp-@PK KQH "(//H .ACa"A-H-@ .".aPO-@ .rm S".ذo n"n-HS-I .Jn.gD.-H .SJoA"nd n-I-H`.f nah-@ nRpgfpe`pE .SAa` .Jn n0-H .SJo A"ndS n-I-H` .Jn.g\ n.-H .Jo4A"nd(".tl 0R` nS-HR`.f na-@ .A-H-@`XK KYH-P n `~ nJfS -@Юހ".-A.g nJgpNJkR` .Jo&ހ.fSm.gp0`p NJj`T nJgpNJkBR`|l npNJk$R`.gSmp NJj` `pL(N^NuH*H.&U KRKJjDp-`p+pco rdN3Jr0Ё rdN3<. r N32r0Ё r N3$p0Ҁ*L(NuH.,JgA `gA`gA `A LNu/ *Hp0-fSM`p.-fSM *_NuNVH.*H&I/. /.p" M"Ka8L(N^NuNVH.*H&I/. /.p" M"Ka L(N^NuNVH7.,*H&ILtvNlLNHp`p&Jjp`pl"`" , .㈀ f&A-HA"nd 0R`z`-lp)@z-|-@L$?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}0eZH.Jkpop`> A*H0|"Ufp`$ f UfK`p`*U N NpL NuNYpaH0v$j4 eRHHxN XOL`<H@HB8F@BBDGmBCG`BBE?GhNH@.៳G@HB.៷GB.HG,HFކBGGHGHA,BFHFކHC,BFHFކH@HB,ރv݃ށ݃"HA&HCт$B@@H@HBBBނц҇tтNNuNV-@ ,lSm* l"@0;Np")@D`p!)@DN^NuNV)nlpN^N^NupaH?@aLNu<<><H@HB8F@BBDGm\Bm fJgN´Gm fJg "NNJf$Jf HHxNzXOL <@rH@NuNPGm fJg "NbN:GfJfJfJfJfN(NN|`@ @BfJfJf`BCGN\BCG`B BG?GhNH@.音G@HB.| GBHD8"DHB8HA0BAHB:HC<HC>HGFHGBFHF݅dSD҃тBCHD,HBhBD HBH@HA0BA`&8HA0BAHB<.HGHGGHFBGGHFdSD҃тeSD҃т,HBhBE HBBH@HA0`:HA0HB<Őd SEЂeSEЂHEHBhp: "( :HDNJk&JjJfHJfDJf@ f8Nufe.f&NuJkfJfJf fNufe fNuDNuDNuH@HB<<><8F@:G@BBBBGf Ef*Bm.f.g "N^Dg~N8JEfDH@f(Jf"HBfJfFN "H@@@H@NuHBfJfH@@@H@Nu~G@BH@HBDg$f fNujD@8NN҃т m~ӇчE EeNtH@EDH@Nun BCFG Eg0JGf>HBfJf @@H@NuփՂJEf&H@ҁр`"Jf JfN*NP BHB @H@EFGGE G4nҁр G o &tG t`4EH@EDH@Nu Go6HCBBHBG"F,, Df<҃тE m E~ӇчH@E EdDH@NuNh mD҇~чEH@EDH@Nu m JElD`El?NAXONp` < f ?r>?NAXONXp)@Dp` J@kz.gr ?r>?NAXON.p??/ rC?NAO N?/ r  m + ?@H" M"k`Sd2/ k'HH *MJg KN.Jg ЇS"N X" `Jf^ L(N^NuNVH*H-g`-g MNHx -rNHXO.`h MHx/H (rN.XO o "(.*h,` r fS SJf`*Hx -rNXO.-g - ހ` L N^NuH*H.,-g MNFpf MN6ހ|+mp+@+m B- -g rí+@ / -"NrXORfp`pL NuNVH*H&I.,| nJgN+H@+g<@6g S@g@fN~r++WDHH,`:.<r++WDHH,`"|+H@ag S@g @f ~`.<H@ag@gN[@g`Jgp`p@/,// NO *pfp`Jg ,<@`,<@`zJgp`p/,// NO *pfp`Jg|@܆`F|`BJgp`p@@/,// NO *pfp`@Jg|@܆`|`p`.f"n#H#H#E#H#H #H#F L(N^NupaNVH*H.,&I "N&*Jf `LJf@d+f KNJgp3SgpLFr@ҁf `p'@`+fcl + k"M`Sd M +" +N,pf +"N,`"JfJf |` Ы"N,p'@`zJg> m +?@H" k"M`Sd2/ k'HH*MJg, KN(pf ЇS"N0" ` S*MRMJf L(N^NuH*H&I`  KNRfp` HHfpL(NuNVH.*H| @S m2 mR -gp f MNl,Jg ` `p3UgVpLFr@ҁf -+@ `6-gp`pnFrnFf+m ` p+@ `-g0B -rAN,pf`|pgv`nJf" MN :Jg p`^ -+@ +m - Jn MN,Jg `8J g mR S -gp f MNV,Jg ` L N^NuNVHHKX`&M*S gJf fp"N *@Jfp`&p!r MQ/ n"nNL(N^NuNVH4*H-I. M"S-@/HJg`&M nJgN m (,p " K$n"jN*@ g " nѨ`> nݨ*Kƞ`$N8,pf ofp`S p gJf~B /L,N^NuNVH*H-gAXf pAzN Sm mRp`p3Sg$pLFr@ҁf` p+@p`-gHB~- JgB- ` -rAN.Jo~.`zJf`~`dJf MN Jg p`L+m -"- mN+@.JoS mR~`Jf` B~ L N^NuNVH*H-H g-f*+mp+@B- +@ -g`lJgf - Jjr+A - .Jg( -" mN0,pf` g+m-gp+@ rí`+m p0gp`&p`"~KX`Jg Ma,Jg~*U f L N^NuH*H~-g MN.p fJg mN$B -N,pgJfpL NuNwpaNVH!$-@*l4` mN*U fKX`(pUf -.Jg -" mN*U f` lLXH/pA?NA\ON lL)PLJLf~K $`JUg 0-HNRXMHm .N pL$N^NuH0$&HBHCCHBBBЂL NuJjDJjDaDNuaDDNuJjDaDNu/HA4fH@HAHB4g0H@40HB2$Nu/v|dQC|dYC| dUCJAkSC4HBBBHC604HAdSCЁr2HCH@A&$NuNV-HN @NdN^NuNVH $-@NB*@Jfp`.-gBUp` 0-?r>?NAXON BUJLgp`pL$N^NuH.p)@LJkHl A $*HJUg `p )@DpL NuNVH -Hp:(fHHNrA?r?NAXOT/.p;?NA\ON LN^NuH(0/?@A0ACA`d2XH`"Q)_$NML("l$N½NV-Hp NN^NuNV-Hp NN^NuNV/-H <l nШ"($(///(/(/( Ǎ/0(A̼/0HzHl NτA  $.N^Nu%s %s %02d %02d:%02d:%02d %4d NV/ AN*@ fP ,R d@@0;N""4""""".(""."K`K`K` K`KU m m B, A )H ACNV ."<N)@ JgU m m p@ r)A `B, B A )H *_N^NuTZCST6CET-1???-2???-3GMT0H0`HxC9r1fJm$nf Bt`<-fP`<+fJfp <0f8p<Xg<xf(p`"<f<0f xfRH` xfRHJgt<0mT<9n0`<Am>7l4&gHCHCJCfԃek`PPԁek`PP`JgD"/ g"ASH"" L NupaNVH#4*H&n-I g0Bg/ p=?NAPO.Jk g BgpE?NAXO6 ?BgrF?NA\OJgp> nf<~p&(fCp?/ p=?NAPO,-H`FCp?/ p=?NAPO,`0~p&fCBg/ pp0gp` pfp` L N^NuNV)H pN^Nu/.J g  l N` N.NuNrpa)_$H(Jfp`//??<@NAO `)_$H(>?/2?<BNAPO`rNVH'$.*H,p)@LJg"A*?AJkf| NJgr/ /?/ p??NAO .JkRJg pf HlHx?r@?NAO ~`.g  xR HlHx?r@?NAO ` p f N`/ /?/ p??NAO NL$N^Nu?H(?<?/B?<BNA/@2/ ?ABo>BBg?Hx?<BNAO rJWD?A NAO p0L(Nu   "_` "l$L(Jj$AD)@L|ClApfp)@DpNBLNJkp)@LNpa/2H@t `WWf(CQQ`дWWf CQQ g$Nu// "QS@t `| SAgU@c дgSAW  _ $Nu2 ^766^CAT^M1 ^902^3 ^902^4 ^765^^534^V5 ^765^^&2D9^6 ^765^^&2E0^7 ^536^8 ^512^9 ^538^10 ^&2EA^277 ^774^279 ^&2E6^280 ^&2E8^281 ^&2D8^282 ^&2D7^283 ^776^284 ^777^285 ^&20B^286 ^&20D^300 ^788^316 ^789^302 ^781^298 ^765^^536^b305 ^765^^536^i312 ^765^^536^#317 ^765^^536^u319 ^765^^536^*ffffffffffffffffffffffffffffffffffffgfffffg``gffffffffffg`gfffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffggffffffffffgg````ggffffffffffffffffffffgg``ggffffffffffffffffffffffffffffffffffffffffffffffffffffffffff|uuuuuuuuu,4uHLubfuz~uuuuu0LOu0C5SSu5uA$u2M4u:BuPuRu9fu9\Pur,,u(uCJPuuPuu "PuuD QQuuuuuu*u@uOPuXuV Ffuh RxuuPuuuuuuPuuFCu"u Pu4 VBCRXduZPuvPu8|FPu>ARuuPu&6uPuPufuuuuPuuuuu u Pu&u6uTunuuPuuuPuunAunR,FRu.Pu\nPuFu?l-l PuuDuT uC"u2uDTu`uɂPuxu4ubu&Puu=A(A<uPuNuaZuX juvuuHuZRu[utu@u:vuuuuu VNu S\u Tb Rh Pn:uHuQXuQ|Pufx @$u*B0\6x<upBu Huu xPuuC^$u <u>>0>>5>>9\>>V>>h>>z>??>? ???2?? E?"?(8|?,?4?8>&?<?B?F?L)&?P?XN?\?d^?j?r&?v?~ ??ɂ?> *??F??F?>E?>E?>.?>>????????$??6??F@@ X@@h@@"x@&@.@2@:@>@F@J@R@V>@Z@`D >>@b@h(@l@r@v@~@@H@@[@@a@@t@@@@@:@@@@@@X @@ZR@AAA !AAxAA :A">%xA&>$A,>EA2A8A<>ADALAPAZA^AhAnAxA|AAA;AA+AA+AA;AA+AA@AA4AAbA>A>A>AA,AB,B BBB"B(>'(B.B6C^B:>>B@BHCJBL> BR>EBX>FB\BdBh><Bn>Bt>Bz>rB~>VB>BB<BB=BB=BB=&BB=8BB=JBB$BB%BBBB;B>:BBCvBB=&BC;C>rC>=rCC;C>(C">( C(>(8C0>(TC6>(p>>LÆĸ&T|8Ȍ2@3#('")`~+\|&1|2@"3#'4(5[6^7` !8 9{ 0} )>] -_}aA)ACzZBZ\=<[$*]qQ9QS'mM 5MO(%'>+``<>\,wW?WY2,?3;.4:/5=+~2"@34$6&7/{ 8([ 9)] 0=}+*~)#^+~|`<>3,;4.:5-_V<> ?\ :;zZBZ\@\'[{(]},yYAY[1|2@3#6/:<[;=]'(;:{)`'+}`<>\3,?4.!5'"36& 8({ 9)} '?; ^=[+*]'@(#)`'+2"@3#4$6&^7/{ 8([ 9)] 0=} +?\ [{]}'(`~)'*+\|^@`<>\|3,;4.:5-_V<>\|4$'(('1!|3#4$ 8({ 9)} '? +*[:;]'()`'+=  -_??'('<:5;;;;;;< ;;=>;?;;=?;@^;;@^A;@^A;=A;=B;1!2"34$5%6^7&8*9(0)-_=+ qQ9QSwW?WYeE-EGrR:RT tT<TVyYAY[uU=UWiI 1IK oO7OQpP8PR[{]} aA)AC sS;SUdD,DFfF.FHgG/GIhH0HJjJ 2JLkK 3KMlL 4LN;:'@`#~zZBZ\xX@XZcC+CEvV>VXbB*BDnN6NPmM 5MO,<.>/?  !  " !#"$#%$&%'&( ') (*---+++!\|\|(())//**77889944556611223300...              !   O$M*$Muser.dctSPELL$$$.TMP@N Z "%($B$$$I $$P,$>$J$X$h$U1,2vZ"`%f'~l)Rr+&x,./O&3! Y N     A R FFe7PRRe7PWCG DA# @ S0EB A&C B6N/ >M Nf9 FL  R3 ZJSlYXN )JWV S I  C L K  R & X LL CC PP R & Yx FFf  IIf & R ,( [:N)03XfP nSZF!vF(Fe2O,QIC% LOVA2AfAMN Nf ME4 EfA M  R$ K\Loading %s... PROTEXT v%s (c) Arnor %s PROTEXT must be installed firstPROTEXT incorrectly installed - invalid path specifiedPrinter (%c) %-8s %s %sPress any key to continue ...Line too long for system commandNo room for configuration fileInvalid configuration fileDirDirectoryNot enough memoryBad command or file not foundFormatting...Counting...Fixing...Please enter help subject name: Invalid path or file not foundDirectory: filefiles occupying %ld bytes. Free space %ld bytes.KNot enough memory to sort filesToo many files to sortAre you sureFile already being editedSave macro changes madeINK number: INK value: SAVEKEYS filename: LOADKEYS filename: Bad key file%lu bytes remaining in buffer (y/n)? WARNING - text has not been saved. CLEAR text - are you sureGOTO P(age), L(ine) or C(olumn) number: Enter configuration file name: INK %u is %u ( = &%03x)Invalid parametersEnter drive letter: ERASE filename: RENAME old filename: RENAME new filename: MKDIR directory name: RMDIR directory name: COPY from (filename): COPY to (file or path): No file to copyCopying %s to %sNot enough memory for copyFile cannot be copied onto itselfSource name must not be a directoryTOUCH filename: Current date is Current time is Enter new date (mm-dd-yy): (dd-mm-yy): (yy-mm-dd): Enter new time (hh:mm:ss): Invalid dateInvalid timeInvalid directoryToo many open filesCurrently defined variablesUnknown stored commandUnknown microspacing methodString too longParameter(s) expectedNesting too deepVariable expectedEL without IFEI without IFCannot nest repeat loopsUN without RPCode sequence too longWrite file not openData file not definedData file exhaustedBad variable nameData item too longLine too longFilename expectedWarning - ignored commandStoppedUnrecognised HELP subjectCannot find COMMAND.HLPCOMMAND.HLPExpression too complexHexadecimal number expectedIllegal character in expressionNumber too longSyntax errorIllegal operatorVariable name too longUnknown variableMissing ')'Division by zeroSearching...Found: %luReplaced: %luFIND string: Too many wildcardsUnmatched wildcardsOptions are: All,Backwards,Case sensitive,Global,Spaces ignored,Word,numberEnter options (A,B,C,G,S,W,n): REPLACE with: ' not foundReplace (y/n/x)?Incomplete '!' expressionCannot find %s - Insert disc containing file and press a keyFatal error 1Memory error getting file buffersError creating fileError writing fileRepositioning..File already exists. Overwrite itLOAD filename: MERGE filename: SAVE filename: SAVEB filename: Enter new name: Enter extension: Abandon unsaved fileAbandon unsaved other file Enter expression: Result is:Press SPACE or 0-9 to insert into textAdd or Remove (A/R): 1st number: Increment: SIMPLEtoken is %d (&%04x), key number %dDrive does not existMACRO string to assign to key: KEY number (S=shift, C=ctrl, A=alt): words countedTYPE filename: EXEC filename: SPOOL filename: Spool file already openEnter printer driver name: Current CFG filename:PROTEXT STATUS INFORMATIONDictionaries for checking : Dictionary for updating : Page length : Line spacing : Top margin : Header margin : Footer margin : Bottom margin : Side margin : Continuous printing : New page after printing : Headers : Footers : Form feeds : Backups : Search path : Temporary text path : Default filename extension : Memory allocated to text : Memory used by SPELL : Maximum index pointers : Keyboard language : Keyboard type : Undelete buffer size : Background printing : TYPEWRITER MODEEnter text a line at a time then press RETURNQuick dictionary : ONOFFCannot open file '%s'SPLIT filename: SPLIT size: CODE - press required key (ESC to end): ACCESS filename: PROTECT filename: Invalid tabsCannot run external programUnknown variable: Press one of P, R, S, T, V, Many thanks as always to David Foster, without whom ...Press printer control code (A to Z) or marker (#, * or =)Non-break character. Press hyphen or spacePress marker number (0 to 9) or one of [ F L R ? ]CLEAR text. Are you sureCan't swap. Press ESC key. Type line drawing character: Please wait ...Warning - Unrecoverable text. Delete Press macro key, then key sequence (CTRL-f1 to end): Page %u. Press SPACE to print, RETURN to skip, ESC to endPRINTF output filename: PRINTF input filename: at lineSAVEA filename: Can't open output filePress ESC to editType CONT to continue printingRepeat buffer fullAbandon printer buffer contentsPrinter is on STOP with %lu bytes in bufferContinue printingFilling printer bufferLine buffer limit exceeded PROTEXT DocumentProgramAuto Indent On ESC for Command mode Line Macro RJ WW AutFm TypChk f3 for Menu SCR Page Ch Line Col No markers set Mks << No File >> CAPS NUM CAPS+N Overwrite Insert Box Wd-Wrap W-W off Right-Justify Justify Off ESC for Command mode Block not definedCursor in blockWarning - Box overwrite operation. ContinueDelete BOXOut of memoryBox too bigBadly formed box<< Current Text >><< Current Block >>Text too large - must spell check from disc file PROTEXT spelling checker. Checking: Options : S(tore), I(gnore), V(iew), C(hange), L(ookup), B(ack) Dictionary file '%.47s' not foundReading text ...Writing text ...Scanning text ...Sorting words ...Checking words ...Writing dictionary ...Table overflow in dictionaryToo many index wordsIndex pointer table overflowNot enough room for quick dictionaryError reading quick dictionaryScanning quick dictionary ...Loading quick dictionary ...No dictionaryBad dictionary fileChange to: Disc I/O errorStored word buffer fullText file too large - split it and repeat with each part Spell checking ... (Press ESC twice to stop) No matching words foundReplace all occurrencesoccurrences changedPress a number to select word, any other key to continue: Adding words to dictionaryin user word fileWarning - mixed upper and lower caseOptions: U(pper), L(ower), F(irst upper), I(gnore), C(hange), V(iew): Counting words in dictionary Words checked: Word is in dictionaryDo you want to re-load the documentNumber of words checked: Number of unrecognised words:Number of words changed: Number of words stored: WARNING : Text may need re-formattingmatching wordwordsDictionary name: Word to lookup: Find word pattern: Anagram word pattern: Text file name: Name of file with words to insert: Name of file with words to delete: Name of file to spell check: Build input file name: Build output file name: Name of dictionary to list: Start word: Output file: Name of dictionary to count: Dictionary 1 name: Dictionary 2 name: Output dictionary name: Searching dictionary ...SILCBVSILC ULFCIVRead errorCodes too longUnknown command%s in printer driver at line %uBad IF nestingWarning - missing ENDIF *2DIRD Confirm erase '%s'Enter file specification: MFADCNMFADCTREN[M]ap [T]ype [E]rase [R]ename [C] Copy file(s) [D]rive change [ESC] end A' 5FCNMTER#C5DEDisc free space: %ldKNot enough memory to map directoryTree overflowPlease wait while directory tree is scanned Use %c and %c to move to a directory, RETURN to select it, ESC to cancelNo PathUnnamedNew FileLASTUNRECOGNISED WORDUNRECWord too longSelect wordCANCELNumber of spaces to inset text: words in dictionaryCondition required Select with mouse or cursor keys/returnDocProg[RETURN] Open file/dir [A] Show all [TAB] format [F]ile spec. [N]ew dir.. Clear bufferTo finish press EscSaving fileUnwanted parameterExpands to: CONFIG.PRGCONVERT.PRGFSORT.PRGIBIFIL"IR  ! - L! !!!-!L- -!---L>>AVm8BM CCCE)CFx`COCPCS{|CWDA{XDCy@DFwDM{DPyDUqEAzEF EH EIkELkEMEN{XEP EXxFFFM jFN JFO FPFR{XFX GE{XHE XHM JIDjIErIFjIN|,IT{XIUk8L L!L-LF>LLLS \MC|MFMM}*MS,NCzNPHOC{ OF OH ,OMOP PA PEfPL PN 0POPPZPR}VPSPWRC,RJRPqRUtRVtSAzSKlSMSP{XST{SVySW{XTM *UNrbWCj2WFhWM|WT{ZM ppdZCEFNFOHEEFEHOFOH>>CO >-------!-------!-------!-------!-------!-------!-------!-------!----R  @ @ @@Y  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRS;<=>?@ABCD^_`abcdefghijklmnopqrKMuvG   abbbb(b4b@#/8<A  $(,048<@DHLPTX\`dh  $(,048<@DHLPTX\`dh T $$$xx<<Ey09?6C,?zGz??uOs;ZwH01M8O?FnCAy7Aׄ@È@Y@$No memory for expansion stringInsufficient memory for program to runFile '%.56s' not foundDisk error %dDisk fullBad filename '%.60s'Invalid pathPath not found or File already existsToo many files openCannot write to open input fileAccess denied - read only file or directoryNo room for copy stringPress any key to continue: Directory of same name existsFile '%s' is read-onlyFile '%s' already exists Press RETURN after inserting next sheet of paper, or ESC to stop printingYNX`jpvz"0BLXdrPlease insert disk for drive %c and press a key: Drive %c: %s. Abort or Retry : ARIBusOdd AddressInstructionDivisionCHKTRAPPrivilege You may be able to continue by pressing the UNDO key. A 68000 processor exception (%u) has occurred at address %06lx. This occurred OUTSIDE the current program. Description: %s Error. Prog limits: %06lx-%06lx. Offset: %06lx. Registers: a0=%08lx, a1=%08lx, a6=%08lx, a7=%08lx d0=%08lx, d1=%08lx Params: %08lx, %08lx, %08lx, %08lx Locals: %08lx, %08lx, %08lx, %08lx Lastframe: %08lx Ret Addr: %08lx  ((((( H ((((( H  (@b( Z,    "     6 z     "l8( < N$    x           B&    D4$$  2:v , : *4 ( ^   "      2  &r b8L| $* VX^,,0,,0,,,,,     "           .ZR>  L            .0000000\\,,,,,,0\0`000z00000x\\\`\\0`0000000\00000000\\\0xT2 L\ ~"""$ Desk Quit---------------------- Desk Accessory 1 Desk Accessory 2 Desk Accessory 3 Desk Accessory 4 Desk Accessory 5 Desk Accessory 6 PP $P +2 I ^ s   >--------------------------------------------------------------------R >>> WIDTHS.TST >>> This file is for testing the setting of the widths as set up in a printer >>> driver. When printed all the characters should line themselves up on both >>> outer margins. If the characters do not align, then check the character >>> definitions and re-do the widths. >>> NOTE. This file may print extra characters on some printers, for example >>> on daisywheels. >zm >bm 6 >pp on >ff on >>> Insert control codes below to set correct proportional font              . (width of space) !!!!!!!!!! !!!!!!!!!! """""""""" """""""""" ########## ########## $$$$$$$$$$ $$$$$$$$$$ %%%%%%%%%% %%%%%%%%%% &&&&&&&&&& &&&&&&&&&& '''''''''' '''''''''' (((((((((( (((((((((( )))))))))) )))))))))) ********** ********** ++++++++++ ++++++++++ ,,,,,,,,,, ,,,,,,,,,, ---------- ---------- .......... .......... ////////// ////////// 0000000000 0000000000 1111111111 1111111111 2222222222 2222222222 3333333333 3333333333 4444444444 4444444444 5555555555 5555555555 6666666666 6666666666 7777777777 7777777777 8888888888 8888888888 9999999999 9999999999 :::::::::: :::::::::: ;;;;;;;;;; ;;;;;;;;;; <<<<<<<<<< <<<<<<<<<< ========== ========== >>>>>>>>>> >>>>>>>>>> ?????????? ?????????? @@@@@@@@@@ @@@@@@@@@@ AAAAAAAAAA AAAAAAAAAA BBBBBBBBBB BBBBBBBBBB CCCCCCCCCC CCCCCCCCCC DDDDDDDDDD DDDDDDDDDD EEEEEEEEEE EEEEEEEEEE FFFFFFFFFF FFFFFFFFFF GGGGGGGGGG GGGGGGGGGG HHHHHHHHHH HHHHHHHHHH IIIIIIIIII IIIIIIIIII JJJJJJJJJJ JJJJJJJJJJ KKKKKKKKKK KKKKKKKKKK LLLLLLLLLL LLLLLLLLLL MMMMMMMMMM MMMMMMMMMM NNNNNNNNNN NNNNNNNNNN OOOOOOOOOO OOOOOOOOOO PPPPPPPPPP PPPPPPPPPP QQQQQQQQQQ QQQQQQQQQQ RRRRRRRRRR RRRRRRRRRR SSSSSSSSSS SSSSSSSSSS TTTTTTTTTT TTTTTTTTTT UUUUUUUUUU UUUUUUUUUU VVVVVVVVVV VVVVVVVVVV WWWWWWWWWW WWWWWWWWWW XXXXXXXXXX XXXXXXXXXX YYYYYYYYYY YYYYYYYYYY ZZZZZZZZZZ ZZZZZZZZZZ [[[[[[[[[[ [[[[[[[[[[ \\\\\\\\\\ \\\\\\\\\\ ]]]]]]]]]] ]]]]]]]]]] ^^^^^^^^^^ ^^^^^^^^^^ __________ __________ `````````` `````````` aaaaaaaaaa aaaaaaaaaa bbbbbbbbbb bbbbbbbbbb cccccccccc cccccccccc dddddddddd dddddddddd eeeeeeeeee eeeeeeeeee ffffffffff ffffffffff gggggggggg gggggggggg hhhhhhhhhh hhhhhhhhhh iiiiiiiiii iiiiiiiiii jjjjjjjjjj jjjjjjjjjj kkkkkkkkkk kkkkkkkkkk llllllllll llllllllll mmmmmmmmmm mmmmmmmmmm nnnnnnnnnn nnnnnnnnnn oooooooooo oooooooooo pppppppppp pppppppppp qqqqqqqqqq qqqqqqqqqq rrrrrrrrrr rrrrrrrrrr ssssssssss ssssssssss tttttttttt tttttttttt uuuuuuuuuu uuuuuuuuuu vvvvvvvvvv vvvvvvvvvv wwwwwwwwww wwwwwwwwww xxxxxxxxxx xxxxxxxxxx yyyyyyyyyy yyyyyyyyyy zzzzzzzzzz zzzzzzzzzz {{{{{{{{{{ {{{{{{{{{{ |||||||||| |||||||||| }}}}}}}}}} }}}}}}}}}} ~~~~~~~~~~ ~~~~~~~~~~