NNNNNNap NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNN少  @`! #@%`')+/1 O5`79;?/C@E`GIKMOQ S@U`WY[]_a c@e`gimoq s@u`wy{} @` ` @ ` @ ` ǀ ɠ @ ` ׀ ٠ /@` @`!Aa   a!!#A%a')+  @`! #@%`')+/1 O5`79;?/C@E`GIKMOQ S@U`WY[]_a c@e`gimoq s@u`wy{} @` ` @ ` @ ` ǀ ɠ @ ` ׀ ٠ /@` @`!Aa   a!!#A%a')+CZPATCH t CZVOICE .t =SIM_FOUR 8t jSOUND_ST Jt LEES DITo}WINDOW PRGft `.  t..  tCZ101 DOCt CCZ101 DTAt kCZMIDI DTA t CZPATCH PRG"t CZVOICESDTA(t -hPATCH DOC*t 3.&Parameter... # meaning -- ------- 0 Octave 1 Fine Detune 2 Octave and Note Detune 3 Vibrato Waveform 4 Vibrato Delay Time 5 Vibrato Rate 6 Vibrato Depth The following parameters are for line 1: 7 DCO Waveform 1 8 Use DCO Wave 2? (0 = No, 1 = Yes) 9 DCO Waveform 2 10 Ring Modulation 11 Noise Modulation 12 DCA Key Follow 13 DCW Key Follow 14 DCA End Step 15 DCA Initial Attack Rate 16 DCA Initial Attack Level 17 DCA Pre-Sustain Rate(s) [Note: pre- and post-sustain become 18 DCA Pre-Sustain Level(s) first half / second half of 19 DCA Sustain (if any) Rate envelope if no sustain step] 20 DCA Sustain (if any) Level 21 DCA Post-Sustain Rate(s) 22 DCA Post-Sustain Level(s) 23 DCA End Rate 24-33 As 14-23 except for DCW 34-43 As 14-23 except for DCO 44-80 As for 7-43 except for line 2 { 2, 60, 47, 3, 99, 99, 99, 7, 1, 7, 1, 1, 9, 9, 7, 99,99,99,99,99,99,99,99,99, 7, 99,99,99,99,99,99,99,99,99, 7, 99,99,99,99,99,99,99,99,99, 7, 1, 7, 1, 1, 9, 9, 7, 99,99,99,99,99,99,99,99,99, 7, 99,99,99,99,99,99,99,99,99, 7, 99,99,99,99,99,99,99,99,99 ); { /* 0 1 1 2 2 3 3 4 4 5 5 6 6 */ 2, 2, 3, 3, 2, 3, 2, 3, 3, 3, 2, 3, 2, 3, /* line 1 */ /* 7 8 8 9 9 10 10 11 11 12 12 13 13 */ 2, 3, 2, 1, 1, 3, 2, 3, 3, 3, 1, 3, 2, 3, /*14*/ 1, 3, 3, 1, 3, 1, 3, 1, 3, 1, 3, 1, 2, 1, 3, 2, 1, 3, 3, 2, /*24*/ 1, 3, 2, 1, 1, 2, 2, 3, 1, 2, 2, 3, 1, 2, 2, 3, 1, 2, 2, 3, /*34*/ 3, 3, 1, 3, 2, 3, 1, 3, 2, 3, 1, 3, 2, 3, 1, 3, 2, 3, 1, 3, /* line 2 */ 2, 3, 2, 1, 3, 2, 2, 3, 3, 3, 1, 2, 1, 3, 3, 2, 3, 2, 1, 3, 1, 3, 1, 3, 1, 3, 1, 3, 1, 3, 1, 3, 1, 3, 1, 3, 3, 1, 1, 2, 2, 3, 1, 2, 2, 3, 1, 2, 2, 3, 1, 2, 1, 3, 2, 3, 1, 3, 2, 3, 1, 3, 2, 3, 1, 3, 2, 3, 1, 3, 2, 3, 1, 3 }; { /* 0 1 1 2 2 3 3 4 4 5 5 6 6 */ 1, 3, 2,11, 1, 3, 1, 5, 2, 5, 1,33, 1,66, /* 7 8 8 9 9 10 10 11 11 12 12 13 13 14 14 15 15 16 16 */ 1, 2, 1, 2, 2, 2, 1, 3, 2,99, 3, 2, 1, 5, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 1, 3, 2, 3, 2, 2, 4, 3, 2, 3, 3, 9, 2, 3, 3, 4, 2, 3, 3, 4, 2, 3, 3, 4, 2, 3, 1, 9, 2,99, 2, 3, 3,99, 2, 3, 3,99, 2, 3, 3,99, 2, 3, 3,99, 2, 3, 1, 2, 1, 2, 3, 1, 1, 1, 1, 1, 4, 1, 2, 3, 2, 3, 4, 3, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 3, 2, 5, 2, 3, 3, 4, 2, 3, 3, 4, 2, 3, 3, 4, 2, 3, 2, 5, 1,10, 2, 3, 3, 9, 2, 3, 3, 9, 2, 3, 3, 9, 2, 3, 3, 9, 2, 3 };  !#%')+-/13579;=?CGKOSW[_cgkosw{/?O_o?_  #%')+-/13579;=?AGKOS @` @` @` @`` ` ` ` ````````  #%')+-/13579;=?AGKOSW[_cgkosw{/?O_o?_`rW*O*m# - ЭЭм"ҍ¼.A// Bg?<JNA y"h#E?/ NZN"/0<NBNu o AdpNu#BNuNV0/"/ NBd0< AtZ"NB0<NBN^Nu o2/0/ HSoQBNu o0/JfBNuf SNuNV>NCV=@f">/ENX4.uNZP.j/<NX3V.vNZPN$BWN*> ?<NWT>JNX4>NCv@`.v*NZP.v,NZP.|N 36V .rg .Rf.v;NZPJyVl.v=NZP`T.vRNZP09Vy6f.|N`09VHмj.N>VN)`.vdNZP.vfNZP.|N$>BgNWT>KNX4.vzNZP.vNZP>?<NWT.,NX=@JngJnm=|Bn`R0n ( ,m0n (,o..vNZP.vNZP.vNZPBn`Rn0.ڰnm0nB(,JngBn`n.,0.Pм/NoXJ@fD.vNZP.vNZP.,/<vNZPX.vNZPBn`Rn0.ڰy6mJngJnm~>BgNWT>KNX4Bn`*096H2.HЁмj @2n|Rn nm.,096Pм/NpX.,/<vNZPX.|/,NPXRy6>VN)`.wNZP`.wNZPJy6f.w N"` .ag .Af09VR@H6H@3V`">NA6=@ ngJ3V>BgNWT>KNX409VPм./<w2NZPX09VHмj.N>VN)`.wGNZP>BgNWT>KNX4.wINZPN'=@ ng Jnf.w`NZP.wuNZPJng ngJno3N)8`V>N*N-VBWN*`:.wNZP./</<?<NCV >BgNWT.wNZP.wNZP>?< NWT.NX=@>NCVJno=|>BgNWT.wNZP.wNZP>RW/N<0X=@0.аy6l>BgNWT>KNX40.Pм.?./<wNZP\>BgNWT>KNX4.wNZP>NCv@>/<wNZPX`f>BgNWT>KNX4.wNZP>BgNWT>KNX4.wNZP`> NCvJ@g>NCv0.аy6l .yg .Yg`T.xNZP`D.xNZP.H>/<xNZPX``|A|6b@0@t PN .qg .QfJnf BW/ l.x7N"BW/<x{?<NNCv\H-@ f.x/<xNZPXBW/<x?<?<>NCvTBJf\BW/<y ?<=NCv\=@Jnl,.y*/<y/<jNCP.jN!`.y7NZP`(.yV/<yE/<jNCP.jN!By6.ycNZP`p096PЮ.?.N! TJ@fP096PЮ.NpJ@o.096HЮ .?.N!TJ@fRy6```>?<>NCvTN^NuNVBWNB=@0.S@HH@=@0.@r=AA"n/./<?<NCVT/Nr^P _@>NB=@0. H@2.HnSAHHAA"n@>NB=@0."n@>NB=@pH2.RA ngBA`rA"n@>NB=@0."n@ n2nQ nOnB@`p n_nBA`rA"n@>NB=@0."n@ n2ni n2nid >NB=@0."n@ n2ni, nNnB@`p n^nBA`rA nbnBA`rA"n@ Bn`0.%>^WNB=@=n0.%>PWNB=@Jng@0.%>W NB=@0.R@=@ no noBn`Bn0.%>W NB=@=nf$0.%>W NB=@=n`BnJnf nl B@=@=@ nl 0.` nop`0.R@@ nl 2.SA` nor`2.AJnnBB`tAJnnBA`rAA2.9Ү"A@Sn0.no 0.`0.|o 0.no 0.`0.Y@`B@@2.AA2.AA2.9Ү"A@0.%>W NB=@0.2.9Ү"A@0n"<t~002.9Ү"A@0.%>W NB=@0.2.9Ү"A@0n"<t002.9Ү"A@0.%>WNB=@Jnf nl=|0.2.9Ү"A@09H/?<NCVT/Nr^PJf =|`&> n2.90H?N"T=@ n2.90Hnf=|0.%>WNB=@=n0.wHc2.9Ү"A@0.%>WNB=@=nJnf 0<`B@JnfBA` 2.|A2.9Ү"A@=|`& nl0.nlB0.%>WNB=@=n0.%>WNB=@=n`0.nfB0.%>WNB=@=n0.%>WNB=@=n`>0.%>WNB=@=n0.%>WNB=@=n` n2.%0HR@HnoB0.%>WNB=@=n0.%>WNB=@=n`>0.%>WNB=@=n0.%>WNB=@=n n2.AH4.9҂0H|no 0<`B@2.wHcA2n4.9@0.nf 0<`B@JnfBA` 2.|A2n4.9@Rn n2.90Hnn0.%>WNB=@=n0.wHc|2n4.9@0n2.9B(0.R@=@`80n2.9|<0n2.9B(Rn nm0.%>WNB=@0.2.9Ү"A@%09H/?<NCVT/Nr^PJf =|`&> n2.90%H?N"T=@ n2.90%Hnf=|0.%>WNB=@=n0.%>WNB=@=n0.wHc2.9Ү"A@&0.Hc2.9Ү"A@'=|` nl0.nlB0.%>WNB=@=n0.%>WNB=@=n`0.nfB0.%>WNB=@=n0.%>WNB=@=n`>0.%>WNB=@=n0.%>W NB=@=n` n2.%0HR@HnoB0.%>WNB=@=n0.%>WNB=@=n`>0.%>WNB=@=n0.%>W NB=@=n n2.AH4.9҂0%H|no 0<`B@2.wHcA2n4.9@&0.nf 0<`B@2.HcA2n4.9@'Rn n2.90%Hnn0.%>W!NB=@=n0.wHc|2n4.9@&0n2.9B('0.R@=@`80n2.9|<&0n2.9B('Rn nm0.%>W"NB=@0.2.9Ү"A@609H/?<NCVT/Nr^PJf =|`&> n2.906H?N"T=@ n2.906Hnf=|0.%>W#NB=@=n0.%>W$NB=@=n0.Hc2.9Ү"A@7 n@l 0.`0.X@2.9Ү"A@8=|`( nl0.nlB0.%>W%NB=@=n0.%>W&NB=@=n`0.nfB0.%>W'NB=@=n0.%>W(NB=@=n`>0.%>W)NB=@=n0.%>W*NB=@=n` n2.%0HR@HnoB0.%>W%NB=@=n0.%>W&NB=@=n`>0.%>W)NB=@=n0.%>W*NB=@=n n2.AH4.9҂06H|no 0<`B@2.HcA2n4.9@70.nf 0<`B@ n@l 2.`2.XAA2n4.9@8Rn n2.906Hnn0.%>W+NB=@=n0.Hc|2n4.9@70n2.9B(80.R@=@`80n2.9|@70n2.9B(8Rn nmRn nmBn`6 n2.H0H@2nHA|A2nRn nmN^NuNVN"^>N">DN"BWN"BWN">pN"> N">`N">N(nJ@g>DN(nJ@gBWN(nJ@gBWN(nJ@g>pN(nJ@gv>0N(nJ@gfBn`D n2.H0H@|H>N" n2.H0H|H>N"Rn nmBn`BWN"RnJnm>N">N(nJ@gN^NuNVN"^>N">DN"BWN"BWN">pN">N">`N">N(nJ@g>DN(nJ@gBWN(nJ@gBWN(nJ@g>pN(nJ@gv>0N(nJ@gf>pN">1N"Bn`\`>?<NCfT@|f`>?<NCfT@|f.H@.HA2nRn nm>N"N^NuNV y6m>/<y{NZPX.yNZP.z/<yNZPX.zNZP.z=NZP.z/<z/<zkNZPP.z/<zNZPX.zNZP.zNZP`> NCvJ@g>NCv`.Np|^H"9o.{ N!>/<{=?<=NCv\=@Jnl(.{[/<{J/<jNCP.jN!>?.B?<BNCvP./.NpXR@H/?.?<@NCvPJl.{hN!.NpR@H. /<?.?<@NCvPJl.{N!>?<>NCvT l.{N" y6f>/<|NZPX.|/NZP.|FNZP.|/<|rNZPX.|NZP.|NZP.}"/<}/<|NZPP.}X/<}/NZPX.}eNZP.}tNZP`> NCvJ@g>NCvN^NuNV. /<?.?<?NCvPJf n B`@R . /<?.?<?NCvPJf.}N"p` n JfB@`N^NuNV. /<?.?<?NCvPg.}N"p`B@`N^NuNV>ENX4./<}NZPX.~NZP`> NCvJ@g>NCvNWN_N^NuNV./<~NZPX.~&NZP`> NCvJ@g>NCvN^NuNV`>?<NCfT>?<NCfTJfN^NuNV`>?<NCfTJg. H>?<?<NCfXN^NuNV,Bn`60n/2.RAH/?<NCVT/Nr^P _1@0Rn0.n mBn`X=nBn`.0n0(0nl0n=h0=nRn0.n m0n1n0Rn0. Hnn=nBn`.0n0(0nl0n=h0=nRn0.n m0.`N^NuNV=nBn`82.RAH/?<NCVT/Nr^P=@nl=nRn0.n m0.`N^NuNVBnBn`82.RAH/?<NCVT/Nr^P=@no=nRn0.n m0.`N^NuNVBW/<~F?<=NCv\=@l.~QN!./<?.?<?NCvPl.~jN!>?<>NCvTBW/<~?<=NCv\=@Jnl.~N!32Bn` >N&?0n80Rn nQmBn`@>N&?0n0>N&?0n1_Rn nQmBn`@>N&?0nX0>N&?0nX1_Rn nQm>?<>NCvTBW/<~?<=NCv\=@Jnl.~N!Bn`^Bn`J0.d2.HЁм./<?.?<?NCvPl.~N!Rn ndmRn nm>?<>NCvTN^NuNVBn.U/<?.?<?NCvPl(. /<~/<jNCP.jN! .*fJngB@`p=@ .0m .9nJnf.H|=@.U/<?.?<?NCvPl,.,/</<jNCP.jN!`. .0m$ .9n0. .HA|=@0.`N^NuNV.jNX=@l p``Jnfp`rBnBn`T0nj 0m0nj 9o p`<`"0. 2njHA|=@Rn0.nm0.`N^NuNV`>?<NCfTJg>?<NCfT=@. H|Ag|.6N">. H?/<n/<jNC .jN">?<NCfT./</<jNCP.jN!B@`p`N^NuNV>?<(NWT>KNX4>/</<jNCP>?<P/<jNpXWNWT.j/<NZPXN^NuNV>?<MNWTJnl.NZP`>/<NZPX>?<(NWT>KNX4Jnl">?<LNWT.NZP`0.y6f">?<JNWT.NZP`x>0.Pм/NpX?pN_|(o$?<N0.Pм/NpXW`?<(NWT0.Pм./<NZPXN^NuNV>ENX4Jnf.NZP.NZP.NZP.NZP.7NZP.RNZP.tNZP.NZP.NZP.NZP.NZP.NZPN)8./<jNCX>?<P/<jNpXWNWT.j/<NZPX>VN)`.NZP.$NZP.3NZP.KNZP.^NZP.{NZP.NZP.NZP.NZP. NZP.2NZPN^NuNV>BgNWT>JNX4Bn`Bn``>WBgNWT>KNX40.ny6l.0.nPм.?.0.W/<=NZP\Rn n m.FNZP.\NZP.pNZP>NCvH|gn 0.y6mH>BgNWT>JNX4N^NuNV Bn> ?<NWT>JNX4>NCv@` ..NZP> NA6=@ ng >BgNWT>KNX4.NZP.NZP>?<NWT.NX=@JngJnm=|Bn`R0n ( m0n (o..NZP.NZP.NZPBn`Rn0.nmJngBn`n.0.Pм/NoXJ@fD.NZP.NZP./<NZPX.NZPBn`Rn0.y6mJngJnm .0.Pм/NpX=|` .H>/< NZPX .df.NZP`. NZP>NA6=@Jnm D .Df.7NZP>KNX4.:NZP>NA6=@Jnm20.nl&>/<P/<jNCP.jN"Jnm 0.nmJnm `=n0.R@=@`n0.Pм.0.n2.RAAPм/NpX0.Hмj.0.n2.RAAHмj/NC(XRn0.y6m0.R@ny6=|` .H>/<NZPX .mf.NZP`.NZP>NA6=@Jnm .Mf.NZP>KNX4.NZP>NA6=@Jnm20.nl&>/</<jNCP.jN"Jnm 0.nmJnm0`=n> BgNWT>JNX40.nf>/<NZPX`>?./<6/<fNZPX.096Pм/NpXRy6>NA6=@Sy60.y6o,>6/</<jNCP.jN"`Z0.noN0.nnB.NZP>6?.RW?./</<jNC .jN"0.y6n0.no0.noJnm. NZP=n`0.no0.Pм./NpX0.Hмj./bNC(X0.R@=@`Z0.Pм.0.S@Pм/NpX0.Hмj.0.S@Hмj/NC(XRn0.nm.0.S@Pм/NpX.b0.S@Hмj/NC(X` 0.Pм./NpX0.Hмj./bNC(X0.S@=@`Z0.Pм.0.R@Pм/NpX0.Hмj.0.R@Hмj/NC(XSn0.nnno.0.nnPм/NpX.b0.nnHмj/NC(XRn0.R@nn=|`."NZPBW/?<GNCv\>NCv=@>?<NCvT-@=|.&N"> BgNWT>JNX4.>NZP.XNZP> ?<NWT.NX=@m.iNZP .:f .am .zn. .Am .Zo.lN"`p.H|f..H>/</<jNCP.jN"`B.H>W?<NCvT./NpX .\fBn=|`0n (\f=nRn0.nmBn`0n2nirRn0.nm0nB(r.r?<;NCvT0.HЎ./^NpX`./^NpXBW/^?<NNCv\=@HJg./<NZPX`./<NZPX0.HJfJnmBW/^?<=NCv\=@l../</<jNCP.jN"`.+NZP`096R@|m*>/<C/<jNCP.jN"`z096Pм.?.N! TJ@fV096Pм.NpJ@o0096Hмj.?.N!TJ@fRy6```R>?<>NCvT=|.yN">?<NCvT.?<;NCvT`.NZPJngN9J@m|q`z.NZPJngf.NZP.j/<NX`B.NZP.H>/<NZPX``H |ur W h,N .qg .QfN^NuNVN;-@`"./<NZPX.N"BW/<?<NNCv\HJf>/NCvм-@ n йmN>b`z`v.7NZP.ZNZP./<~NZPX.NZP>NCv@|yf.NZP.N"N>BW/<?<NNCv\HJf>/NCvм-@`>/NCvм-@ nB n йoN>b```.NZP.NZP.NZP. NZP.)NZP.ENZP._NZP.iNZP`> NCvJ@g>NCv`>NCv@|ygN^NuNVBnB`,0.Pм.NpR@HѮRn0.y6m .`N^NuNV.\//.N=P|f 0. `=n `.0.Pм/N=XJ@gn.\/NpX./ /N=P|f 0.`@. 0.Pм/N=XJ@fRn0.y6m^0.`N^NuNV nJfp`n n f nHR` n "nRR nJg n f n B` nH"nRRJ@fB@`N^NuNV. Np=@fp`X.Npn=@Bn`.>/. 0.HЮ/Np@PJ@fp`Rn0.noB@`N^NuNV.NZPBW/?<6NCv\/././.Nr P/Nr P#N^NuNVBW/<?<NNCv\HJg B`>>/NCv @-P.?<ANCvT./<NZPXBW/<?<NCv@|yf.?<>NCvTJnm$>/<?<=NCv\=@Jnl../</<jNCP.jN"p`B./<NZPX>BgNWT.NZPBnB`>?<NWT>KNX4>/<&NZPX0.Pм.NpR@H-@0.Pм./.?.?<@NCvPl.)N! .Ѯ0.Hмj./<?.?<@NCvPJl.RN!Rn0.y6m& .ѹ .>?<>NCvTB@`N^NuNV>BgNWT>KNX4.{NZP>6SW/<NZPX>?<NWTN'=@|fN,\ nf.NZP ngJnmx0.y6lj0.`N^NuNV0n2n "<00`0n2n "<X>0n"<8?0N$,T``0n2n "<X>0n"<8?0N"T`\`X0n2n "<X>0n"<8?0N#T`"``|gH|gz|g`N^NuNV09H/?<NCVT/Nr^PJfBW?.NAT``>?.NAT`N^NuNVBn` n"n R RRn nmN^Nu#NN/9Nu#NM/9Nu#NA/9NuNV f*# A# yB>a^ yB`( dA #BWa<`A#BWa,N^NuNV#A #>a yBN^NuNVH y*PX(y`#<%gH>?.aT`B@=@=@H|-fRn<#fRn| <0fG=|`"JnlBn0. HA|=@<0m<9oҾ<*f=\=|<.fBn`0. HA|=@<0m<9oܾ<*f=\Bn<lfRnA-HH`:Jng -|U\`-|TBW/.?<?< // NTlTJngT`Jng -|U\`-|TBW/.Bg?< // NTlTJngT`Jng>0?.apTJng -|U\`-|TBW/.Bg?<// NTlTJngT`dJng>0?.aT>x?.aTJng -|U\`-|T<XgBW`>/.Bg?<// NTlTJngT`# y-PX(y`=\0.H@B.`>// aPP=|`>// aPP=|`x>// adP.a2.^AAo>// axPX=|`.H>?.aT``|C|5b@0@ PN.at<no Jnm<.0.F=@JnfJ . g$ n -fSF nH>?.atTR`.H>?.a\T0.SnJ@n` nH>?.a?.aT0.SnJ@nfJL8N^NuNVJng y R`.. H?Nc,T. HN^NuNVJnl=| n-h-P>/. /./.NLN N^NuNVJnl=| n-h-P>/. /./.NI N^NuNVH*nBG`RGJf0JL N^NuNVHJnn=|` no=|*nBB/. /.NPl -/. /.NSP//-_-_ BB/. /.NPf00.`00.SnJ@fe00B .`|BG`*SG/</<@$/. /.NR"-A -@/</-|dm0Hd|0HHǏdHG0H |0H0H H@|0HB .JL N^NuNVHJnn=|` no=|*nBB/. /.NPl -/. /.NSP//-_-_ BB/. /.NPf*0Jng.`00.SnJ@fB .`VBG`*SG/</<@$/. /.NR"-A -@/</^_FGGi$CF^FHFBFLNuNTZ`jNTZ`rp`/CLa&NuH"H@4HA6BCXY@gAg@A@i?prxz|JfJgh`/܇ۄ>/ ܇ۄHEЅ*HFBFBEHE҆хgG h`*ҁg0fg$фgG hjNTZ`(rp`"Go_GHGBG|QPLNu /"/@Nu /"/aNuHNTv$Dv$%NCV.Bg?<NCVX>fNX4>ENX4BW?<?<NCVX>eNX4N^NuNV>fNX4.Bg?<NCVX>NCV|l.?<NCVTN^NuNV>YNX40. | H@.H>NXT0.| H@.H>NXTN^NuNV>NXT. H>NXTN^NuNV`>NCvJg. H>?<NCvTN^NuNV-n>NCv@ . e .f.@` nBp`` .cNYS` >NXT` nB .`` .f>NXT`NYS n ( g .b`` .f>NXT`` NYS .b`*>NXT``H |rW hN`.@>NXT nR`N^NuNV>DNX4> NXT>DNX4N^NuNV>ENX4./<.NZPX.3NZP`> NCvJ@g>NCvNW>N_N^NuNVN^#@.NC.?< NCvT.@NuNVHNiBW/<tsNbpX>/<tsNbpX>/<tsNbpX n2n B*n`&HHм @g H| `HRJf> /.N[XJL N^NuNVH BWNhX#F#JByD.tia*n`N`RJgHHм @fJg2 "g 'fFH>/ RNX(@ f.N/ aVX H> M2GBRG.Ra`BG`RG M2GJg5pHHм @gJ5pg M2GBRGH`BWN`LBW/ RNbXJ@g.R/<`aX`l>N`L ->f@>/ TNbX|f>B?<Nb\|f.R/<ma|X`$BW/ RN_xX|g.R/<|aVX`>?/ NXJf>*/ NXJg-|b.8?<NT>/ ?<Nn\<f./ aX`^.H?/.aZ\.Np>RWNqD(@./ NpX.a>/ ?<Nn\<f`.a`|g`JfBaSyD.JNz|f./<a*XB/9F?9DN\>N_JL0N^NuNV|./NpX. /NoX./NoX.?< NT>N_N^NuNVH*n yJ XJRyDJL N^NuNVH*n. (nGVfJL8N^NuNVHNi^>|fp`>Ni08*@úJnfU.ts/.NpXJ@f U0`R`.tx/.NpXJ@fU0`2>/.?Nn\J@g3#3p`U0JL N^NuNVBW?. /.a:\N^NuNVBW?. /.a"\N^NuNV>?. /.a\N^NuNVN_>NN^NuNVHBG`0м.N_RG|mJLN^NuNVH*n0-|g*.N`-g .NfB@H+@+@Bm m>N`LJL N^NuNVH>.>NjT*@ f3 3p`NBF0|f>?<>NqT<l|>Ni>NiJFf0``33pJL N^NuNVN^NuNVH*n0-| |f, -<o >/-?Nh\>Gg mp`J-gJg-g;| `;| `>0- D@H/?Nb\Bm +mB@JL N^NuNVHNi^>|fp`>Ni08*@úJn fUJnfU.ts/.NpXJ@fU;n 0``.tx/.NpXJ@fU0`d>/.?Nn\J@g>Ni33p`0U>B-H?Nb\BWB-H?Nb\0JL N^NuNVBW?. /.a\N^NuNVBW?. /.a\N^NuNV>?. /.a\N^NuNVH>NjT*@ f3 3p`$>?-/. ?<BNqP+@U -JL N^NuNV>B?.a\N^NuNVH. *n Sm mH"m|R``.H?NcrTJL N^NuNVH. *n BF:-fp`$JfV-fN>Ne<+@+@fm`2m>NdJ@gm@`;| H"mR`-gA+H +@ mR-gz>/-?Nh\<Bm `n-g>< g -мb" -:>/-?Nh\<+mBm `( -:>/-?Nh\<;| +mFg mp`H|JL N^NuNVH>NjT*@ fB@`-fB@`pJL N^NuNVH>NjT*@ fB@`0|JL N^NuNV>aJ@g <ts`BN^NuNVH>.^GORG>a*@ fB` >/ aXJL N^NuNVH (y*T`ZB@0-BA2-@F@J@g>NhPB`:B@0-ne `*f>a*@ f>NhPB`(M*U`JL0N^NuNVH n*PB@0. X@me n `F(MB@0. HH@B@H@B@0-n 9@B@0,F@9@( n ;n B@0-F@;@# PJL0N^NuNVH >.|?GG0@>NhX*@fB`* R*@(M9GB@0,F@9@.Pa 9JL0N^NuNVH *nQB@0-BA2-@F@J@g>NhPp`(yeeecd(T`e2 BA2-IHABAHAЁ" BB4,JHBBBHB҂b #B@`n BA2-IHABAHAЁf T0(mB@0-F@;@ T*`* BA2,IHABAHAЁfB@0-lB@0,F@9@(`(#B@JL0N^NuNVH *n.a>. ^GORG>a-@fB`J n(PPg2d`Sn Jn f`B0. B0. `%Sn Jn f>/.aXJL0N^NuNVN^NuNVN^NuNVH >.HμgR*y(G.Nz|f3 3p`>Bg/ N\ JL0N^NuNVH>NjT*@ fp`vJnfB@`j-g3 3p`L0|g>/. / Nl@P`0-g>/. / NjP``>/. / NkPJL N^NuNVH|BG` f 0`RG|m33pJLN^NuNVp2.`F@HB@N^NuNVHBG`>aRG|mJLN^NuNVH 0.8*@ú0.@BUB-+| BB> Bg/ N\> ?< / N\JL0N^NuNVH>.|e3 3B`0B@08*@ú-f3 3B` JL N^NuNVH *n(n >.B@=@=@``Rnnc L2n  fB@0.ncf>?.B@0.W B2.Ё//-/ Nq=@B0.ѭJnf33p`^=n`8Rn>?</</-/ Nq=@B0.ѭnb4 -o+mB@0.JL0N^NuNVH*n>?./. /-/ Nq=@Jnf33p` B0.ѭ -o+mB@0.JL N^NuNV=|Bn n(g -|m` n(g-|m n(g .м-@ n0(| =@Bn=n`=|` n  f.=|Jng 0.R@|l N2n| Rn`\ n  fRJngLp2.|A=@0.n|l^0.n` N2n| Rn0.SnJ@fR ` N2n"n QR RnSnRn nlJnf>0.S@@/ nNXJnfB@0.N^NuNVH*nH|=G`H>Bg?<NCfX0SGJ@n0.JL N^NuNVH*nH=@ M2n$BG-M`H M2G $f: n $g.?< NT.$?<NT 2HЁR-@RGnm 2HЁg.?< NT0.JL N^NuNVH*n 0.8мú-@~.a&M`RJg :fJgc .Am .On*K`K0.`BW/ ?<o n1GBG`BW/ ?<NNq\JgB@`0<>`d>ONqJgB@`0<>`J.?<=NqT>o n1GBG`,.?<ANqT>``||b@0@ PN0JL8N^NuNV n am n zn n nHRJfN^NuNVH *n (n`RJff .JL0N^NuNVH *n(n `op`lp`JgJfHHAJL0N^NuNVH *n(n >.` JfB@`RRSGoHgHHAJL0N^NuNVH *n (nf .JL0N^NuNVH *n(M`RJf HJL0N^NuNVN^NuNVH *n(n `$H>a0H>a&op`lp` JfJfB@JL0N^NuNVH>.|am |zn|0JLN^Nu _B0Z"yCCbNC NJg .NuNV n=h.0n/0n/Nr P/?.?<?NqPN^NuNV n=h.0n/0n/Nr P/?.?<@NqPN^Nu#NNA/9NNuNVBBJlDRBJ lD RB0. -@0.2. An=@ .gDN^NuNV/. /.Nr| 9RN^Nu C"/lD&/nm <"`\Df r`:pmn2pr`,tl 0BAHA`Ԃփd`efJojDDJojD#R&Nu Stack Overflow$C runtimeCON:LST:$/:ER_,9FS`n888&B88888888(n888888888888888&B88888888(n888CDMQXcdmqrx-/809T9*-/809T5B9*9Getting old voices from file Getting random voice weights from file n making voicer no current voice sending voice s receiving voice enter voice name:  [ESC to abort] Name has invalid character in it - re-try There is already a voice named '%s' - re-trywriting voice '%s' to file alNo voices to loadLoading voice '%s' wNew weirdness factor: Input 1 or higher [ESC to abort]fEnter string(s) to search for: [ESC to abort] # name --- ----%03d '%s'Continue search (y/n)? %c*** NONE-- Hit any key to continue --q Bad option '%c' - re-tryWARNING: There is not enough space on the disk to store more voicesCZVOICES.DTAfile '%s' not found -- attempting to create CZVOICES.DTACZVOICES.DTAcannot create '%s'CZVOICES.DTA'%s' created CZVOICES.DTACZVOICES.DTAcannot open '%s'CZVOICES.DTAfile opened cannot find '%s'CZVOICES.DTAreading in voice data At voice number limit [%d], to save current voice: (1) use 'quit' option to exit program. (2) rename file %s to any other name. CZVOICES.DTA (3) restart program and save voice. Note: To access the voices stored in the old %s it must be renamed back to %s CZVOICES.DTACZVOICES.DTAand the current %s named something else CZVOICES.DTAtemporarily. -- hit any key to continue --Not enough free space on disk to store voice dataCZVOICES.DTACannot open '%s'CZVOICES.DTAError while writing voice name to fileError while writing voice data to fileWARNING: there may not be enough space on the current disk for another voiceWARNING: voice number limit of %d reached To save more voices: (1) use 'quit' option to exit program. (2) rename file %s to any other name. CZVOICES.DTA (3) restart program. Note: To access the voices stored in the old %s it must be renamed back to %s CZVOICES.DTACZVOICES.DTAand the current %s named something else CZVOICES.DTAtemporarily. -- hit any key to continue --unexpected end-of-file in voice file -- check voicesUnexpected end-of-file in voice file -- check voices%s -- hit any key to exit -- %s -- hit any key to continue -- KEYTAB.DTACannot open 'KEYTAB.DTA'Read error on 'KEYTAB.DTA'CZ101.DTACannot open random weight fileCZMIDI.DTACannot open MIDI table fileUnexpected EOF in 'CZMIDI.DTA'Unexpected EOF in '%s'CZ101.DTAUnexpected EOF in '%s'CZ101.DTABad handshaking from synth - Make sure MIDI channel = 1Expecting %x but received %xNext byte = %xweirdness factor = 1 in %d%s---%03dNONERANDOM'%s'OPTIONS ------- n = generate and load new voice s = save currently loaded [and edited] voice r = reload current voice l = load previously saved voice a = audition next voice in library w = change weirdness factor e = edit voice library f = find voice by name q = quit Option? current voice # %sEDIT OPTIONS ---- ------- c = change voice name d = delete voice D = delete range of voices m = move voice M = move range of voices r = read in and append voices from alternate file x = execute changes and return to main menu q = quit edit menu, abandoning changes Option? [%3d] %s -- hit any key to continue or ESC to quit listing --c enter voice name:  [ESC to abort] Name has invalid character in it - re-try There is already a voice named '%s' - re-try%c Delete voice... Delete from voice... up through voice... Last voice number must be greater than first voice number [%d]%c Move voice... First voice to move... up through voice... Last voice number must be greater than first voice number [%d]move voice %d in front of voice...move voices %d to %d in front of voice... (End of file is position %d)END OF FILE highest legal position is %d block cannot be moved inside itself! Legal ranges are from 0 to %d and from %d to %d Moving voice(s)...r Enter disk if necessary[Drive:] Path/File name: [ESC to abort] Bad drive; Drive letter must be in the range A-Z... re-tryBad drive; Drive '%c' not installed... re-try'%s' not found, re-try... '%s' found...Cannot open '%s' for reading -- aborting...reading in voice data voices number limit reached (%d) -- file read abortedRe-insert original disk if necessaryx q Restoring library to pre-edit state from disk Bad option '%c' - re-tryCZVOICES.DTA'%s' not found. CZVOICES.DTAPlease insert voice disk. Not enough room on disk to save file Do you have a formatted disk with at least %ld free bytes available to insert (y/n)? y Insert diskCZVOICES.DTAn Aborting save... It is recommended that you quit out of this program and create enough space on a disk to save the file as desired Hit any key to continue...checking disk usage CZVOICES.DTACZVOICES.DTA'%s' deleted CZVOICES.DTACZVOICES.DTACannot create voice file. Ensure disk is inserted and not write protected. Re-try (y/n)? y n '%s' deleted/not found and current voices NOT saved!CZVOICES.DTA'%s' created. CZVOICES.DTACZVOICES.DTACannot open '%s' -- Aborting saveCZVOICES.DTA'%s' opened for reading/writing... CZVOICES.DTASaving voice number %dUnknown write error on voice file - bye!Unknown write error on voice file - bye!enter voice number: [ESC to abort, RETURN to list, voices 0-%d available] Bad input - re-tryFE2FFG GTGTGTGTGTGTGTEGTGTGTFGTE|GTGTF GTGTGTGTGTGTGTGTGTGTFE2FFG GTGTGTGTGTGTGTEGTGTGTFGTE|GTGTF ???tzGz?@bM? 6C,>h>>j򚼯H>5y09>. &֔=|׽=yd=a-=,%hIv<+<V<Ҳ؉h>>j򚼯H>5y09>. &֔=|׽=yd=a-=,%hIv<+<V<Ҳ؉ @:<b B">&*&*8 0:>z."D"ܬ  0:~."D"Ԭ  0:."D"   .     <      .4  0 R :    "  &&&ZF6$>" "   "        F<(    "@    "0   "  *$(6 $  >( *       0    .,2 (*0          *   4 >    4 B *  @>f X(&((",< R(&(("4`t PV>0 "~J     F0 6""       , ,D( 0 <    >  h 0HN&  jhF \@(B4.J".86 Jp &""@2&"fNbd4*R">* h4,\b heaven organ`0@@B rR `]F#9pThe nagging deadPq&DC` B)( d@BP50D˕Z3E @YReal Nice PatchA 0 0 `e\dY GS0 PP5C Jc+Wň28warm electric grand 0 e0xPeU04hA Akbar's Organ `ҳ0 eP@d*GV28  ub{fi*Blimey!0@ 0 ';`G,8t%`T"c)c;TxFoonboard``qQQ0$pT W2ZWq0 @|>&NWU( Demibanjop`qQQ0$pT W2ZWq0 @|>&NWU( Kermit's Harpsichord`P0@0fKZj`Psif043`T1xLightray` @@ P``0`BzI189!0`2ۛBj 8j<Johnny Fonebone`P@d478$P@d@E8;ɜ07Hh# ySelma's Brass0!Ѐ0ՕxzPP5@GHT&0 s0HPianjo0@00)@W;R6K f h0 `b B,Kb%Ys9 s 0Oscar Goolox@bPp -'"+@d@lxWhAnother Organ p `P ]~ G&SH h`kEByForcefield0P @BzZm  r;h*1ZardozQ# &@ at @d0DJRQPIPhantomPe0 'eO<07K0+@B0 5T)IOrgan #556 @B @oN5tk06bw;POY&&FPXGubblesupp p@0&kf@)f(,Q%`Pcm(;Sitangop b@B@.~Rl 7U<(dz0 f+YE@Goofstringsp!1 0@WJWvHaP`pD ";3zT)JC@+Breedingppp0`pjpT05)(" P5PuYPI J0T Autobend P 99% T RHOrgan #213q LH pT[WR0&XIBram Stoker0 p0hP0יP0a%49 05Zf9PWow-Wow-YehAQ   06u,0 K,zDDDD}   0&u,0 K,zDDDD4}Bud's bassoon0`bcQah%n&'  0Fdhigh 'n' sadAAU]Y1 ) h@h.8cPxElectric Harpsicordo Su%@B% @Bd%f) Buck Whinestein `P`c E7Z Wb(2  ;( v9 Cheryl Whinestein `P`  E7Z Wb(2  ;( v9 Electric Scots Organ `P`  vE7Z Wb(2  ;( v9 Church Organ 5က0_P7IQ`&h 0R6bwe are talking bizarre@`@0@@F?0Wus+ @d0"! p*trombone bassAc@P` w4 lDDDD0EsP5%p J/v gflDDDDsynth brass0A2sqp w0VLlDDDDp w0VLlDDDDFUNCTIONAL OVERVIEW Automatic Patch Generation and Archiving for the DX100 and CZ-101 The following instructions apply both to DXPATCH.PRG and CZPATCH.PRG . Both of these programs interact with the user identically. To use either, MIDI your synthesizer to the ST (ST MIDI IN -> synth MIDI OUT, ST MIDI OUT -> synth MIDI IN) and run the program (in any resolution). Due to extensive memory requirements, it might be necessary to de-activate RAM disks before doing so, however. You will then be presented with a menu of options. They are: n - Generate and load a random voice into the synthesizer. The voice does not go into any permanent storage area of the synth. It goes into a temporary area for the currently sounding voice. To store it *in the synthesizer* permanently, follow the normal synthesizer procedure for storing an edited voice. The program can store the voice on disk using the next option. s - Save the synthesizer's currently active voice on disk. Random voices can be improved using the synth's normal editing facilities, for instance, before being saved. You will be prompted to give the voice a name before it is saved. l - Load a voice from the program's library into the synth. You will be prompted for which voice you want. The loaded voice's name and number will be displayed on the upper right of the screen. r - Re-load the current voice (shown on upper right of screen) into synth. Useful if you made an error while editing the voice with the synthesizer. Random voices are re-loaded correctly. a - Audition next voice in library. Loads next voice number (see upper right of screen) into synth. Will wrap around from end of library to beginning. f - Find voice by name. Will prompt you for a search string and will find all voice names that contain that string. The search is case sensitive. Unfortunately, there is no wildcarding. It is possible to find names that contain *more* than one string. To do so, enter the strings on one line, separating them with the *keypad* plus key. In this mode, the keypad plus key will generate a special symbol to avoid confusion with the normal plus key. w - Change weirdness factor. When random voices are generated, the weirdness factor determines whether the voice is more like a musical tone or a sound effect. The *higher* the weirdness factor is set, the more *normal* the voice is. This is because the chance that the program sets a voice parameter to a weird value is 1/(weirdness factor). This factor is displayed in the upper right of the screen. e - Go to the edit screen (explained below). q - Quit program. The 'e' option above changes you to the edit menu, which has the following options: c - Change the name of a library voice. d - Delete a voice. D - Delete a range of voices. m - Move a voice to a new position in the file. Useful for grouping similar voices or for putting your favorites in the first positions. M - Move a range of voices. r - Read in an alternate voice file and append it to the current library. This is useful if you are sharing voice files with others or manage your voices in several separate files (one file for each class of voice, for example). When prompted, specify the file as follows: [Drive:][\Path\]Filename For instance, if your file was VOICES.OLD in folder OLD on drive A, it would be specified as A:\OLD\VOICES.OLD. If drive A is the drive you were already using, you could drop A: and just type \OLD\VOICES.OLD. Finally, if OLD was the folder that you started the program from, you could just type VOICES.OLD. x - Execute the changes specified in this editing session and save them to disk. q - Quit the session without saving the changes specified. If you goofed up, this is your option. The library will be restored to its pre-edit form by reading it back off the disk. A lot of sample voices have been included on the disk for you to try out. These two programs have various support files associated with them on the disk. For DXPATCH.PRG to function, the files DX100.DTA and KEYTAB.DTA must be present in the same folder. For CZPATCH.PRG to function the files CZ101.DTA, CZMIDI.DTA and KEYTAB.DTA must be present in the same folder. KEYTAB.DTA contains the keyboard translation tables used in the 'find voice' menu option. CZMIDI.DTA contains tables to translate CZ101 vibrato setting levels to the MIDI data the CZ expects. The program you run will expect to find a voice library file (DXVOICES.DTA and CZVOICES.DTA respectively) in the same folder. If one is not found, an empty one will be created. Otherwise, the file will be read in automatically and be ready for use. No more than 1000 voices are allowed in one file. The DX100.DTA and CZ101.DTA files contain the parameters used by the respective programs to generate random voices. Unlike the previous files mentioned, which are all binary, these are in ASCII and can be edited with any word processor or editor to customize them as you see fit. Each file contains three large groups of numbers, each group enclosed in braces [{}]. The numbers in each group correspond in a one-to-one manner to the voice parameters of the voice being generated. For the DX100, these voice parameters are listed on page 54 of the DX100 owner's manual. For the CZ101, these parameters are listed in the file CZ101.DOC on the disk. In the first group of numbers, each number is the highest value that its respective voice parameter can assume (lowest value is always 0). In the second and third group of numbers, there are two numbers for each parameter. The first number is the value the program uses when it has decided to set this parameter to a weird value (see 'w' menu option, above), the next number is the normal value. Numbers in the third group tell the program how many times it should generate a random number in the range (0 - maximum parameter value). Numbers in the second group tell the program whether it should set the parameter to the highest, lowest, or median value just generated (1=high, 2=median, 3=low). This whole process can be thought of as glorified die rolling. The first group of numbers defines the number of sides on the die. The third group of numbers tells you how many times to roll the die, and the second group of numbers tells you whether you are taking the highest, lowest or median value you roll. Note that the program will ignore any non-numeric characters that are put in the file, so you can put notes in the file if you wish. The program will ignore *any* characters that are between asterisks [*], including numbers. So the numbers already in the files that are between a '/*' and '*/' are just there to help you see which values correspond to which parameter numbers, and are ignored by the program. NOTES There are many safety features included in the program to prevent you from inadvertently clobbering your voice file or going over the 1000 voice limit (if you have more than 1000 voices, remember the 'r' edit option!). However, if you manage to do it anyway, remember that as long as you stay in the program you can save a new voice file with the 'x' edit option (as long as you move one voice so that the program knows the voice library has changed and will therefore re-save the file). Also note that a voice is not lost as long as it can be sounded on your synth (if you accidentally quit before saving). Just restart the program and save the voice! Nonetheless, it is advisable to occasionally backup your voice library just for your own peace of mind. If you change the voice parameter files, back them up first. Don't set the weirdness factor to greater than 32767 (highest value for an normal integer on the ST). HINTS Some voices generated for the CZ will be garbage, a few will be perfect without any change, but many will need just a little fiddling to be very useful. Try each line select. Hit the ring mod button. If the voice does things you don't like after the key is released, make the DCA1 or DCA2 END step closer to the SUSTAIN step (or nearer first step if no SUSTAIN). If the voice clicks when the key is hit, reduce the attack RATE of the first step of either DCA1 or DCA2. If the voice is too quiet raise the LEVEL of the SUSTAIN step of DCA1 (or first step if no SUSTAIN). If the voice seems out of tune check the value of NOTE in the DETUNE section, if it is 1 or 11, change it. Remember the re-load option in the main menu. The DX is much harder to fine tune. On the other hand, the random voices usually sound much better to start with. But don't ask me how you fix 'em if they don't. [Actually, if you are familiar with all the voice parameters, you can probably fine tune the voices.] You might consider putting some code on the end of the voice name to tell you what it is useful for (e.g. 10=effect, 20=bass, 30=lead, 40=bell). You could then use the main menu find option to find all voices with a certain code. Alternatively, you could use the edit menu move option to keep all your voices sorted or you could keep similar voices in separate files. Or you could be like me and just sit there. Have fun! If you have any comments, questions, or suggestions, I can be reached via USENET electronic mail. My address is: ucbvax!pett@socrates.ucsf.edu. . . t=.. . tCZVOICE DOC0t > CZVOICE PRG2t A CZ VOICE Features A PUBLIC DOMAIN program for managing CZ sound data from the ST. (C) 1986, by Jim Glish. The CZ_VOICE manager supports reading and writing sound data from the Casio CZ series of digital synthesizers to Atari ST voice files. Sound data may be saved and restored one voice and file at a time, or may be loaded using a custom batch file which can handle multiple saves and restores. The following sections briefly describe the features of the program. EXECUTE A BATCH FILE To read a group of voices from the Casio to voice files, or to write sound data to the Casio from a group of voice files can be accomplished by this option. Enter the file name of a previously created batch file to save/restore a number of voices. CREATE A BATCH FILE Enter the full file name of a batch file to be created (including optional path name). Enter the raw voice number (PRESETS are 1-16, INTERNALS are 33-48, and CARTRIDGE are 65-80), followed by the read/write code number followed by the voice file name. The format is VV_R_F......F, where VV=raw voice, R=0 for read from Casio, R=1 for write to Casio, _=space, and F....F=file name with extension. Press RETURN after each VV_R_F.....F group is entered. You can mix read and write entries so that you can easily save all internal voices and restore them with saved voice files in one batch operation. READ FROM A CASIO VOICE To read sound data from the Casio, enter the number of the voice to be copied (using raw voice number SEE ABOVE, or I1, P4, C3 for internal voice #1, preset 4, or cart voice #3, etc.). Then enter name of voice file to be written to disk. Sound data will be transferred to disk file. NOTE: Sound data is in the same format as that used with CASIO.PRG, also a PUBLIC DOMAIN program. WRITE TO A CASIO VOICE To write sound data to the Casio from an existing voice file, enter the name of the voice file followed by the Voice Number to be written on the Casio (NOTE: only INTERNAL voices can be written to). See READ FROM for voice number formats. ENTER SOUND DATA This feature is available in the complete version and permits you to entry sound data directly from the keyboard uses the entry format shown in the Casio SOUND DATA book. (See format of page in SHOW DATA below). This makes entering sound data extremely fast and easy. SHOW SOUND DATA Shows CZ sound data from any PRESET, INTERNAL, or CART voice number in the format shown in the Casio SOUND DATA book. Useful to check a voice against the sound data sheets. DISK DIRECTORY Will show a sorted directory listing of the selected disk path, including wild cards. For a complete version of the program including the Sound Data entry feature, pre-saved Casio default voices, and full docs, send $15 to: Jim Glish, 13119 Pleasant Pl, Burnsville, MN, 55337. nnnnnnnnnnnnnnnnnn` o"h###,Oc.N//Bg?<JNA Bb3Nz0NmNV?.?. ?<NMN^ _ONNV?.?<NMN^ _ONNV?.?<NMN^ _ONNV?.?<NMN^ _ONOUT_CHAR ?Hz~/,HNVNHA-HP?<?.Nf~N^,_X> _TNOUT_ESCAPE?Hz~/,HNVNHA -HP?<N~0.?N~ N^,_X> _TNNV?.?. ?<NNN^ _ONAT ?Hz~(/,HNVNHA.-HP?<YNl0.@?N0.@?NN^,_X> _XNWRITE_LINE?Hz~,/,HNVNHA,-HP?.f?.dNvHyHn? _OVNWRITE_INT ?Hz~0/,HNVNHA(-HP?.?.NHy?.NXN^,_X> _\NWRITE_CENT?Hz~7/,HNVNHAF-HPp(r.tHA=@~8?.d?.N~9HyHn? _OTNCLEAR_LINE?Hz~>/,HNVNHA-HP?.?<NH?<lNN^,_X> _TNCLEAR_EOS ?Hz~B/,HNVNHA-HP?<JNN^,_X>NuCLEAR_TOS ?Hz~F/,HNVNHA-HP?<dNTN^,_X>NuTI ?Hz~/,HNVNHAP-HPp=@~~0.r.A]0.ArA0p @WCBd~0.R@=@`~~Bn~p.nm~~~~0.ArA0p-@g~~Bn`~~~ p=@~!0.R@=@~"~#~$~$0.r.A_0.ArA0?Hz?<NR0@Bd:~%~&0. 2.CtA0Br0A=@~'0.R@=@~(`~)~*0.@d~+0.D@=@~,~-~.=n~/0.N^,_X> _ONCZ_HREQ ?Hz~/,HNVNHAt-HP0.S@=@~?<?<N~?<?<DN~?<BgN~ ?<BgN~ ?<?<pN~ ?<?<Nx~ ?<?.Nj~ N^,_X> _TNCZ_HREQ1 ?Hz~/,HNVNHA&-HP?<?<pN"~?<?<1N~N^,_X>NuCZ_HOUT ?Hz~/,HNVNHAt-HP0.S@=@~?<?<N~?<?<DN~?<BgN~?<BgN~ ?<?<pN~!?<?< N~"?<?.Nt~#N^,_X> _TNCZ_CONF ?Hz~)/,HNVNHA-HP?<?<N,~*N^,_X>NuMIDI_DOUT ?Hz~1/,HNVNHAl-HP=n~2~3~30.2|CrA0=A~4?<?.N~50.R@=@~60.n^0.|WÄCBd~7N^,_X> _XNMIDI_CLEAR?Hz~>/,HNVNHA,-HP~>?<NJ@j~??<NZ=@`~@N^,_X>NuMIDI_DIN ?Hz~G/,HNVNHAr-HP=n~H~I~I?<N|=@~J0.2|C2.CA~K0.R@=@~L0.|W0.n^ÄCBd~MN^,_X> _XNCBUF_TO_MB?Hz~V/,HNVNHA-HPp=@ nn~W~W~X0.S@@R@=@~Y0.^@2|C2.4|EtA0rAEA~Z0.^@R@2|C2.4|EtA0JrAEA~[Rn`Z~\N^,_X>NuMBUF_TO_CB?Hz~e/,HNVNHA-HPp=@ nn~f~f~g0.S@@R@=@~h0.2|C2.^A4|EtA0rA2.^ARA6|GvA0K|CEA~iRn`v~jN^,_X>NuCZ_VIN ?Hz~o/,HNVNHAR-HPp~pN(~q?.N~r?<?<Nh~sN4~t?<?<NT~uN~vN~wN^,_X> _TNCZ_VOUT ?Hz~|/,HNVNHA@-HPN~}?.N"~~?<?<N~?<?<N><N><N^,_X> _TNCZ_BUF_SHO?Hz></,HNVNHA-HPp=@ nn><><><0.rArAfN><><HyN XHyHz?<N?.?<NHz?<NX><><0.2|CHyrA0??<NlHz:?<NX><Rn`D><HyN X><N^,_X>Nu CZ_BUF_PRI?Hz></,HNVJNHAJ01|A -HPHnJHz.?<N><p=@ nn><><><0.rArAf^><><HnJN X><HnJN X><HnJHz?<N?.?<NHz?<NX><><HnJ0.2|CrA0??<NlHz\?<NX><Rn`6><HnJN XHnJN X><HnJN><HnJNN^,_X>Nu prn:NV/.?< NAN^ _ONNV?<NNN^NuNV?./. /.?<NNN^ _O NNV/.?<NNN^ _ONSETCOLOR ?Hz~H/,HNVNHA@-HP?.0A0.R@}?0.R@}?0.R@}?~INvrN^,_X> _PNNV/.?<NAN^ _ONNV?./. ?<NNAN^ _ONNV?<ONAN^NuSHOW_FILE ?Hz~\/,HNVNHA-HP"n-I~]~^p=@~_~_0.rA_"n0.2|C r1JAVCBdH~`~a"n0.2|C Hyr1?NX~b0.~cR@2|C =@`~dHyN X~e~fN^,_X> _XNORDER_DIR ?Hz~m/,HNVNHA-HP0.rH=@~n~n0.rAo~~o0.R@=@=n0.nnH~o~p0.n=@~q~q0.rAo ~r0.n=@~s0.2|Cc,AjHp?<0.2|Cc,AjHp?<Nh0@d~t~uBn`~u~v0.2|Cc,ALCELp $Q~w0.2|Cc,2.4|Ec,ALCALEp $Q~x0.2|Cc,~yCLALEp $Q~z0.n=@~{~|`Rn`~}0.~~rH=@~`xN^,_X> _TNSORT_DIR ?Hz></,HNVNHAz-HPp=@><><><0.2|Cc,"nALEp $Q><0.R@=@><NJ@j><?.N><3><N^,_X> _XNDIR_LIST ?Hz></,HNVNHA-HP?<BgN><?< NZ><?< ?< CO$O p QN><Hy?<PHyVNNX><BgBgNT><?< N><p9VJ@f><CPEV><p=@p9V=@0.nn<><><0.2|CO2.CPtAV0ARn`><p9VR@2|COrA><HyLN ><p=@p=@><?.?.N><Nh><HyBgNJ@j0><?<?< CFO$OpQ><N`><><HyLN><09S@?<~/<p=@><p=@=y0.nn><><?.?.N><0.2|Cc,ALHpNH><0.nl*><0.R@=@><0.><R@=@><`2><><p=@><p=@><0.><@=@><><Rn`J><N^,_X>NuNo files match specification!*.*Search path: GET_V_FILE?Hz></,HNVNHA-HP?<BgN><?< N<><?< ?< CO$O"p!QN><Hy?<PHnNNX><BgBgN8><HyHn?<NJ@f:><><CEpE$Q><NX><HyN><><N^,_X>NuEnter name of VOICE FILE to read: WRITE_V_FI?Hz></,HNVNHA-HP?<BgNp><?< N><?< ?< CO$O#p"QN><Hy?<PHnNNX><BgBgN><HyHn?<CEpE"Q><HyND><HyN><N^,_X>NuEnter name of VOICE FILE to write: ZVIE ?Hz></,HNVNHAV-HPp.riAWp.rIAWÄCBd4><p @><C IO$Op?$QN><@ =@><p.rpAWp.rPAWÄCBd0><p @><C IO$Op?$Q><N>=@><p.rcAWp.rCAWÄCBd4><p @><C IO$Op?$QN><@@=@><p.r0A\p.r9A_CBd"><C IO$Op?$QN=@><=n><0.N^,_X> _ORNGET_VOICE ?Hz></,HNVNHA-HP?<BgN><?< Np><?< ?< CO$O)p(QN><Hy?< Hy:NNX><C: IO$O4p$QN=@><BgBgNF><NJ@f><><?.N\><N><><N^,_X>NuEnter number of voice to get from CZ101: WRITE_VOIC?Hz>< /,HNVNHA-HPN><NJ@f><><?<BgN><?< N4><?< ?< CO$O+p*QN><Hy?< Hy:NNX><C: IO$O4p$QN=@><BgBgN ><NJ@f><?.N><><N^,_X>NuEnter number of voice to be sent to CZ101: GET_BATCH ?Hz><%/,HNVNHA-HP?<?<N><&N><'?<BgN`><(?<?< CO$OpQN><)Hy?<PHnPNNX><*BgBgN><+HyHHnP?<,NJ@f><-p=@p=@><.?<?<CLO$OpQN4></?<?<C&O$OpQN><0?<?<*CO$OpQN><1?<?<>CO$OpQN><2><209L@e"><3><4HyHHnNHnN?<PHnNNX><5?.?.?.N><6Hn?<70.rAf><8><9?.0.V@?N><:HyHz?<NHn?<;HyHn?<><=><>CEpE$Q><??.N><@HyN><A><B><C0.J@f><D><E?.0.V@?N ><FHyHzZ?<NHn?<G?.N><HHyHn?<ICEpE"Q><JHyND><KHyN><L><M0.r>Al><N0.><O@=@`&><P><P><Q0.R@=@><Rp=@><S><T`><U><VHyHN><W?<N><X?< CFO$OpQN><YHy?<PHnNNX><ZN^,_X>NuPress any key to continueR W VV R F..........FEnter MIDI batch file name: WRITE_BATC?Hz><f/,HNVNHA-HP?<?<N:><gNJ><h?<BgN><i?<?< CO$OpQN\><jHy?<PHnPNNX><kBgBgN><lHyHHnP?<m?<?< C|O$O4p3QN><nHyHzJ?< NX><o?<?<C"O$O p QN><p?<?<CO$O6p5QN><q?<?<CO$OpQNf><r?<?<ChO$OpQN@><s?<?<*CBO$OpQN><t?<?<>CO$OpQN><up=@p=@><v><w><w?.?.Nn><x?<BgN:><yHy?<PHnNNX><zBgBgN><{0.r>Al><|0.><}@=@`&><~><~><p=@><0.R@=@><><p.J@g*><HyHHn?<`4><HyHN><N^,_X>NuVV R F..........FVV=Voice # , R [0=Read, 1=Write], F..F=Voice File NameEnter using:, Cart 65-80)(Use raw voice numbers - Preset 1-16, Internal 33-48Enter MIDI batch file name: CZ_BUF_INI?Hz></,HNVNHAb-HPp=@ nn2><><><0.2|CrA><Rn`><p><p ><p><p><p><p'=@><><0.r5An4><0.2|CrA><0.T@=@><`><p ><p#><p4><p`=@><><0.rnAn4><0.2|CrA><0.T@=@><`><pE><N><N^,_X>NuE_OC ?Hz></,HNVNHA-HP?< Nݦ><?< ?< CzO$OpQNR><Hy?< Hy:NNX><C: IO$O4p$QN=@><=n><0.N^,_X>NuEnter VOICE number : EUEFN?Hz></,HNVNHA-HP0.J@Z0.rA]CBd 0.@=@><0.rA^0.rA]CBd0.@@@D=@><0.rA^0.r.A]CBd0.@@@=@><0.r-A^0.r=A]CBd0.@@@=@><0.N^,_X> _TNI_AE ?Hz></,HNVNHA~-HP0.`N><><p=@`X><><p=@`F><><p =@`4><><p=@`"><S@ @b@0;N><0.N^,_X> _TNI_EA ?Hz></,HNVNHAV-HP0.r Al=n><0.rA^0.r-A]CBd0.@@@!=@><0.r,A^0.r0A]CBd0.@@@;=@><0.r/A^0.r@A]CBd0.@@@C=@><0.r?A^0.rPA]CBd0.@@@=@><0.rOA^0.r`A]CBd0.@@@=@><0.r_A^0.rdA]CBd0.@@@=@><=n><0.N^,_X> _TNI_AE ?Hz></,HNVNHA0-HP0.r Al0.@@ =@><0.rA^0.r0A]CBd0.@@@`=@><0.r/A^0.r@A]CBd0.@@@=@><0.r?A^0.rPA]CBd0.@@@=@><0.rOA^0.r`A]CBd0.@r `@#=@><0.r_A^0.rdA]CBd0.@r `@G=@><=n><0.N^,_X> _TNI_ET ?Hz></,HNVNHA>-HP0.r Al 0.R@=@><0.rA^0.r0A]CBd0.@@@#=@><0.r/A^0.r@A]CBd0.@@@G=@><0.r?A^0.rPA]CBd0.@@@=@><0.rOA^0.r`A]CBd0.@@@=@><0.r_A^0.rcA]CBd0.@@@?=@><0.rcAf=|><=n><0.N^,_X> _TNC_AE ?Hz></,HNVNHA-HP0.`><><Bn`><><p =@`><><p@=@`><><=|`><><=|`r><><=|p@=@`Z><><=|=|`B><><=|=|`*><S@ @b@0;NL\n><0.Hn=@><0.N^,_X> _TNC_AE ?Hz>< /,HNVNHA-HP0.`>< >< Bn`>< >< p=@`>< >< p=@`><><p =@`><><p=@`><><p=@`r><><p=@p@=@`Z><><p=@=|`B><><p=@=|`*>< @b@0;N<0.Hn=@><0.N^,_X> _TNC_E ?Hz></,HNVNHA-HP0.`><><Bn`><><p=@`>< >< p,=@`><!><!p9=@`><"><"pF=@`><#><#pS=@`t><$><$p`=@`b><%><%pn=@`P><&><&=|`>><'><'=|`,><( @ b @0;N<)=n><*0.N^,_X> _TNC_E ?Hz><1/,HNVNHA-HP0.`><2><2Bn`><3><3p=@`><4><4p=@`><5><5p=@`><6><6p$=@`><7><7p/=@`t><8><8p:=@`b><9><9pE=@`P><:><:pR=@`>><;><;p_=@`,><< @ b @0;N<==n><>0.N^,_X> _TNN_AE ?Hz><C/,HNVNHA-HP0.`><D><D0.rAo0.rcH=@` ><DBn`v><E><E0.wrcHP@=@`V><F><F0.rAo0.wrcH=@` ><FBn` ><GS@ @b@0;N`><H0.N^,_X> _XNN_EE ?Hz><M/,HNVNHA-HP0.rAo><N0.`l><O><O0.r?Ao0.X@=@` ><O=n`V><P><P0.rcH=@`8><Q><Q0.@=@` ><RS@ @b@0;N><S`><T><TBn><U0.N^,_X> _XNCZ_OCT ?Hz><^/,HNVNHA-HP?.?<FN~Hy?<HnNNX><_?.?<FNR><`Hn?<aHn?<b?.?<KNHy?<HnNNX><cC IO$Op?$QN=@><d0.J@W0.rAWCBdp=@><e?.?<KNRHy?.NX><f0.=@><g0.rAf><hp9P@A><i0.rAf><jp9X@A><kN^,_X> _TNCZ_LINE_EN?Hz><}/,HNVNHA -HP?.?<N̔Hy?<HnNNX><~Hn?<Hn?<Hn?<Hn?<?.?<N˂><"n0`><><HyHz ?<NX`><><HyHz ?<NX`d><><HyHz ?<NX`B><><HyHz ?<NX` >< @b@0;Nf><"n0A><><?.?< NʦHy?<HnNNX><?.?< Nz><Hn?<Hn?<><?.?<NɸHy?<HnNNX><Hn?<0.A><?.?< N8><0.`l><><HyHz?< NX`><><HyHzv?< NX`|><><HyHzJ?< NX`Z>< @ bN@0;NBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB><><?.?<NZHy?<HnNNX><?.?<N.><Hn?<`$><pHyHz@?<NX><><?.?<NǰHy?<HnNNX><C IO$Op?$QN=@><0.`V><><p`\><><p `H><><p`4><><p$` >< @b@0;N><?.?<NHy?.?<NX><><?.?<"NHy?<HnNNX><C IO$Op?$QN=@><?.?<"Nt0.r Al&Hy?<0N?.?<NX`><Hy?.?<NX><p9nA><><?.?<'NHy?<HnNNX><C IO$Op?$QN=@><?.?<'NŰ0.r Al&Hy?<0N?.?<NX`><Hy?.?<NX><?.NA><><?.?<.N<C IO$Op?$QNZ=@><0.rA]0.rA^ÄCBdp=@><?.?<.NHy?.?<NX><?.N6A><><?.?<3NĊHy?<HnNNX><C IO$Op?$QNƨ=@><?.?<3N>0.r Al&Hy?<0N?.?<NX`><Hy?.?<NX><?.N*=@><0.A><0.|A><0.H|A><><?.?<9NÐHy?<HnNNX><C IO$Op?$QNŮ=@><?.?<9ND0.r Al&Hy?<0N?.?<NX`><Hy?.?<NX><?.N=@><0.A><0.|A><0.H|A><><?.?<>N–Hy?<HnNNX><C IO$Op?$QNĴ=@><?.?<>NJ0.r Al&Hy?<0N?.?<NX`><Hy?.?<NX><?.N(=@><0.A><0.|A><0.H|A><?.N><N^,_X> _\N+ - ON OFF OFF ON OFF OFF ONonOFFoff 2 1 1+2'1+21+1'1+1CZ_ENV_ENT?Hz></,HNVNHA-HPBn><Bn><p=@><p=@><Bn><Bn><><0.J@W0.rA_CBd><><0.2.SAAA=@><><?.?.NHy?<HnNNX><C IO$Op?$QN¸=@><?.?.NN><0.r Al.><Hy?<0N?.?<NX><` ><><Hy?.?<NX><?.?.NN=@><Bn><><0.R@??.NHy?<HnNNX><C IO$Op?$QN=@><0.R@??.Np><0.r Al.><Hy?<0N?.?<NX><` ><><Hy?.?<NX><?.?.Nf=@><0.T@??.NHy?<HnNNX><Hn?<=n0.T@??.NbHyHz?<NX><Hn?<=n0.T@??.NHyHzf?<NX><0.no><><=|`><><Bn><0.n2|C2.nCA><0.nR@2|C2.CA><=n><0.R@=@><0.T@=@>< `0>< 0.2|C2.SACA>< 0.rAo`>< >< 0.T@2.SAAA=@><0.2|C2.4|EtA0BEA><><N^,_X> _PNendsusDCO_WAVE_E?Hz></,HNVNHA-HP?.?.N,Hy?<HnNNX><Bn><C IO$Op?$QNB=@><0.J@fp=@><?.?.NHy?.?<NX><?.NJ=@><?.0.@ ?NHy?<HnNNX><C IO$Op?$QN=@>< ?.0.@ ?N6Hy?.?<NX><!?.N=@><"0.n=@><#0.2|C2.ICA><$0.R@2|C2.RA4|EtA0r8A2.|AEA><%N^,_X> _\NDCW_KEY_EN?Hz><-/,HNVNHA-HP?.?.NBHy?<HnNNX><.C IO$Op?$QN`=@></?.?.NHy?.NX><0?.N=@><10.2|C2.CA><20.R@2|C2.CA><3N^,_X> _\NDCA_KEY_EN?Hz><;/,HNVNHA-HP?.?.N>Hy?<HnNNX><<=?.?.NHy?.NX><>?.N =@><?0.2|C2.CA><@0.R@2|C2.CA><AN^,_X> _\NCZ_ENV_SHO?Hz><L/,HNVNHA-HP0.2|CrA0RA=A><MBn><Np=@><Op=@><PBn><QBn><R><R0.ްnnZ><S><T0.2.SAAA=@><U0.n2|CrA0p@=A><V0.rAW0.rA^CBd4><W0.rAf pc=@`><W0.crHR@=@><X0.rAW0.rA^CBd6><Y0.rAf pc=@`><Y0.Q@crwHR@=@><Z0.rAW0.rA^CBd4><[0.rwAf pc=@`><[0.crwHR@=@><\?.?.N><]0.r Al.><^Hy?<0N?.?<NX><_` ><`><`Hy?.?<NX><a0.nR@2|CrA0=A><b0.rA=@><c0.rAW0.rCA^CBd><d0.Y@=@><e0.rAW0.rA^CBd4><f0.rAf pc=@`><f0.crHR@=@><g0.rAW0.rA^CBd><h0.@=@><i0.R@??.ND><j0.r Al.><kHy?<0N?.?<NX><l` ><m><mHy?.?<NX><n0.|J@g(0.T@??.NHyHzr?<NX><o0.R@=@><p0.T@=@><q`><r0.T@??.NzHyHz ?<NX><sN^,_X> _PNendsusDCO_WAVE_S?Hz><z/,HNVNHA-HP0.2|CrA0Ip@=A><{0.2|CrA0Ip@=A><|0.R@2|CrA0I=A><}0.`v><~><~p=@`><><p=@`r><><p=@``><><p=@`N><><p=@`<><><0.Z@=@`&>< @b@0;N~><?.?.NHy?.?<NX><0.`v><><p=@`><><p=@`r><><p=@``><><p=@`N><><p=@`<><><0.Z@=@`&>< @b@0;N~><?.0.@ ?N.Hy?.?<NX><N^,_X> _\NDCA_KEY_SH?Hz></,HNVNHAN-HP0.2|CrA0=A><?.?.NHy?.NX><N^,_X> _\NDCW_KEY_SH?Hz></,HNVNHAN-HP0.2|CrA0=A><?.?.N*Hy?.NX><N^,_X> _\NCZ_LINE_SH?Hz></,HNVNHA-HP"np9rA2><?.?<N><"n0`><><HyHzx?<NX`><><HyHzP?<NX`d><><HyHz*?<NX`B><><HyHz?<NX` >< @b@0;Nf><><p9r8A=@><?.?< N><0.`l><><HyHz?< NX`><><HyHzZ?< NX`|><><HyHz.?< NX`Z>< @ bN@0;NBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB><><p9=@><?.?<N><Hn?<`><HyHzP?<NX><p9?<}/<*?NN|N0=@><?.?<NRHy?.?<NX><p92. A=@><?.?<"N0.r Al&Hy?<0N?.?<NX`><Hy?.?<NX><p9=@><0.rAo0.2.IA=@` ><Bn><?.?<'N|0.r Al&Hy?<0N?.?<NX`><Hy?.?<NX><><p9=@><0.`N><><p=@`><><p=@`|><><p=@`j><><p=@`X><U@ @bJ@0;N>>>>>>>>>>>>>>>>>>>>>>>>>>>><?.?<.NdHy?.?<NX><p9=@><?.?<3N.0.r Al&Hy?<0N?.?<NX`><Hy?.?<NX><p9=@><?.?<9N0.r Al&Hy?<0N?.?<NX`><Hy?.?<NX><p9=@><?.?<>NZ0.r Al&Hy?<0N?.?<NX`><Hy?.?<NX><><p9r A=@><?.?<FN><0.rAoHy?<-NX`><Hy?<+NX><?.?<KN><0.J@gHy?<1NX`><Hy?<0NX><N^,_X> _PN+ - ON OFF OFF ON OFF OFF 1+2'1+1' 2 1 CZ_SOUND_L?Hz></,HNVNHA-HP?<?<NN><?<?<NHyHz?<NX><0.rA^0.r!A]CBdHyHz?<NX><0.r A^0.r1A]CBdHyHz?<NX><0.r0AoHyHzX?< NX><HyHz0?<N0.rA?NX><N^,_X> _TN Voice Number CartridgeInternalPresetCZ Sound Data for CZ_LINE_LA?Hz></,HNVNHAN-HP?.?.Nv><HyHz^?<(NX><HyHz ?<$NX><N^,_X> _XN Wave Delay Rate Depth +/- RangeLine Ring Noise +/- Octave Note FineCZ_ENV_LAB?Hz></,HNVNHA-HP?.?.N><HyHz?<$NX><0.R@??.N|><HyHz?<NX><0.T@??.NN><HyHzR?<NX>< 0.V@??.N >< HyHz ?<NX>< N^,_X> _XNS/ELEVELRATESTEP 1 2 3 4 5 6 7 8CZ_WAVE_LA?Hz></,HNVNHAf-HP?<?<N><HyHz?<NX><?<?<N><?< ?<NN><HyHzn?<NX><?<?<NL><?<?<N><HyHz ?<NX><?<?<N><?<?<*N><HyHz?<NX><?<?<*N><?< ?<*N><HyHz~?<NX><?<?<*N><?<?<*Nf>< HyHz0?<NX><!?<?<*Nd><"N^,_X> _XNDCA 2 - KEY FOLLOWDCW 2 - KEY FOLLOWDCO 2 - FIRST SECONDDCA 1 - KEY FOLLOWDCW 1 - KEY FOLLOWDCO 1 - FIRST SECONDCZ_SHOW ?Hz><)/,HNVNHA*-HPN8><*?<?<CO$OpQN><+Hy?< Hy:NNX><,C: IO$O4p$QN`38><-?98N><.?<?<NB></?<?<N ><0?98N><1?<?<HnN><2?<?<?<Nb><3?<?< ?<7?<N ><4?< ?<?<N><5?<?< ?<&?<N><6?<?<?<NN><7?<?< ?<?<N><80.rAW0.rAWÄCBd><9?<?<9?<HN><:?<?<1?<p?<N|><;?< ?<??<LNV><<=?<?<??<JN><>?<?<1?<N?<><?N ><@Hy?< Hy:NNX><AN8><BN^,_X>NuNumber of voice to display : CZ_ENTER ?Hz><I/,HNVNHAF-HP?<?<NN><J?<?< N><KHyHz?<NN X><L?<?< N><MHyHz?<ANN X><N?<?< N><OHyHz6?<@NN X><P?< ?< NR><QHyHz?<@NN X><R?< ?< N"><SHyHzZ?<;NN X><THy?< Hy:NNX><Up3><VN8><XN^,_X>Numessage at the bottom of the main menu page. Thanks JG To obtain the latest version (1.1) of this program refer to the parameters using the same format as used on the SHOW VOICE page.This feature enables you to directly enter all of the CZ101 voiceNot available in this versionCZ_ENTERX ?Hz><_/,HNVNHA-HP?<?<CO$OpQN><`Hy?< Hy:NNX><aC: IO$O4p$QNd38><b?98N><c?<?<NF><d?<?<N$><f?<BgN><g?<HnN><h?<?<?<NN><i?<?< ?<7?<NT><j?< ?<?<N ><k?<?< ?<&?<N(><l?<?<?<N><m?<?< ?<?<N><n0.rAW0.rAWÄCBd><o?<?<9?<HN><p?<?<1?<p?<Nܰ><q?< ?<??<LNh><r?<?<1?<_?<N܄><s?<?<??<JN@><t?<?<1?<N?<><uNT><vBgBgN^><wN><x?98N><yN8><zN^,_X>NuNumber of voice to enter : TEST_MENU ?Hz></,HNVNHA.-HPN8><p!38><><><ByF><?< ?<N><N><?<CdO$OpQN><?<?< CO$O pQNHy?98NX><?<?< CO$OpQN><?<?< CO$OpQN><?<?< CVO$Op QN`><?<?< CO$OpQN:><><?<NJ@f><?<N3F><09F`|><><?98N?< ?<NN`?< ?<NzNx`d><><N"38`N><><Nn`>><><Nl?98N`$><@1 @b@0;Nt><09Fr5AW09FrAWÄCBd><N^,_X>Nu5. EXIT back to main menu4. ZERO voice3. PRINT voice data buffer2. CHANGE voice number1. GET data from Casio voice # CZ MIDI Test MenuSHOW_CREDI?Hz></,HNVNHA-HP?<?<N><N><?<(?<i?<X?<iNq><?<X?<Nq><?<(?<Nq><?<(?<iNq><?<?< N><HyHz?<<?<?< N><HyHz@?<;NX><?<?< NZ><HyHz?<NX><?<?< N0><HyHz?<;NX><?<?< N><HyHz0?<9NX><?<?< N><HyHz?<8NX><?<?< N><HyHz?<NX><?<?< N><HyHz&?<8NX><By><N^,_X>Nu Jim Glish, 13119 Pleasant Pl, Burnsville, MN, 55337.documentation, send $15 to:default CZ voice files (preset and internal voices) and to get the most complete version, along with a set of theIf you find this program to be useful, or if you would like(Shareware) use on 6/13/86.OSS Personal Pascal and is being released for Public DomainThe CZ MIDI Voice Manager by Jim Glish was created using MAIN_MENU ?Hz></,HNVNHA-HP?<?<N><N><BgBgNL><?<?< CO$OpQN><HyHz?<NX><?<?< ?<?< Nq><?<?<C"O$O/p.QNP><?<?<CO$O.p-QN*><?<?<C|O$O+p*QN><?<?<C4O$O"p!QN><?<?<CO$O&p%QN><?<?<CO$OpQN><?< ?<CpO$OpQNl><?< C<09rAfN><N^,_X>NuPress ESC to Exit7. LIST disk directory6. SHOW voice data5. ENTER voice data and send to CZ1014. WRITE TO CZ101 from voice file3. READ FROM CZ101 and store as voice file2. CREATE multiple voice batch save/load file1. EXECUTE multiple voice batch save/load file(C) 1986, by Jim GlishCZ MIDI Voice Manager v0.6 - A0B1|A01|AH01|ABP1|><Ad#NrJ@k ><NyB><BgN><N3><p3><09J@ff><p/Nb#><p/p/?<Nn></9N:#><?<BgBgBgN><?<0ANx><><ByF><N8><N><><><ByF><?<NZJ@g><><?<N,3F><09F`z><><NH`><><N`~><><N`n><><N`^><><N`N><><N(`>><><N`.><><@1 @b@0;Nv><09FrAgN><><09FrAf><09J@fd><p/N#><p/p/BgN></9N#><?<BgBgBgN><?<0ANx><><Ny`><HyNHyHNHyNNzNu/,HNV8NpAn-H?<%BgBgBgHnHnHnhHnPHn8BgN0.hrAm"n0.lR@20.hrAf"n$n0@2"n 0.pJ@V2N^,_ _PN/,HNVNpA-H?.?. NN^,_ _XN/,HNV8NpAV-H=nP=nR=nT=n V?<BgBg?<HnHnHnhHnPHn8?<N?.?. NN^,_ _PN/,HNVNpA6-HHnHnN?.?.?.?. NZ?.?. NN^,_ _XN/,HNVNpA-H?.?. ?.?. NN^,_ _XN/,HNV8NpAZ-H=nP=nR0.nS@=@T0.n S@=@V?< ?<Bg?<HnHnHnhHnPHn8?<NN^,_ _PN/,HNV8NpA-H=nP=nR0.nS@=@T=nV0.nS@=@X0.n S@=@Z=n\0.n S@=@^=n`=nb?<BgBg?<HnHnHnhHnPHn8?<NN^,_ _PN/,HNV8NpAX-H=n=n =nP=nR=nT=nV?< ?.?<?<HnHnHnhHnPHn8?<NN^,_ _ON/,HNVNpA&-H?<?.?.?.?.?.?. NXN^,_ _O N/,HNVNpA&-H?<?.?.?.?.?.?. NN^,_ _O N/,HNV8NpAJ-H=nP=nR=nT=n V?< ?<Bg?<HnHnHnhHnPHn8?<NN^,_ _PN/,HNVNpA -H?.?.?.?. Bg?<N,N^,_ _PN/,HNV8NpAZ-H=nP=nR0.nS@=@T0.n S@=@V?< ?< Bg?<HnHnHnhHnPHn8?<NN^,_ _PN/,HNVNpAL-HHnHnNBgNw?<Nw?.?.?.?. NF?.Nw?.NwN^,_ _PNNu/,HNVS@r VR?/LNuHaS@r VT?/LNu#" _0 @g "_J@jp`0"|p2 Ag $_JAjr`2$|r@g\HGe$4SBkQ4@SBpQ0"|` 4SBkQ4ASBrQ$|LJ@f pC$I/9"NuH& _024SBgQ@4BAAc/L&NuHyNRange error during set-operationH& _0246@SCBgQAn68DCCc 0AgRB`/L&NuH& _0@CEHS@rIVW.J?/L&NuH& _0@CEHS@rIVV.J?/L&NuH& _0@CEHS@2FA_VW.J?/L&NuH& _0@CEHS@2FAYVW.J?/L&NuH& _0@274BAAc7V`tO>/L&NuH& _0@"_24BAAc1V`t>/L&NuH& _02S@AC2YQ/L&NuH& _02S@AC2YQ/L&NuH& _02S@AC2FAYQ/L&NuB9>`P>By _0g$_jp"_// H@NL@J@fP)J9>f" f |` f|` f |` f|`4<G BQB) @ef *:f^&Jrt `e QGf g g`> g8 fp@`*S@rG   e gRAQJ9>g`tJ)f8a J9>g| _0< HyZN|#|3|Nu )bJ) g )g )g ) f J9>fgHBNu|/ BgHi ?<ANA>3|NAXNu _4` _t6 Bo r aSB`2aNH? _r ar a/L?Nu _r aN _4` _t"x0HgJJjDxvCDzp cRЀ`|e W0R"f`6 _4` _t2xJAjDAxvCDp0 2H@0RJAfJg<-RBlCSBr aQSCaQN _4v` _46"_JBjtClBSCr aQSBk aQN _v` _60@d Cgt`CbtClBSCr aQSBavQNFALSETRUE _6kfv2_t Cc"4YBv` _6kfv"_t Cc4QBvSBkr a(QSCC" A0 9c^a JgYC`NH "oA/ NDL NuBy(_ _/ C( g  f,t4(H / /?(?<@NA LJkffNu4(SBraQNu(gN fH ??<NAXLNu f H ??<` f H ??<` f NuHy/` Hy0< LNREWRITE required prior to WRITE or PUTDisk or directory fullBy _$_"Wp )f)H/ NL4NH/ NLp)`By _"WJyhf8J)f )f)H/ NL )g)J)fJgByh )g J)fBiNz`zBy _$_"WptvH/ HyLa029LXL- -fJf^p`4  fJg*`N0eH  bBԂi\(؄iV؄iRԄiNԁRCJ)f  g )f) 0e 9c~Jg&JgDJf 6Höf4N$NHy0<` Hym0<NBy _$_0"Wt )gJ&JRJ)f4H/ HyLaP29LXL )gJ)f RBBe`ưBe`N&|NH/ ?< NA\Hyj?< NA\LS@kQ3hN Bad digit in number encounteredOverflow during READ of numberBy(_ _/ C (g ( fxJ(f t4($IH / /?(?<?NA LJk,g*fJg  f"J` g  Wf NuJgJ(f P Nu!|Nu4(SBa@J(f8Jg. fJ(f"gr W1Agp f W1A1AQNu(gVJ(fD f&H`?<NAT f?< ?<NAXp LNu fH`?<NATLNuHy0<` Hy0< LNReset required prior to Read or GetAttempt to read past end-of-fileHPp`:HPp`.HPp`"HPp`HPp` HPp _/fJ/ gLJ/kJ`L/ fJkB`</jJk2`,gbJk&` Jk`"eb// ebr`r`rAV ?/LPNuHPv` HPv _ `HPv` HPv _0HJ[fBBg`,j Dj4<` 4<ЀkSB`Jf].B/BJg 2/.?o /@?A /LPNuHPv` HPv _ [2Jkp`&4<cH@j JgR@kJ@kJgD@?/LPNuHPv` HPv _ [2Jkp`$4<cd JgRkJk~JgD//LPNuJ/ goNuNuHP _?///` HP _0/2// Jv/ 8://N~/DD?DBoJgJgC|k?>BGHGv8ބdRC8ބdRC>HGvކdRC8ބdRCHGv48ބBޅB:>HG8ކkE߇SDkBg|d RdRDUJg( DbRD ME \/LPNuBBo `HP _0/2// v/ 8://~/?DD?DBo 8JgJgG|HD8H@0zr)`рe efef<څ߇QgRCgڼd RGdSCJCkD|blo/EC \/LPNuoHP _p2/g/ f/W?o `ֲ@e:f$/&e&f // d*B6//J/ k`(&// S@Q`&// `R"/?/[4JfFӃddRdRR/eJd RdRd`/AG o Jk`z0H*kS/JkFft grkRBjIHA~`( dtHAI.kRBҁjBG` BBRBӁj/e2/AG o Jk\/LPNuHP _0 @&b(CC/)?/LPNuHy`HyLPN Hz@CPt$> nk(:C@hԥ*5 c_1ɿ1.Ź^ k:v #-xŬX&x2n)h? SYQa@%oNˏ'?9x!7I|o|@Eŭ+E75vV 9@{pvP *** Floating point overflow *** *** Floating point division by zero *** H _0"_e /LNuHy8N/B9/|NuH _0 @f0"|p` "_J@jpEr4@ BbBS@kQ/LNuH _4SBkt82$_rAdd0 @f0"|p` "_J@jp6ADb6CG0IS@k$eQ/LNuH _4k2SAk0"_p6B@bE0)CS@kQ/LNuH _2$_r0 @f0"|p` "_J@jp@kS@kv&J$IRC4(K Vg RQBg`?/LNuH _4kF2SAk>0 @f0"|p` "_J@jp6B@bESBkQ/LNuString overflow _ hNVf 0(gr"OD@Hd2S@k "Q` _"ye HyNN## .f -|`-| nNнf yNStack overruns heap09Nu _3NByNu[3][][ Abort ]Copyright 1986, CCD and OSS, Inc. .Hl^2 064N>>认RD.nXF\X.:X":nrF<,B$ Bpl$4 0 4 (r:>4R &6 6H">R VR  TR  0|T  0r^  02  8  f8~^0(t> 8$ 8$8D  nhv(:44,  \ .  44*,>8,"*x,>8D D ^D $D $D $L <P 0**X*TXDT.>D088 2&88 2&8"0 " *@>"(*6" 6" 6242n.0 R & & & .  &  l2(( n" "   h",,,,,0   .P  N6  N8   L f :&4 : \8h   & (  & .ZJ"4\ZBBL:\  .$@$$2$*|4$&&$$6      8@F D"2 T &( 0&  >             $"  ,*< * * , , 0 , " HB@6 2J X D   ( 0"L2 N z  f H F  D ( *@ B @ B  . 8 tj.. 8 tSIM_FOURPRG:t kSIM_FOURRSCAt 9WIT_BLOKPICEt ZW_BLOK PICHt `F`Tsim_four.rsc ONLY *o#^n - ЭЭl// #^rBg?<JNA ?<NN#^R>NNT3^ȠC^V"L?H>aShHx?<HNA\@#]/?<HNA\#]3%]Xa\la`N^C AJgAtJg  gSfa[Da]aV``NuaE*B9LBy2aV2Nka *y]`$daZfa]jarByrhAN[N vN^vaZBypN``SEvf$H$& y^:C^>e a^>d, a,A^>ךf B E^JdђXbђNup`Kd d3 d# d# # d# # # # d# # # # # # # # dB` # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # QNu$H$&"BA 9^:a(XA^>f B E^JdXdNudd2d"d""d""""d""""""""dB` """"""""""""""""""""""""""""""""QNu2(g"P@g:RADAH""y^>r2g"ZA^:e& 1@##^>Nu1@Nu y]\]`a"y^>^:dp`I`H y^B$y^>"Hg< k&@0+R`g k#&@0+S@H3 Q&f#^>LNuH?<?<NAXJgJf&AH@B p`\A] \ @BBPtNua*Adp`:a*AV0p`,a*AH p`a#za_A6 1Ap`a#daad$a BS@kH2Q y]] tNuHpg`aS@Q`a""@ Y0g0]b(2RA4DAH! ^>fXչ^>NuaaJBkdHNuaHPaJBkd8 `bCgBJ@gv  g &g a]NutNuRptr ae OgR Xgh HgSRB ae Fb$0k  c_  c b退`tSJBjblNuRB0 b b瀀`RB0 fрd`aJ@g`c`c^aJ@g`aJ@g0` y] Bh\]tNua`ca `aa!a( Shda [PHP Pa _`8LNua!Va( Shda [PHP2( P`Qa _]b6(gRC8DCHHP P!@ _Nua a(.?p`a a( ?La( S2fr4(Ae.RBBc0?af2 [PHP PS`Qa` _`~ [Pav` @"[PHPHQ0(ie4k2a t _aN2( P`Q _a:2( P`QNup `Ep @HPa Sa [P"_0( X2)"Y@`VNuag"`af`a(e`a"c` ab `adtNu <r$<Nu @HPa Sa [P"_0( P2)"Q4Ae4v`Vf@Nua @2(g]b P"H`/0Ha.2  _ PSAvjx E&Wf* ae zb QNua8U@k0`aa*Y@k `_za]@jW``aY@k rtHHBBNuaQ@k 24HHBBNuaBjtpr Bc4<prJjAjNua Bp`8a 1A1Bp`&atЀUrЀQ`Da%A(Jf J0p`NuatV0 9c^Q A`at `V0Q`H?<,NATA2X@a&:0H@?a:AAa Avp`N0H 0 0H@NuH?<*NATAJ2@a.0H@a.YdaHAaAp `a$a$2 P`a$r b?a2`Q tNua Nuaa patNua$H gJg ba"P @4(gHP bn aX$_// Z4HQ`S@Q _Q _al tNua#B9 ?Hy ?<GaPHNAPA pR@J0fH`a#/aN `aDa@a#/ [P` Ba.a* @a/? [Pa"X20 _$gS@cY6 :fRS@g.t;ak&AA :fRS@g t;akIA??<-NAXaZ @a."X0gZtaZkT6gP .fJS@gFt aFk@Ag6paX -Fgz !g %Fgna6pja8 -FgZ !g %FgNa6p a -Fg: !g" %Fg.a#Lrtp aAj -Fg Fg a6p`NuaBg?aN/a?@a@ @a'7 _a "X24$[A 0@@[000][vx`* [g" ]g |g QSx` xQSrQ][vx`* [g" ]g |g QSx` xQStQ]BA 0a:`taD?9L?9N09LyrdaTR0yrfaFR0`>a?a3L3Npirta@*09N `Ua|??at -Fg$@@?@a^@@oaP@o?@?<NN\Nup`7p`7p`7p`p`p 3a d3vgC@@@A^ p hf X ~e#TvgC@@@A^ p hfT X 4eN#R3rd3rf FgaJ3aL3 "|L z9f?:`aJ*aRz2TSWjT`0:2:`$@2TQ"|L z9f?:`aIaRPzT2SWjT`0:2:z`$@T2Qr4:f0:^`>. @a"X0ALH2`0Qppta> vp`a JBkaQ@3pN`= @a"X0ALH2`0Qtpoa=`DHv y^CC`I HvC y^փփ`IHv y^ CC 00`PHvC y^ փփ 08`Pv y^CCHp0Ra@ _`HvC y^փփHp8Ra _`Haj/A^eeeee `H@J@g`쐨g`Hd`v y^ CCHp0Ra _ NuvC y^ փփHp8Ra _ Nuv y^CJp0g*H <r$<NuvC y^փJp8fHtNuv y^CHp0Ra4 _0NuvC y^փHp8Ra _0NuHv 9^CCCCtNuHvC 9^փЃփЃtNua*/A^eаdʐH@J@g0`v y^CC`vC y^փփHp8Ra~ _g$]c/"@0)a _$PS@kH2QNu2(g"PRAA4DBH#"@$Y2g 1ARAA%NuBhNuvg@g"Wkg2WkR/&SEg$`LR/ bZ RbJp0@:<Jf` փSGgЃЃЃA^6H aLp$4`YE PQƐFrd0` Qj`prgAA^BBB p "X2g UAk$QNuHaT`EaBPJg, BgBUBg8j(Ѐ"ЀЁE Y0gR@2DAH!b` `ЀЀ`Ѐ"ЀЁE. y^ 9^`2"X2g,e($UAk&QHPS Y2g RSj _b y^ 9^""X2geb 9^: J"F^6^:`~aSk.TH@gX V0"~:00.LKLRLLJZ,>,N0D000J4! V ^0 33,,$&xV3ThU8b^b $#"]#&\"""hZPR 01,1>1Xn2]]3f3_f3F33` p@  : HxFF~AJ0pk*c`TG<;p0N`~-A*B0p`G<;pN``p `$p `$??@@@8899HAAA>AzAzAtAtAVAPAߢߺߺ߮߮ߴߨߜ" ?>??B>9rC8C*F^F@BDzEt4J$26`޸RbEFH4LdNAd 8 .<$h6 \LrJx:$ pr.!!@&D`pxh&X?BXDXD&hS  ?>12h233>h3,32$REEEEEEEܤE(,z BRz((2## <<<<<<<^:`e a׎^>d#^:%` -Ig&a$y^:%@ -Hf&a$y^:%@Nu%ea^>d#^:!@ -Ig2a. y^:!@1A!B -Hf2a$y^:Y%5%Nu!<B`!<HPa$_%5%NuY!<B`!<Nu"y^:$] ! @g !k А n (JNuА l#^:Nu 2($4AB*!kB8!&!a34*!8!&!Jk JkEffDb(J`2#^:`2JjBf涀fA`8!&!a2*!8!&!JkJj`Jk`/RaJBgpgX^:(_NuXNuaJBfprtNua" bNua bNup`p` ga`9~A~-J0pfR~RHGG y^ 0pNu y^n`l y^n^r`^A`VA>`NAJ`FAr`>A`6A`.A`&A`A`A`Ar$`AH `8Ra0,/JkTSGgL`NM.F`84  f R~ NuBg` BgarRW g %g - f>NuRar`a,/JkTSGgL`NN.F`7a,/JkTSGgL`NA.F`7a@J@g6@Hz ?<&NN\NuJ9]ZfjNua~#1 /aH _Jg/JkTSGgL`Hx1NLx.z `7Fa&/aD:HP1 M JGg` -JBj @aՂSGkL` _HV?LPN\LPNuBg -FgaxJBj @ `a7LtRW - f>Nupg@ЀЀ y^" 0g(@Nup`V Fga~HA^JLpNuaBNu~G<6p N`  gNuR~G<6p N``>D? *_a 3rh2HUa fRp"Ma !g yXNf pCaaVJ9]Zfr | pghfb "f.R 0"g 0 gR@` 0,g 0 fHp`R@ 0,g 0 fHpa _ Fg  f`pXNupR@ 0,g 0 fadJBkHQ ! gRfa`X yXNg yXNgp`<9XNk&a(HS&| a  gf< &_Nu\F Fg Fga(ZHS&| ??<NMXJk g f< &_NuHPa2  _`Q`N3rh2Ra fRp"MaD !g yXNf pC$a*a4J9]ZfA pR@ 0 fa FfNu??<NMXJkNu\F Fg Fga'HS&| a "f g 9" g& ,g g f< &_Nua g`Ra ,g ga| ,g f`<9XNkva' HS&| ab "f g 9" g& ,g g f< &_Nua*  g`Ra ,g ga ,g  f`HSHx??<?NA JkSfNup`v`v??a?@NMX`2DW?<`a?k?<NM" Af J@fH@`4g \SG??<NMXJkJ9]ZV t&_NuRa dd XA*0kH?<?B?<BNA `1tNuak `1a kf`2Rar dd A*0kH?<?B?<BNA Jk.,?<?B?<BNA *kBg?/?<BNA JkNu` y]~ (g (fB76Nu#7637:Nu FgvgCփփֹ^" C g @~`p!`tp"`np#`hp$`b :g @|Sg`pR@ 0,g 0 farJBkHQ ! gRfa _  f z4~a8 FfNuR37: FfNup "f.R 0"g 0 g,R@` 0,g 0 fHp`R@ 0,g 0 fHpa&`~09u@29uBR@RANuS@SA3u@3uBNu3p`84:`fprta09N29LNu4:Df3N3Lp rt` By8`pBy8` p3 8|38@38a383838~`&aJf,H@ Kg Mg Pg Hf~`DSGj@RGFc:>`6 | g6 g0 gd gXz`ez\gFf6pRGRFa`an` `?~aa!p a>p a80NuCpE`bf`FgRGJGgLSGSFFgCpE`Yf`Nua@Jf gH@ fa(@ fza0 b @ Ee0Nu?<?<NAXJ9]ZfJgNup Nu4:f??<?<NM\Nu3XN`a!0:R2:Pa0zEfpa\ppaX | Eg0PaEfa<`@a @aN"X0g?Ra dbTA*JfHPaH @a"X>EFr$WfFA0 _3XNTNuApHPB2/ Og* Rgz Ag< Ug. Ig ogB`&p=`pNAXJ@kNu~cG*VgB+B+eHk ??<>NAXQNupA` p9`p:`p;?a @a*>"X0AHPBHQ?NA\ _JkTNu?<`?<Rat db A*0Hk?aVJj Jof?|/?<BNA `a./a(/ @"X2B1HQ ["X2B1HQBg?<VNA _a _a~`p`p3GN Ff #*.* `8a~S @aP"X0gA @f ):f 0 *.*`QB?:Hy ?<NHz?<NA\NAP3XN Fgar9)H3XNa`\Jj @g @g ?aF0`NuC EpAJyGNg *g|*fSJyGNg$ f *a8JfP|0ala  C a?<ONAT`d'/Qa H@HaHda H aNqJfJg0P H@HNu 0*X@a:0*H@?a:0*@@` 0*@a.0*H@a.0*X@@H`haS@k ??<NAXNua?Hz?<6NAP0:`av @aJ"X4g,A HPBBgHQ?<=NAP _J@k??<>NAX`tNuaa @a/? [a"X2A #`QB2"_AZ# A e ` \gQBapZa aA "H09g"Hg \f`AZfS A `Ja : -Fga9(Hk$3XN//<??<?aNA Jk ` aa#JTaa"z9)H3XNaR` xp6`p5` p4`p3`p2`0ap(fgTA3JgJhf~X?HPa Wv- eC-00ÑyJm y^FaZ _> FWfBNup?`p@3JaFr(fgpTAHP0( -Fg aSk _1@RhHhBg?9XN/.?<BNA JkN&_>gF2ҹ^ A"XPfHQH/?9XN?:NA Jkgp y?Jgp%` Nu @fp7`Ha y^R"y^F`Han"y^R y^F <}arLNup=arkHQ??<>NAX"WA fSp g \g .WgJfS.BAKBHy ?<ANAT//Bg?<VNA "_`VBgHQ?NA"oPJ@Nua4L #L#NJy|Zg a2Sy|Zf y^B"y^>Ef` k&@p0+R@Db bPL y]$z\p (g&fQLܐ#L (f[L:"J9LfA gXgJf`CFJj* fANSfpABahJyXf zx b` CFAfJj<-TDd0@H@H 0 0H@B`3#p4`&][Return]H:FHH`H:8HH` f" LWLfp e@3LNu -f. FV\bg LfD9\bp e@3LNuv Lgv g gh f.v RA eC0H"y^&J8n0Nu@aT@aJaHAv2+&gvA020000` Lg$a3M a3M a3Mv`aߖ`ߒv`r0z B9L^&"o$y^:X^>eaε^>d#^:B*A`ո0z^&"o.$y^:X^>ea^>dۜ#^:% *A`xB9\b` ֹ^& C"nNuvgCg Yk,gL`b y^փփHPaRaXa, _` y^ փփHPRaޒ _ѐiNuvgCg Yk,g`0 y^փփHPajRaa _`p y^ փփHPRa. _iNuvgCg Yk,g` y^փփHPaRa֐aT _` y^ փփHP aRala0aF _ NuvgCg Yk,g` y^փփHPaRa"aZ _` y^ փփHP adRaa6a _ NuvgCg Yk4gp` y^փփHPa*&<x*<a _`( y^ փփRi`NuvgCg Yk4gF`\ y^փփHPa &<x*<a$ _` y^ փփShp`Rֹ^a̪ЀЀ`ֹ^a̐ЀЀ`ֹ^axЀЀ`ֹ^a^ЀЀ`ֹ^aFЀЀ`ֹ^a,ЀЀ`ֹ^aЀЀ`Pֹ^aЀЀ`Zֹ^aЀЀ`ֹ^aЀЀRiNuֹ^aˬЀЀ`ֹ^a˒ЀЀSiNuL88PdRBNu#S8p arpMal3pd |Lr 0Q0tr a3`peapp`0pAaS@fa @aBaA aN_$BgNA`"|"2AUV@p222a"<^0<NB09Nurt3 33 a"<^psNB09LNu Fg a43a"<.psNBNu Fg2aC>2 @ e @}bAUV@p222a`"<0<NBNu A`H JA #C#B0\* BpZaHSa.09g$A "Hg \f`Af09NuGfABASICByZ 0:A( fB fB @m ??<>NAXNuAa&|.BASa^g <.BASa6B^JB^NaC p apA CelVfdC XptaPZ A]C^:E "Ҁ f Cdb("y] 9^2aha&J9XfXNup `p `p ?a&`p`p?a0`Nua/a8/a o("_ _" $Id*b` QjNuQjNubd`aHaa"[`a6aa"[<:HS?HQ/a.&_<k/HS/??<?NA Jk0&_fDNu\Fj.?^:,*B(9]؅kr/9]?<INA\/?<HNA\JgH y^>"y^B۹^F۹^B۹^>#]$I`&bۛp0R@@b CX`/9]?<HNA\p=`Na|a aaA a&HRLaHRLaHRL??<KNA` J$H @a"X0 J @cp~QBNuH <r$<NuH <r$<NuH <r$<Nua 0`a`vHJ9rh`6?<%NNTNuH`HP?< aNA\LNuQ[J[f H LNuJ9[g*P[Jy[gH y^V hBP By[LNupA :#^6#^: zb :~grHd0` Qj`xNu". LLLLB?< NA\#_ /?< NA\Hy_4?<&NN\NuHy_?<&NN\NuALH_C$pJg XXQA#`Z `LNu________LH!`ZNuHx`(Hx`"Hx`Hx`Hx`Hx` Hx`Hx !4VxH A3`J Ni LHO|1R/:?< NAO0: @d`HarLxN 2$4BANuAd RdQRB BbABJk 0NuJBjBBXNu 0Nu 2$NuE`BL8<gJEgEjCDEDF Fe"Fk8BCHC`PFk\QF^FkTQkDуdQRBNuDdBDA@kgAр[SBk(NuJlJBkNu0gH@rB JkЀ[`JBjtNuJ9afgPagpr$<Nup`JBgVB&8TTDуdQRBNuaDNuz` L8JEgJBgJjBEB:gHC҅H@:|ۆ҄ۆ<HC>H@ЃdHA@B@H@хk HAҁHAрSB Bb@Nup`Nu&8*LJEgJBgJjBEBQ*HE?<>0rHGGdHGGdSWDуdi\?<>0rHGGdHGGdSWDуdiN?<>0rHGGdHGGdSW2 H@`H?<,>CEdGH@0r`?<`DAр&AdRAрAрDуNuprt|PafQag  g +g -f .g20  b 0e 9b da`RF` .f 0e 9b dadSF` Eg efX +g -f 0e 9oSH`00  b&Hz0  b E Do`TJjDDDS4</a$JFkSFkLaRFBd&8*L?a><JBgaSF Be BgQRB`ApdR e <rRF&0xaffEv+0JFjDFv-Hƌd0BFHF 0HF0A Nuprt|`HQ2:( A dHC 5e2!R 0c 9c0`|1<A ar`2:C0 Ef"_Nuaa/ Cr  g 00VJAgB @ nN @mHJ@j0.4DBUBk0QSAg Q.`S@k 0`0BAF "_Nu.WAkQA" 0g` a| @e3fNuaJBg <r4<NuaAd RdQRBABe B/dNAрQ4<`BNuaag `.aag`@Ad RdQRB>Ge GbFGNu G0dFGNu~NuatAd RdQRB6Ce C/jC C@j C jr0H@{0AFG0000X0000X0000X0000Gr$~A0g0  pia QNua?S@kF8LfBfLC`HNua -FgH?aa"AJWfHa #rdTNu3`ʰzbzbHr`a0S@k@> A0P"G0(JgRJ)@g1@C2fZ2HP"("(pdaj W091@A00 piaJ3@pia2 _C""pe` 3 pia3phaLHrdHsSBSC@AHLHsPrhPuDPL0<rt`pa"papapaLr`a,S@k<@ A3gFBPpfahpgab3 phaT3f8Bya.QrhBLBrd`bNuXNurt`rtH`aS@k@?aN @a""X80L6BPA E\G66&JDg DNexMQBBJyg *gpi`Nua`< d8 VuDg* g gj g& fzSyu@jByu@`j3L0:z"3L0:R@S@z3Nprta|Ryu@0ΰz|e$Byu@RyuB<SFEzbcSyuBaQj&_NuByu@`3LH ALEE1FL HHhha a6ByLAL0(1@hV@1@1@ `H ALL a ByLa LNu??<?<NM\`L3pkaD3LALL fHL|D@ASBSCHHa Bypk` z#g.vG2RC+ g33p!aĶSeNuALp #gBypaܚBwAprt0 0BBB R@ @efA000 0PB0 00 000\0X00000 0P0BX0:@00p1| 1|QBX0 $HTH0P 00,NuSk [0NupNupNp M gz gp g g*Ha:a6rHA3@@"TAt #zg0A7( f hgSASAgRB`3`DSAgNu@  f/az _^&X PfR/|~ Kbza0g @ ep 24C"2 S@ػrTd BTA3A0C4$I2a222B"0@2A\xvag@2#M 4B3BS@ -f ػrTd@BAb8RGRC`3RSG5GC5C J1DcaRF F eXNuRG GcdNuPNuXASF1F41R 1h4 x1EDgZA##w3?<NNTU@g.A g dRhdRh(gp`zp>`Ap0rtCLagQ0CLL000zH?#|<pa0LHrH|Lv3|:ALff$f*f*fNu y |6(`86(`2629|BWAARA09|DA hfRAS@f3|: Cf0Nua$@k0;` <`   FgbSa@gS@ AHP -Fg^a| W@ -FgL Mg4ad W -FgaR W HAA}:20i0d R@`Ra. W@H@?< NN\ -FfbNu0^ M / haw FgSaF|H| -Fgra|c|o|{f|cf|of|{ -Fg$ab| -FgaP|H|AxHP P0P T0T X0X?< NN\ -FfdNuaJk$ Be B baS@ogRR FfNu$y^:X^>eN^>dJ#^:% p e@ЀЀ y^& 0gk g$(@Nup`T`* f /BaN"_pHq )eRXar(_Sy|ZNu&y^: 9^> nN 9^> ovgC C@g,U@kBg^6BP`X^ &B`D^&B6BP`*^"X0gBPr2RAA#&6&#^: Ff@NupZ`9L#^:fJ9Lg`,Nu&y^: #k g#^:(@Nu0@H@@gU@k,g ^0`^ ` ^1c ` ^"X0gHR@@"D#0#"c0g! HR@#`zvgCGGA^ pp,08gH F gF g&& ] m&NeHUKa*_Nup*`p-`p.` p/`p+`p,`& fRHPa&"_HUa6RLa*_HSy|ZaLNuHSa - fH$_Nu y^:X^>oN^>nn#^:BRy|ZEHRK"y^: 9^> nN 9^> c2$""" "v eC Cg\Ukxg8JBk^20"#^:g  f`  f&_NuJBk^ a" `JBk^"2aB`JBj^H f"HQHP0(N$W$RH`2Q  _"_$X4BPY"2gHRB]%(\$@$2g@]e$HQ/0NB$_$RS@H2Q"_L` 1A$BHRA%L`p\B9L`"p^`#^6^:p]`a b6J9Lf 9ZLg 9[LgB9L(yL Ff(yLNuv eCֹ^" C/g y^:^6c> k `g& @gJf,Y^:`Jf aT` ^: ^:`fDJ(_B9LNu((@((?<NN.?<NNX LA HA HNua aa -Fga`Hp3La SN"X0 @e024EH$JyLk Bb5B5A6CC5CK5C8+:+ALB0000Dk~Ekz00AL<:>:SFSGFn`Gn\DDk0BhDEk1EBh Fchh Gchh0hb&0hbpmrt##`ϠNu _pNBaaaaa/a4>+<+:+8+&DbFEbGALHP@dAdBD0ƞE03LAFC&000FF22N23BRG0@\@ _NB"2#`2a @0<}NB&IaNa @&XaH`az?<NNT @"K <}Nu @HPa^ _"X0 @Jg8zf:HPEJH LppJN$_4&bp$2Q"G HD&NuTpNup d@Tй^ @"X PfXLNupN z&"z2gB` zBp( g;j `` $&( "A2;N,PX2P,(r /` f"_#Hѩ` f@"_!I` f"_#Hѩ` g`/`j f"_#Hѩ` f"_!IE#J`: f&"_#Hѩ(g|`|` f"_2(if()g AdE#JE!J`  g  ft"_E#J`  fd"_E#J/ ` g g g f /`lHz`"HzY`Hzf`Hzu`Hz` Hz`Hz#]`tgB"#] g0 g0 g0 g0 g0 g0 +g0A`.X`zHz`"Hz`Hz`Hz`Hz` Hz@`HzaAa" _aJf~NuH lHzX``Hzd`XJfHPr((( eA(ҁҁ"zpJf# Fgpѱ`T +fX`DHz``8r(` r(A("zJf>"ёEXJg +fp`NqEXJg +f`Hz`Hz` +gJgHz`|Hz`trHPTgAGGCt"qpJf # _` _Hz`6 zFp( g -g g`~Nu (e`|vCgCֺ*"C&"CgijgHPbH~t( g(  g* +g .g±e _JgBHz<`R`S`Sj`vCgCֺа"C&"CgP~t) g,  g* +g .g g`JgBHz `*R`Sj`Division by zeroOverflowNumber not integer|-2147483648 .. 2147483647Number not byte|0 .. 255Number not word|0 .. 65535Square root only|for positive numbersLogarithm only for|numbers greater than zeroUndefined error Out of memory Function or command|not yet implemented String too long|max. 32767 characters Not GfA-BASIC V1.0 program Program too long|memory full|NEW Not GfA-BASIC program|file too short|NEWArray dimensioned twiceArray not dimensionedArray index too largeDim index too largeWrong number of indicesProcedure not foundLabel not foundOn Open only|"I"nput "O"utput "R"andom|"A"ppend "U"pdate|allowedFile already openFile # wrongFile not openInput wrong|not numericEnd of file reachedToo many points for|Polyline/Polyfill/Polymark|max. 128Array must have|one dimensionNumber of points too|large for arrayMerge - Not an ASCII fileMerge - Line too long|aborted ==> Syntax error|program aborted!Undefined label"Out of data#Data not numeric$Syntax error in data|unpaired quotes%Disk full&Command not allowed|in direct mode'Program error|Gosub not possible(Clear not allowed in|For-Next-loops or|Procedures)Cont not possible*Parameter missing+Expression too complex,Undefined function-Too many parameters.Parameter wrong|must be a number/Parameter wrong|must be a string0Open "R"|Record lenght wrong2Not an "R"-File3Only one Field per|Open "R" allowed4Fields larger|than record lenght5Too many Fields (max. 19)6GET/PUT|Field string lenght changed7GET/PUT|Record number wrongMENU error?RESERVE error@Pointer (*x) errorZLOCAL error[FOR error\Resume (next) not possible|Fatal, For oder Locald GFA BASIC V 2.0| Copyright 1986|GFA Systemtechnik GmbHf2 bombs - bus error|Peek or Poke possibly wrongg3 bombs - adress error|Odd word adress! Possibly at|Dpoke, Dpeek, Lpoke or Lpeekh4 bombs - illegal instruction|executed in machine codei5 bombs - divide by zero|in 68000 Machine Codej6 bombs - CHK exeption|68000 interrupted by CHKk7 bombs - TRAPV exeption|68000 interrupted by TRAPVl8 bombs - privilege violation|68000 interrupt by|execution of a|priviliged instructionm9 bombs - trace exeptionGeneral errorDrive not readyUnknown commandCRC error|disk check sum wrongBad requestSeek error|track not foundUnknown media|boot sector wrongSector not foundOut of paperWrite faultRead faultGeneral error 12Write protectedMedia change detectedUnknown deviceBad sector (verify)Insert other disk|(request)Invalid function numberFile not foundPath not foundToo many open filesAccess deniedInvalid handleOut of memoryInvalid memory block adressInvalid drive specificationNo more filesGEMDOS range error|seek wrong?GEMDOS internal errorInvalid executable file formatMemory block growth failure[1][Do you really want to quit?][Ok|Cancel][1][Program end][Return][2][Program stop?][Stop|Cont][2][Printer listing?][Ok|Cancel][2][NEW - delete program?][Ok|Cancel]Editor - Internal errorWhile without WendRepeat without UntilDo without LoopFor without NextWend without WhileUntil without RepeatLoop without DoNext without ForIf without EndifEndif without IfElse without IfElse without EndifExit without a loopProcedure without ReturnProcedure in a loopProcedure defined twiceReturn without ProcedureLabel defined twiceLocal only allowed in ProcedureLocal not allowed in a loopFunction defined twiceGoto into/out of a For Next loop or a ProcedureResume into a For Next loopResume without ProcedurejH lSyntax errorjH lLine too long>.Jr[3][\"& 6     B2p\ x~ 4*"t:< 2X00FB^  "  < T2&$"F"* &$ L&8@h24&"* &lJ"$,(:$P X>   x@& V4 j  @*JLr &:z$J( (.(F < Zt"N\"`  @*(<,8L*(j<,( @<    4^> 6 X:dH.( @GfABASIC5\7$7778x88889h9h9h9hP***************************************************************************** P* * P* Verander a.u.b. niets in het programma zonder de toestemming van de * P* schrijver : * P* * P* Pim Coenradie , Wapenveld , tel. : 05206-78258 * P* * P***************************************************************************** vFEvL)FoFYF!!! ! ! F,F,F,F^F FvLFE,F +FFF,  EQGEFF[FFE !! F h Atari STF,FF rF,FF F,'F*,#F@,%F;,F!, F!,F F Z FFFn.F +Ft BFYF,F,F"EFEF EF!EF F<BEF FFEFE E  F0!F R#! # F,F! F Z"F(E# 6 F  Atari STF,F F,F  F ZBF,'F*,#F@,%F,FA, FAFEEFGEFEF^F FvLF.F +F `EFn}FBEFGEF!! ! ! FF^F FvLFF,F F.F +Fv!!!  ! LFEEF  F }F FC}FF FFEFF "@!A!?F ?Fn @ F&EF FE @ @ F&EF FE F@ @ppF&EF FE b@pF&EF FE E ApF,EF FE ApA\\F,EF FE A\A F,EF FE A F,EF FE&@, FFEEFF.F +F NQ F, F&E*FG,E+FG ^FEEF,FF F.F  +'F*$ &@, &@, F0&@, !F0&@, !F F>.F# '+#F*":E &**&@, F";E**,BB&@, F.FE +F@:!;! F.F: :+F YF",E\GcHHF"&E G H*F &!,!&p!,ppF &F ^,F.F +F[FF !! F!&H! !\!p!FpEGF f F#F%!!F$\!"!\!fF$H!"!\!fF%F$J!$![!dF%F$L!&!Z!bFESpeler A  :F' !8!F"'!\! FY !P "F`0! F" b F" ESpelerF FE F FH! !F.F +Ft E!FH !FDE @ Fe  Over Simple Four FO,F F   Nieuw spelF2)!Wilt u echt|een nieuw spel ?!!Ja|Nee!F F F,F EFBEF,F F F F *StoppenF EF FE E lSpeler - ComputerFj,F h Ft,F! F F  Computer - SpelerFj,F  Ft,F! F F  Speler - SpelerFe,F  Ft,F! F F  Computer - Computer F,F F  @ MakkelijkF,F F  f Moeilijk FM,F F   Zet-voorstelF,!F F! !  Kant-wisselF6  F H ! F F F FGEF.F +F@ E Moeilijk Fi"0 EB  MakkelijkF3EF F.F +FS0 E MakkelijkFk"@ EB MoeilijkFl3EF F.FE &+F, EFa EAtari STF ,F,* EB Speler - ComputerF F.F +F EAtari STF EFa,F* EB Computer - SpelerF F.F +F EFa EFa,F( EB Speler - SpelerF F.F +F EAtari STF  EAtari STF ,F. EB Computer - Computer F FKEF.F +F" E Speler - ComputerFl" E Computer - SpelerFl  E Speler - SpelerFF$ E Computer - Computer FKEF.F +!FW  FpF,FW,'Fi,#F &@, F;":!;!:p!;HH! F F:,%FF$ f&@, &@, F1&@, !F,1&@, !F, F &@, F; :!;! F F! F.F %+%F &@, F#F%!!F*:!; !:pp!;HHF#F%!!F F:FEFFE { F:!;! !@F*4FF FF.F  +FF $!!!F!! ! !F&H!H! !C!F#F%!!F$H!H! !/F$H!H! !/F%F$L!P! !.F%F$P!X! !-F(!@!!PF"'\!*! Simple FourFu(!!!PF '!f! Versie 1.0F(!F*'p!!is geschreven door :F(!F$'!(! Pim CoenradieFd"'!8! Putterweg 5Fe('r!H!8191 AZ WapenveldF &'t!X!Tel: 05206-78258F"'!h! (na 19:00 )F8('p!~!Tips ,opmerkingen F('p!!en vragen welkom.FF(!!!F6'f!!Mocht dit programma u bevallen,F:'R!!$stort dan a.u.b. een kleine bijdrageF.'p!!op girorekening 0902480.F(!!!PFE FEF,FF ZSBP F4RP P/QQ*F%F$P!X! !-F6'h! ! Andere Simple Soft programma's :F (!@F"'h!8! Simple DrawF (!!!FJ'h!X!3een tekenprogramma voor monochrome en medium kleur.FFV'h!t!?- geheel onder GEM , diverse basisfuncties , comfortabele loepFlP'h!!9- blokfuncties (copieren,verplaatsen,laden,saven,wissen)F R'h!!<- set colors , verschillende tekst- ,lijn- en fill- soortenFT'h!!>- fill-editor met veel functies (Pak,Toggle,Invert,Flip etc.)FJ'h!"!4- geheel compatible met Degas (tekeningen en fills)FJ'h!,!4- hardcopy voor diverse printers, rooster etc. etc.F(!@!!PFm$'h!@!Simple ConvertF(!!!FB'h!P!,een Low-res naar High-res plaatjes omzetter.F(!@!!PFe"'h!d! Simple CopyFn(!!!F,'h!t!(binnenkort verwacht)Fr(!!!PF>'h!!(Alle Simple Soft programma's zijn bij deF@'h!!)schrijver (heel goedkoop) verkrijgbaar enFrF'h!!/mogen niet zonder toestemming verspreid worden.Fn(!!!PFE FEF,FF 2ZSBP F4RP P/QQ*F%FH!H!FEF.F +F!%!!F !! ! Fg%F$!!!F0$!!!F0(!!!PF'P!PP!OKF.F +)FFF.F +F}F.  WIT_BLOK.PIC  ZW_BLOK.PIC F* FE E WIT_BLOK.PICFB~ 'O~~? @~~ ~. K t.. K tDEMO GRALt DEMO MUSTt 2DEMO PRGXt LESMICH DOC`t wGg'" QaSUdsG$ . V???????????????o{GGG''' @@``` 7 x?oxg=  ?ڰ _ U<<< <X???8?@?? x???p?p????}???//////x??߃???? !߃p X???@??????????0xx``x``8?@?????qq8??????????8????? ?? ??8???w? ?????888w8???8?|??????|?___????????????????9??????????? W2??????wn n 6&??;|x_ʩ _ʩ xpE?????S{%./û????&ܟnI@__nI@__d?? pp:??_X_X=B"'>>E ??E??@@dd??U߱1PX?? 1PX??```ggϜb"0"0gg ?????????D`?P@QWP@QWÀ3O/?.O 'GaGAA??? LL?\#wGwGǟC߀LL.?pp?o( LL11w<bMڢMڢY8?@??D߰^^m;x???输@输@o???̙22gg   }&,￀,￀??LL22gg7??7??X'??^^P^^P33???C>>=??}Á}?y_Oy_O+??kÁ  ??(??aaÇÇ????Á| ?@@33 oǃ ?????OO33;TV????ᙇ7??W5??////OO 0??????e"Waa????LL];@{?hO̙__ cp????*f?q__E?9OznS, ??@?Sͬ2_#??}_D 3?{EOXw??|??  >/#X{?öI?]wX???38_p?o_??ug@χII䙎J]=ϓ22yy?0?G?.?aa33||gg_5??/?? |0?w???YXt7??aadždž0p0pʎ}F|G??????>>$ $ dd܇xxMڲ;>>dd'']?t_SaaÆÆffpp?O+9/GoeGaa?B6@@w.TOO?S?jo?aa{?VY_j_J*M[O  ???@_SO???GϿG00?kv_OÆÆ LL$$''̙̙??  00?ooo{{{?``Ç___www?營''??ooo?w?w?w ooo??>>||2?2?``Æ>p>pWWW?p>p@@aq//?~~DDqA>p>pa777?'q@oa ??0110ßs]``<<??O``??ۿۿ???== ????? ?og?ǀ??Swhz{z??ckkk?O@G`99:::_?_~???gg>>ϟ?8<?????~g?????g/??s?cg??s0ǃ????s@Cp?0ßs00ww9!3?OH@@11???AA;;g?8 AA||_g? {{ssB?????9O???9?!?zsz??~px3?????????**7_? ?a g `?'g????O0cxxo0??  pxx9??1!kkk?uuu??00?zsz~~~ ? ?3733???  { @@>>??ߟ?@@@0??AAAA????AA?p?>????????????pppwp??{~~{>??> ??_ޗKޗKLL??_KK22F LFwp??..{\\{<<< ???@@<<<????  sss||||?||>x>HOHxhoj>8(/+?Ϩ/+pp ??????? [X?????>???X]P????  ?@ǿG?go'o@??Xoo??ˀ  ~~n>o~w??~~n>o~~~n>o~|w}~l>nsspp??}~l>n÷0wwpp}~l>nǷ~????wwppzhmϷ$@$ zhm @ ????;8yio{{@?? uak@ϿϿww???7 0 uak݀ ''8??wπ p s߽S_(܀ ?? ?ݧ@ k׽CW(? ii> k!5???? l_ l_;;>>8Ϯ,,WFn?8888||p{=.,,V|Fo?????߀??????0oooPk@joj?{xx@C >x>oho'srr??aaaa882L L;||/ ??cccc0000````???? {/ _?11113OO??? {{;{{????xx㙿ww7ww??>>www>>>z{wӯÏ??:::>>>tvׯ/?Ϝ>>>ln''''???? ~__''''??~_??''''n؎y___,,,,''''.LN߷7?__$$$$####߀?__$$$$    oo$$$$    }|oo$$$$    ||??>>v"v??,,,,    ~~w w??,,,,@@@@>>99((((@@@@>???8888@@@@??0000@@@@?0000@@@@??pW~VV@@@@???pW~VV@@@@???pW~VV@@@@???pW~VV????@@@@??pW~VV??????pW~VV? ? ? ? pW~VV? ? ? ? W~VV~ ~ ~ ~ ?W~VV~ ~ ~ ~ ?W~VV| | | | >þ<ÀW~VV| | | | C??>>"@@@WT````C??~~<{{{ 888zz@````G??}|(;;;000||| aaaaG??}|$;;;<<<aaaa[[[???  kkk???^^nn}|~]~]???nn ???11{xgkk@@@$$$$ppppww>ggg@@@ooooXXXX,,,,=?=###''3???0```(((???????mmmVVH?__?_30@@@{z^^^^^^3v03vH>2CCC^VVf<<|@@@yyyxvyxvH~x<~>~ ```?xxx>>@333x  ppp?cccc`???0|   ܀܀`|`?aCCCa ` ~~~ 30 ` |   ppp؜.>P0 @@ <<<Q. ???`@@@x?8Wh ` ` ` @??@??????? @ @ xxx,?(qXXXOOO @@;;;;```<P ;@?000 ; ?9999000(<000    R,~ Xxxxxqqq000    ~ |||???? (> ߍߍߍߍNNNN8888????888uuu]A]]AwAAwAw]]]]77777777]A]]{{{{]]]]````uuu]A]]wwwaaaatttt0ÎÎÎÎaaaa8888ݏݏݏݏvvvv????ppp; ?/+?|||^oo@@@xxxY_O` `ȃȃ> @ ppp `? 6&;00xEpzr|Et0{ۜ%ۜ[۴%( ?p&\ԃo`o0dugȐ@"? :????po;sss=B"')R{_H~?,???` s@>y;p|?@:(/ >={?ppp [~7? 37@yo ??Ov GgCw  ̿AH ?{CH~c?@ ?o(_o/@(/: ===###wk? mmm?,?,Y6+?"??>?>?,?,"9^9^9^m;+9;r```ֿֿֿom[000_ ! {n`! _ ! _ a`1??o8W1? 0H=||||c## ߀!߀!! ! @@@߁ @ ?? ?! ???????!????????? ???P>ww``pp@?/?GTp }wr]]@@Dٿ1ixCϽWU3nZ"7MVI÷ޕ'j@W8'Gyg~w~???wÞ=Lo?!!????!!/!!???Iw u``@?>y[O???????????ҿ????#=wgڈ?????????3??????-{kz?_pDϻNppp@"`@888#"p@@ \@ p???p???`?????????????????????? ???????????/?????```????????? @@@???????????????iX?3/ %).   xxx  dnd     xdd !!#$"#$"#$"#$"#$"#$"#$"#$"&%%nx2&)'2&*(2&)'2&013+,-3+./3+,-3+64xxn37993855xnn3=::3>;;3?<<;96543211000;96543211000:62000000000;62000000000<:7543211000;96543211000;73000000000;73000000000*&" +&" +'# +'# 900000900000900000900000000000<:8500000000000000000000=;9752000000000000000000=<9200000000><5000*p(p$p p p p p p p p p p*p(p$p p p p p p p p p p*p(p$p p p p p p p p p p*p(p$p p p p p p p p p p*p(p$p p p p p p p p p p*p(p$p p p p p p p p p p*p(p$p p p p p p p p p p*p(p$p p p p p p p p p p000000000000000000000000000000==;:87654321100000000000000000000000=94000000000=<9200000000><5000;97555544444<93322<82111<60000000000=<;:97<:5421<;:988766655555544322221110000000000000000000000ǜ\[ZZZZZZZYXǜŜțȚȚȚȚȚȚȚșȘȗМ̛̙̜̚̚̚țȚȚȚș|yxvsoppppppppppppppppppppppppttttttppppppppppppppppppppppppttttttpppppppppppphhhhhhhhhhhhhhhhhhhhhhhhppppppppppppppppppppppppttttttpppppppppppppppppppppppptttttt||||||ppppppppppppppppppppppppTTTTTTTTTTTTppppppXXXXXXXXXXXXTTTTTTTTTTTTppppppXXXXXXXXXXXXTTTTTTTTTTTT?p>ppppp:pppppp?pppppp:pppppp?Tppppphhhhh?dddddd?TTTTTT?ppppppXXXXXXXXXXXX?T>TTTTT?TTTTTT?p>pppppppppppppppp?||||||tttttttttttt?p>p=ppppppppppppppppp?||||||tttttttttttt?p>p=p?=>?=>?>?><pppqv|||||ztpppqv|||||ztpppqv|||||ztpppqv|||||ztpppqv|||||ztpppqv|||||ztpppqv|||||ztpppqv|||||ztpxxuppppt|~||pxttt|||pppp||zt|}~|xtlljd`dlqrttlhd^X?<?<?<?<<<<<<?>=<UVWXXXmnoppp]^_```mnopppefghhhmnopppefghhhmnopppefghhhmnopppefghhhmnopppefghhhmnoppp]^_```mnoppp<;::<<<<::<WUTTTTSTVSWQWUTTTTSTVSWQOMLLLLKLNKOIOMLLLLKLNKOIGEDDDDCDFCGAGEDDDDCDFCGA;9888878:7;5?=<<<<;<>;?9CA@@@@?@B?C=OMLLLLKLNKOIGEDDDDCDFCGASQPPPPOPROSMKIHHHHGHJGKEWUTTTTSTVSWQca````_`b_c]WUTTTTSTVSWQpppppppppppp````````````hhhhhhhhhhhh````````````hhhhhhhhhhhh````````````hhhhhhhhhhhhXXXXXXXXXXXXĽȼȻțțțțțțțȚș<;:<;<;:<;нȼȻțțțțțțțȚș<;:<;<;:<;CA@@@@?@B?C=OMLLLLKLNKOIGEDDDDCDFCGASQPPPPOPROSMca````_`b_c][YXXXXWXZW[UWUTTTTSTVSWQWYPSXPXLS\UL<:<<<<   <;:<;<;:<;<;<;:::::::::::::96̝ȜțțțțțțțțȚș|{wvrqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqlmlihideda`a\]\YXYTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTU<;::::::::uokgdbbac`a`a`a`a`a`a`a`a`a`a`a`a`a`a`a`a`a`a`a|xuqomjjijhihihihihihihihihihihihihihihihihihi~ywtsoonnlmlmlmlmlmlmlmlmlmlmlmlmlmlmlmlmlmlm}vvsrqrpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpqpq=;:=;:=;:=;:`Z&o#xTAB(HSB$H  g  g  f RSBj` g =g %gJ`Rpr A9nA0m/ПЁRSBk`Jg n <#p`zRpr A9nA0m/ПЁRSBkT`JgN n <#D`8Cx `CxrRSBk$  g  g  gQp`JBkQB"+ҫ p$9Df $`nԀ n$<&ւֹp// Bg?<JNAJg0<`6 .Ap#x@#xD#xHNO/ K,MN9Xp??<LNA` /`p/NXX3Hy|N-XNi$A////NnO3HyHyHyxXN[ O 09H/NgX09U@flHy|p/NkfPBp /NXDP#N./9p /NXDP09HB/NgP09H/N[xXNj`xp/NXX#a(a'a(Ba)Xa(@/<p/NXDPJfa8Jg`09HB/NgP09H/N[xXNja*$NuNV/<'NWXa&p/a)8X09Hr//Ne P09Hr//NelP09Hr//Na`P09Hr//NddP09Hr//NdP09HA////r //NcXO=|#=|=|=|sp/HyyHyy_pZ/a OJgpN^Nup/a"XJgpN^Nu-y#p/p/p/pP//<ph//<a#O#p///9p/NXO09Hr7/r_/rOJgpN^Nua p//9/p/NXOa la!p/pZ//<pF/p`//<BaOp/pF/pp/pq//</</<ahOp//9/p/NXOa BHyyHyypd/aOJgpN^NuHyyp /NXPa |/<a$6Xp/HyyHyyQpP/a>OJgpN^Nuap/p-/p /pD//<p;//<aOa p//9/p/NXOHyyp /NXP/<a#XBHyyHyyp\/aOJgpN^Nuap/p4/p /pk/p`//<"Ba*Op/pK/pP/p\/p/p|//<aOalp/HyyHyy/<a8OJgpN^Nup /HyyHyy_p1/aOJgpN^Nua^p/p/p/p6//<pF//<aOHyyp /NXPp//9/p/NXO/<a"Xp/p/p/p6//<pF//< a&O/<a"LXp/p/p/p6//<pF//<aOaZpd/a"Xp/p/p/p6//<pF//<0aOpd/a!Xa^09Hr//Ne P09Hr//NelP09Hr/r2/r//</N`*Op/p /p/p,//</</<a2O09Hr//rR/Hy}{r//</N`O09Hr//rU/Hy}r#//</N`O09Hr//r2/Hy}r-//</N`Op/p/p/p6//<pF//<0aOp//9/p/NXO/<a Xap//9/p/NXOBp /NXDP#a0N./9p /NXDP yRz dgpN^Nu/<a XapN^NuNV09@H/@r NZJWDHH y|"X49=@-AUBg09>H yRzHHm yRzHH"/m 9RT#R @zRRHHm lN`z``````:`J``` ````2`J`Z`````0`b````````p/p/p//p(/pd//</<a~O`9V V`W`p/p/p?/pH yRzHHfl yRzHHrNZTѹR`H9V V`4p/p/p/p6//<pF//<aOpd/aXp/p/p/p6//<pF//< a`O/<aXap/p/p/p6//<pF//< a(O09Hr/r2/r//</N`*Op/p /p/p(//</</<aO09Hr//re/Hy}r /re//N`Op//9/p/NXO/<aXa2p//9/p/NXOpd/aX`9V V`p/p/p/p6//<pF//< aOpd/aFXap/p/p/p6//<pF//< aO09Hr/r(/r//</N`*Op/p /p/p(//</</<aO09Hr//rP/Hy}r/rw//N`O09Hr//rF/Hy}r%/r|//N`Op//9/p/NXO/<aLXap//9/p/NXO/<a"X`fp/p/p/p6//<pF//< aO/<aXadp/p/p/p6//<pF//< aO09Hr/rP/r//</N`*Op/p /p/p(//</</<aH 4g 8f6p/p /p/pR//</</<a0O\`09@H g $g09@ @Hg @Tf:J9]fdp/p/p/pD/pl//</<aO]`2p/p /p/pN//</</<aO^09>H 0g 8g09> @@f09@HJg]g09@ @ g @f:J9`f2p/p/p/p]//</<6/<aO`09@H g Nf2p/p /p/pR//</</<aO\09@H 6g Zf2p/p /p/pN//</</<aO^9ZgD09@HH@J@f2p/p /p/pR//</</<a0O\9Zgp09@HJg g09@ @0g @Hg @Tf2p/p /p/pR//</</<aO\09@H g $g09@ @6g @Bf:J9`f2p/p/p/p]//</<6/<a`O`09@H *g 6f8J9]f0p/p/p/pD/pl//</<aO]09> @fP09@ @/oD @Zg>HH@J@f2p/p /p/pN//</</<a O^9ZgJy@g09@ @$g @0g @TfrJ9`f2p/p/p/p]//</<6/<a LO`J9]f0p/p/p/pD/pl//</<a O]9Zg>Jy@f8J9]f0p/p/p/pD/pl//</<a O]09@ @Bf2p/p/p/pN//</<'/<a O_09@ @Hf:J9`f2p/p/p/p]//</<6/<a BO`09@ @Tflp/p/p/pN//</<'/<a O_J9`f2p/p/p/p]//</<6/<a O`9ZgJng8J9]f0p/p/p/pD/pl//</<a ~O]Jy@g 09@ @Tf2p/p /p/pN//</</<a 8O^09@ @0f:J9`f2p/p/p/p]//</<6/<a O`9Zg09@HrNZSf09@Hr NZ_f,p/p/p//p@//</<8p /a O`NW|Jf,p/p/p//p@//</<8/<a LO`dNW|Jf,p/p/p//p@//</<8/<a O`(p/p/p//p@//</<8pP/a O9VgJng(p//p//<p?//</<a ONW|/@NW|"/ gd g2 {f|p/p/p/p\/p(//</< a HO`Rp/p/p/p\/p(//</<a O`(p/p/p/p\/p(//</< aO9VgL09@HJg8 g009@ @g$ @$g @*g @6g @Bg @Hg @TfW9VgF09@HJg2 g*09@ @g @*g @0g @Bg @Hg @TfW9VgJngW9WHH gZ g ftp/p/p/pz/p,/p|//<aO9WSW]f:NW| d$N``4`Z`p/p//pt/pP//</<azO`p/p//pt/pP//</<aPO`p/p//pt/pP//</<a&O`p/p//pt/pP//</<aO`fp/p/p/pz/p,//</<aO9WSW`.p/p/p/pz/p,//</<aOB9WJ9Xg0Jng*p/p///</</</<a\O9Xg 09@ @\fNW|R[J9XgBNW|Jf2NW|r/r/r/rw//</<V/aOJ9[gbJng\9[HH29@H/@ rNZJVDHH"/UҀp/p/p/pe//</<e/a|OJ9\g<9\S\Jf*p/p /p/pR//</</<a8OJ9]g:9]S]Jf(p/p/p/pD/pl//</<aOJ9^g<9^S^Jf*p/p /p/pN//</</<aOJ9_g<9_S_Jf*p/p/p/pN//</<'/<anOJ9`g<9`S`Jf*p/p/p/p]//</<6/<a*O . y|c"` . y|bBn nlRn`N^Nup[Z`_^]\XWVBRNuNVpSn =@=@.f3/b0.H/@r(NZT"<e /倒 / /Ar NZTrNZ"/=Ap /NXDX-@Jf09bnl0.H n  gl0.H n  fBn0.H n  fR/.r /=@NXP`.ga`aX0.H n HH29bH4. H///a:O .gHp/pP//pF/p`//</<aLOp/pP//pF/p`//<Ba*Op//9/p/NXO0.H/@R n 09bHHHЁ"/T n 2. HHH҂4.RB&/V n =BHHH3b=A opBn /X=@`^ .N^NuNVBn0.Hl,p/HyyHyyqpZ/aOJgpN^NuRn`pN^NuNV0. @=@ H/@T @xn0. "/RH"@xn0=@4@=B=A H/AT Axn0. "/RH"@xn0=@4@=B=A H/A Axn0.=@02.A=@0. "/RH @xn0R@@33x=A H Axn0.=@04.B=@ Axn0R@33z#09HHyHytHnr//Nf ON^NuNV0.?@S@2/A33x2.?ASA4/33z#4. =B@=B4.=BA=B4.=B@=B4.=BA=B49H6."HHyHytHn//=@=ANf ON^NuNVH 9"9#p///p/NXO*y(y~ G@l (XXRG`L0N^NuNVH 9"9#p///p/NXO y+*H y+(H~ Gl (XXRG`L0N^Nu/<}/9/9NYO NuNVHp=@=@=@=@~ Gl@ "9ҀPp/p/Hn/NY0O Gfp=@=@=@RG`/<}/9/9NYO /<}/9/9NYO LN^NuNV=|Bn0. @l,"9ҀPpH/p/Hn/NY0ORn`N^NuNVBHy}p=/NXDO =@H/9/</r?/NXDO0.H/r>/NXDPN^Nu 9#tp33|p33~p33p333333Nu/<N@X#/<~N@X#/<}N@X#NuNVBn nlD0.H/@ @20."/RHt//t/=A/HNXO o0`Bp//p/NXO 9"9##N^NuNV=|Jnkp /aX0.SnH/aX`N^NuNVBn0. @l yXH/@-H0=@H/@2. HNZT/A rNZ"/p$/ /@ NZTrNZp"/Ҁ //A"NZTrNZ"/Ҁ///p/NXO Rn`BN^Nu09H/"9//t/NXOHy2p/NXPNuNVB .r(NZT".lR`N^NuNVB/.p=/NXDO Hyhr//r?/-@NXDO3l:3n43p609v38J@g 3HB`3`B094HT/N@X#009BH296HT//N@VP#dHyhp$//.p?/NXDO094HR/90//.r?/NXDO096HR29BHNZT yd///.r?/NXDO/.p>/NXDPN^NuNVHap3h3j=|3>pd3<3T3R3Pp3N3L3J=@Jnf09>H y00Hm\ lRN``v``f`0``D`Sn0.H @h0T@f=|Sn0.H @h3>`l09>R@3>H y03J09>R@3>H y03L09>R@3>H y03N09>R@3>`09>R@3>H y03P09>R@3>H y03R09>R@3>H y03T09>R@3>`09>R@3>H y03<09>V@3>`V09>X@3>2.?ARA4/H Bh0?ARA0/H @hBP=A` 09>X@3>2.H/AS AhHW"y002Af /UBn=@Jnk09>H y00R@f=|09>H/@ y00H WDHH^WDHH’0.HЁ"/X3>=@`0.H/@S @h0R@0 /U @h3>`09>R@3>H y00J@j09>V@3>`0.?@R@2/H Ah29>H/AV0?@ R@2/ H Ah0"/ y02SAA3>=@`09>H/@ y00J@ZDHH09>$/R3>H y00H69BH/A"NZTd(/"NZTH/B y02JAZDHH29>(/R3>H y02H=@ NZTd"NZTH/D y02JAZDHH29>(/R3>H y02H=@ NZTd"NZTH/D y02JAZDHH29>(/R3>H y02H=@ NZTd"NZTBy@=@09@29BAl0.RnH ydp0/aHXByH0.RnH ydp0/aX09HR@3H0.RnH ydp0/aX09HR@3H0.RnH ydp0/aXN vp /NXDXJg&p/NXDX g 3d@Rn09@R@3@`aLN^NuNVBn09<29:"<NZ2.HlRn`N^NuNV .? @~H=@. gSn. gRn . f ./aX`09HH @J02.@=AJAjBn n_o=|_0.H/@ @} .r4H/@ NZ"/R A}2H$//@ NZ"/ Ҁ/aX. gaR`a. ga`a* .29HH AP2HNZrdNY/aXN^Nup/Bp/NXO 3D3FBaXNu09DH/</r/NXO NuNV09H@r2. =@H//t/NXO p0. 2.H//t/NXO N^NuNV0. H29HH//t/NXO N^NuNV0. H/</r/NXO N^Nu09HH"<UWDHH’09FH3FH/</r/NXO NuNV09HH/@R WDHHЁ29FH3FH/</p/NXO N^NuNV09HH/@R WDHHЁ"<09FH3FH/</r/NXO N^NuNV09HH/@R WDHHЁ29FH3FH/</p/NXO N^NuByHBabX3HBaRX3HBaBXNuNVBZp#V Vl nHHR"@dgR` nJgZ 9VRV @Z  nHHJgR"@dfR` nrR@JfpNqHyHy~HyxN=*O 9x -@ >g"HyHy~Hyx N=*O -@` HyHy~Hyx!N=*O -@Hy Hy~Hy~N=*O -@Jf p/NO0XJf/.Hy~N;Pp/N gJfV n@`\.gp`p nHH`8.gp`p` nHH` nBp#HpN^Nup n@ nJf-|B . lFr NZT @(R//.NZPJf .r NZT @("nPR` n(Jf.g /.NRbX.gp` . //.NOP n!@JxPg@ . JgB/.NQP n!@JxPgJp#H nBpN^Nu .  f$ n/(NRXp#H nBpN^Nu .N^NuNV . ". ///.a|O N^NuNVJjp#HpN^Nu/.aX-@JfpN^Nu n(HH dN``` ``/./. n/(NRO -@JxPg JfpN^Nu ng .N^Nup-@-@ .lZ n R@HH g f$ .Sr///.aO .N^Nu n R`JfJfB .N^NupN^NuNVJjp#HpN^Nu/.aX-@JfpN^Nu n(HH drN``` ``P ngp/B/.aLO ng0/./. /(NRO -@JxPgpN^Nu .N^NuB.p-@-@-@ .l n R@ f . g | S n .R.-@A m/Hy n/(NRO -@갮gpN^NuJxPgpN^NuB`hJg:/.Hy n/(NRO -@갮gpN^NuJxPgpN^Nu .N^Nu .N^Nup#HpN^NuNV/.a X-@JfpN^Nu n(JgpN^Nu/./. n/(NS$O -@JxPgp#HpN^Nu f`JgZ nfN .S-@Jk4B/./.afO Jgp/Hn/.a\O JfS` .RN^Nu .N^NuNV/.aLX-@JfpN^NuB n/(NRXJxPgp-@ nB .N^NuNV/.NRbXJxPgpN^NupN^NuNV/.aXN^NuNV/. /.NPN^NuNV .xHopN^Nu yxD .ѹxDxH N^NuNV/.aX-@JgN^Nu | N^NuNV 9xDx@ѹxH#x@xD#X#P#\#T N^NuNVa-@JfpN^Nu /./9$azP n-@Jfp-@ . dN```4`L`XJ fDA"n"`(  f*A"n"`  fA"n"`A:"n"`  fA"n"`A"n"`  f. .r/@B///r/r/NWO #xP/.aXJxPWDHHLN^NuNV .r/@///r/rA/NWO#xPJWDHH N^NuNVJfB/./. /.aON^Nu"n QB/./. / NON^NuNVJfp//./. /.a`ON^Nu"n Qp//./. / NON^NuNVH Jf pLN^NuAJ$n"Rg pLN^Nup". /. n/(/. /p/pB/NWOLN^NuNVJgp@`p?r$.". v/A////./ n/(v//-@NWO-@Jj #xPpN^Nu .N^NuNVBp/NWP n pN^NuNVB .l& n HH/r/r/NWO R` .N^NuNVB .l& n HH/r/r/NWO R` .N^NuNVv . lS`p}@A r//r/r /NWOp /p/p/NWO .HHr-Ax-@| .|T".xl>6@w f| w .wf .xUDN^Nu .xU n wRx` .| }l n  .|RN^NuNVB .lP n @HH fp /p/p/NWO .HH/r/r/NWO R` .N^NuNVJg .`pN^NuNVB . l" @>Jf @> N^NuR`pN^NuNV nBN^NuNV. am zn aAN^Nu. N^NuNV. HH/aX.HH/@aX/fp`pN^NuNVp-@p-@p-@-@ n JgR`B . nJg n@JgR =g ,f .S".f .N^Nu .R.HH n HH//-@a2PJfB. ,g =f p-@p-@ .,fRR`^Jg .S".f .N^NupN^NuNVHnBaPP ."<]NZV"<NY-AHnp/a P .N^NuNVHnp/aPN^NuNVJ. f n (` n #(N^NuNVH*OBxPpn@N?.*?.&?."?.?.?.?.?. NA.ML?N^NuC,# O0/@11g"HS@4TBB$0 g/`?S@j?(NA.yNuC# O0/@11g"HS@4TBB$0 g/`?S@j?(NM.yNuC# O0/@11g"HS@4TBB$0 g/`?S@j?(NN.yNu /ob"/ o\ o"of>/f6/ f.f$ Sf"oSf`"$0Sf"oSf`$Sf"oSfNu o"o / oe  SfNuSfNu o /o "/ SfNu//Jg"JgBv㒴eQ"`BB&$NuH<*g2jD(g(jDBv㒴eRQ"jDjD`BBL1o<"/ !A:!o1o81|.!@21| ,No|AoCD!ICD!IHNuAo1oD1oH1o D1o81|.1|21|g,No|HNuAo!o1o81|.Bh21|r,No|AoCD!IHNuAo!o1o81|.Bh21|61| ,No|AoCD!IHNuAo1oF1oD1oP1oF1o D1o81|.1|21|6BhHBhJBhLBhNBhR1| ,No|HNuAo1oF1oD1oP1oF1o D1o81|.1|21|6BhHBhJBhLBhNBhR1| ,No|HNuAo1oL1oF1o D1o81|.Bh21|6BhHBhJBhN1| ,No|HNuAo1oF1oD1oJ1oH1oF1o D1o81|.1|21|61| ,No|HNuAo1oF1oD1oJ1oH1oF1o D1o81|.1|21|61| ,No|HNuAo1oJ1oH1oF1o D1o81|.Bh21|61| ,No|HNuAo!o1o81|.Bh21|61| ,No|AoCD!IHNuAo!o1o81|.Bh21| 61| ,No|AoCD!IHNuAo1oF1oD1oH1oF1o D1o81|.r"oRJf1A2p"o/ EH4Q$_h21| 61| ,No|HNuAo1o D1o8Bh.1|21| ,No|0(DHNuAo1o D1o82<"o C/ EF4Q$_Bh.1|21|,No|HNuAo1o D1o8Bh.1|21|,No|0(DHNuAo1o D1o8Bh.1|21|q,No|HNuAo1o D1o8BhF1|.Bh21|,No|0(DHNuAo1o D1o8Bh.1|21|,No|0(DHNuAo1oF1o D1o8Bh.1|21|l,No|HNuAo1o D1o8Bh.1|21|,No|0(DHNuAo1o F1o81|.Bh21|,No|0(FHNuAo1o D1o8Bh.1|21|,No|0(DHNuAo1o F1o8BhD1|.Bh21| ,No|Ao"o 2D"o2F"o2H"o2JHNuAo1o D1o8Bh.1|21|k,No|Ao"o 2D"o2F"o2H"o2J0(DHNuAo1o D1o8Bh.1|21| ,No|0(DHNuAo1o D1o8Bh.1|21|,No|0(DHNuAo1o D1o8Bh.1|21|,No|0(DHNuAo1o D1o8Bh.1|21|j,No|0(DHNuAo1oF1o D1o8Bh.1|21|',No|Ao"o2D"o2FHNuAo1o D1o8Bh.1|21|,No|0(DHNuAo1o D1o8Bh.1|21|,No|0(DHNuAo1o D1o8Bh.1|21|,No|0(DHNuAo1o D1o8Bh.1|21|h,No|0(DHNuAo /!@2!o1o8Bh.1|p,No|AoCD!IHNuAo!o>!o:!o 1o D1o81|.1|21|m,No|AoCD!IHNuAo2<"oC/ EF4Q$_!o>!o:!o 1o D1o81|.1|21|y,No|AoCD!IHNuAo!o >!o:1o8Bh.Bh21|n,No|HNuAo1oF1o D1o81|.Bh21|i,No|Ao"o2D"o2FHNuAo!o1o8Bh.1|%21|o,No|AoCD!IHNuAo!o:1o8Bh.Bh21|v,No|Ao"o2D"o ">HNuAo1o D1o8Bh.1|21|z,No|HNuAo1o8Bh.Bh21|{,No|HNuAo1o8Bh.Bh21||,No|Ao"o2D"o 2D"o2FHNuAo!o:1o8Bh.Bh21|},No|Ao"o ">HNuAo!o:1o8Bh.Bh21|~,No|Ao"o ">HNuAo!o:1o8Bh.Bh21|,No|Ao"o ">HNuAo1o8Bh.Bh21|,No|Ao"o2DHNuAoBh1|Bh1| NoAo0(0HNuAo!o 01o 21o01|1|1|1| NoAo0(0HNuAo!o 01o 21o01|1|1|1| NoAo0(0HNuAo1o0Bh1|Bh1| NoAo0(0HNuAo1o21o 0!o01|1|1|1|NoAo0(0HNuAo1o 0!o01|1|1|1|NoAo0(0HNuAoBh1|Bh1|NoAo0(0HNuAo1o 0!o01|1|1|1|2NoAo0(0HNuAo1o&@1o">1o<1o:1o81o61o41o 21o01| 1|1|1|3NoAo0(0HNuAo!o01o01|1|1|1|4NoAo0(0HNuAo1o01|1|Bh1|5NoAo0(0HNuAo!o0Bh1|1|1|6NoAo"o22"o 24"o26"o280(0HNuAo1o61o41o 21o01|1|Bh1|FNoAo"o22"o240(0HNuAo1o">1o<1o:1o81o61o41o 21o01|1|Bh1|GNoAo"o$22"o(240(0HNuAo1o:1o81o61o41o 21o01|1|Bh1|HNoAo0(0HNuAo1o">1o<1o:1o81o61o41o 21o01|1|Bh1|INoAo0(0HNuAo1o">1o<1o:1o81o61o41o 21o01|1|Bh1|JNoAo0(0HNuAo1o61o41o 2!o01|1|1|1|KNoAo0(0HNuAo1o41o21o 0!o01|1|1|1|LNoAo0(0HNuAoBh1|Bh1|MNoAo"o22"o24"o 26"o280(0HNuAo!o01o01|1|1|1|NNoAo0(0HNuAoBh1|Bh1|ONoAo"o22"o24"o 26"o280(0HNu"0<sNBNu"0<NBNu1.01ooqsuowosqu/90/9`/9/9;/?0;/?`;/?2///|/J0|/J`|/J:2/                      2F]^ _   2 B N P Z_ $%*0178P Q^NZ_^_ TT  T""T#$^$_&'_)N)Y)[)[*** ******0*2*6*<*B*H*N*P*T*V*Z*[*^*_--$-0-T..$.0.<.=.B.D.H.I.N.P.T.V00$000T11$1%101B1H1T1_ 33=]=_ ??? ? ?????*?+?T?U?V?Z?^?_CCCCC$C0C<CHCTDDDDD$D0DTD_CGGGGG$G0G<GHGTHHHHH$H0H<HHHTH]H^III0IHITIUKKK0KHKTKUMMM0MHMTMUOOO0O<OHOTOUOZO^RR^SSSSSS*S0S6S<SBSHSNSTZVVV0V1WWW0W1XPddemo.mus[1][Diese Grafik und Sound Demo|sollten Sie sich auf einem|Farbmonitor ansehen. Sonst|knnen Sie nur die Musik hren.][ OK ]Grafik und SoundDemovon Eckhard KruseReichenbergweg 733O2 WeddelNa los, Gnurp!Zeig, was dukannst!Hau' rein, Zottl!Zeig's ihnen,Schnatter!Alles klar?!onetwothreefourdemo.gra "$&(*-/258<?CGKPTY_djqw -?Rf{8Z~$T1pGG wa h 0 M  "$%')+,.013578:<=?ACDFHIKMOPRTUWY[\^`rwaaCan't open stdin file Can't open stdout file con:CON:prn:PRN:lst:LST:lpt:LPT:lpt1:LPT1:aux:AUX:com:COM:com1:COM1:rdr:RDR:pun:PUN:nul:NUL:null:NULL:CON:AXI:,AXO:,LST:,NIL:,CON:=* ((((( H ((((( H B H*"       (  &00 $ $   " $ $ $ ,     $ f  P r"H 4  6    .   8  4   h4   z4      6 6 466 6      D 244DD >D42 J4228 48428 4 6 ( ,4(.    &$ N. "  &        T             ( 4          ,N 6F  (&$  * "  .  "  (    P:$  :":V:l&$@T6(,j$&:P(J.z    ,$ , Xd`$  J $2 40 & 0  F H 4 T<@HF B >@@@*<  "" *""J "F0 "(V V @ H H : ((h "< "" &"( """&*".""""(""""&6P& (" "  "   00 0**T*"".4L@LL66.*FDer MUSIK-EDITOR (Platz 1 des Musikwettbewerbs der ST Computer) Diese Musik-Demo ist ein kleines Beispiel fr die Mglichkeiten, die der MUSIK-EDITOR bietet. Das Programm wird fr DM 44,- im Heim-Verlag vertrieben und ist das Siegerprogramm des Musikwett- bewerbs der ST Computer. Alle Besitzer eines Farbmonitors drfen sich glcklich schtzen, zustzlich zur Musik auch noch die Grafikanimation bewundern zu drfen (siehe Titelblatt ST Computer 12). Knurp an den Tasten, Zottl am Schlagzeug und Schnatter an der Gitarre bieten sicherlich ein volles Musikerlebnis. Eine nhere Beschreibung des MUSIK-EDITORS kann man in der ST Computer 11 nachlesen. ******************************************************************** Deze diskette is samengesteld door de Atari Computerclub Nederland. Postbus 5011, 2000 CA Haarlem. Onze bibliotheek van public domain programma's omvat op dit moment al zo'n zeventig diskettes. Daarop vindt u programma's op elk gebied, van tekstverwerker en database tot de leukste spelletjes, de fraaiste tekenprogramma's en de handigste utilities. U vindt in het tijdschrift "ST" ( Onafhankelijk tijdschrift van en voor gebruikers van Atari ST computers) een overzicht en een bespreking van de inhoud van de public-domain diskettes. Dit tijdschrift bevat tevens een bestelkaart zodat U vlot over de software kan beschikken. ***** Deze public domain disk is geproduceerd en gedistribueerd door: Stichting ST afd. Software Bakkersteeg 9A 2311 RH LEIDEN Ondanks onze controle komt het af en toe voor dat een diskje niet goed is gecopieerd. Mocht U dit overkomen, aarzel dan niet en stu`Z> o"h#\d#\h#\l,Oc.N//Bg?<JNA BbBy\pNNV?.?<NAN^ _ONNV?<NNN^NuNV?<NNN^NuNV?.?. ?<NNN^ _ON/,HNVA-H . S-@ . JfN^,_ _XN/,HNVA<-H?.?<N3^?. ?<N3^?<?<Nz3^N^,_ _XN/,HNVA-HBg?<NP3^N^,_Nu/,HNVA2-H?<N?<YN0.@ ?N0. @ ?NN^,_ _XN/,HNVA-H?<N?<pNN^,_Nu/,HNVA-H?<N?<qNN^,_Nu/,HNVAH-H?9^Hy^Hy^Hy^Hy^N:?9^?9^?9^?9^NEN^,_Nu/,HNVA^-HBgNI?<NI?.?. ?9^?9^NBF?9^NI?<NI09^rAl p/NN^,_ _XN/,HNVAJ-H0.@S@=@0. R@=@?.?. ?.?. NAR?.?.?.?.NARN^,_ _XN/,HNVA-HprA?BgBgBgp/BgBgBgBgBgBgBgBgBgBgHy^(Hy^Hy^Hy^HnHy^Hy^NLh3^09^2.49^HA3^09^@ 3^09^y^3^p3^p3^p3^?9^?9^N?9^?9^NRN^,_Nu/,HNVA-H?<BgBg?<(?< N*|-@ .Jgj/.?<Bg?<?<?< ?<Bg0<|?N+0=@/.?.CO$O p Q?<?<N0/.?<Bg?< ?<?<?<Bg0<|?N+0=@/.?.C4O$Op Q?<?<N0/.?<Bg?<?<?<?<Bg0<|?N+0=@/.?.CO$OpQ?<?<N0/.?<Bg?<?<?< ?<Bg0<|?N+0=@/.?.C@O$O pQ?<?<N0/.?<Bg?<?<?<?<Bg0<|?N+0=@/.?.CO$OpQ?<?<N0/.?<prArA??<?<?<?<BgBgN+0=@/.?.CfO$OpQ?<?<N0/.N//.BgN.=@/.N/B/.N+/9^H?<N*6N^,_Nu OK Used by Permission of OSS.Copyright (c) 1986, OSS and CCD.Portions of this product areBy Bob TedescoWindowBall/,HNVA-H09^`vNTrA=@pd/N|N@rA=@pd/NhN,rA=@pd/NT0.nnrAoBgBgBgBgNH?<?<?<?<NHp3^By^p=@ nnB0<2.}A=@?.0.?0.?0.?NHRn``NrA=@pd/NNlrA=@pd/NNXrA=@pd/N0.nnrA^0.nnrA]CBdp3^p3^BgBgBgBgNH?<?<?<?<NH0.2<HN$LvC}B=@pd/N0.2<HN$LvC}B=@pd/N0.2<HN~$LvC}B=@?<?.?.?.NH?<?<w?<w?<wNH`nBg?<?<?<NH?<BgBgBgNHp3^09^R@3^09^rAf p3^` @b@0;NzNN^,_Nu/,HNVA-H09^rAlNBg09^@?NlHy]&Hz|?<NTf?9^NT XBg09^@?N8Hy]&Hz:?< NTfXBg09^@?NHy]&/9_NSXN^,_Nu S: B:/,HNVA-HN?<NH?<NIBgNI?9^?9^?9^?9^NBF?9^NI?9^NIBn nn09^J@fpn?NIBn n n\09^2.AA?09^2.RA^A??<?9^NBF0. 2.AAA^N1^Rn`Rn`n?<NHNN8N^,_Nu/,HNVA,-HN\?<CpO$OpQN$t#^H/9^HCBO$OpQN l3_/9^H?9_CO$O p QN"3^/9^H?9_CO$O p QN"3^/9^H?9_CO$O p QN"3^/9^H?9_CZO$O p QN"3^/9^H?9_C O$O p QN"3^/9^HN)z/9^H?9^N(~/9^H?9^?<N'/9^H?9^?<N'p3^By^LNBy^3^^3@^?<NKTCtE] p Q09^J@fA=@Bgp @?N:3^?<p @?N$3^N?.0<^@?N 3^?<NI?<NI$?<NI?<NJN^,_Nu WindowBall 2Strike 1Strike ----------- Catch Throw Game About WindowBall /,HNVA-H09^y^np3^`09^y^m p3^09^y^np3^`09^y^m p3^?9^?9^N09^29^49^BA^ A3^09^29^^A3^?9^?9^NDN^,_Nu/,HNVAJ-H09^rAfp3^`,p3^09^rAfp3^` p3^N^,_Nu/,HNVA-H?<BgNj?9^?9^N?<NHBgNI?<NI?.?.?.?.NBFNH09^R@3^09^rAf&By^09^@A^20p@TA3^09^29^49^BA^ A3^09^y^3^0. 2. AA2. 4. BBA^N40SBA^N10. 2. AAA^N20p@oD09^J@fpn 3^BgNI?9^NI?.?.?.?.NBF?<NH?9^?9^NX 9_rd4. BHЁ#_Bg09^@?N@Hy]&/9_NSX0<H/N~NN^,_ _O N/,HNVA-HprA?BgBgBgp/BgBgBgBgBgBgBgBgBgBgHy^(Hy^Hy^Hy^HnHy^Hy^NLh3^09^2.49^HA=@0.y^gD?9^?9^N0.y^o =y^3^?9^?9^N`0<H/NN^,_Nu/,HNVA-H?<BgNp3^09^29^A Alp3^` p3^09^y^rH3^0<H/NN09^L|r|Af2pr A??<?<?<p/BgBgBgBgBgBgBgBgBgBgHy^(Hy^Hy^Hy^Hy^Hy^Hy^NLh=@0.rAJ@g09^y^=@?9^?9^NN09^n3^09^y^3^?9^?9^Npr A??<Bg?<p/BgBgBgBgBgBgBgBgBgBgHy^(Hy^Hy^Hy^Hy^Hy^Hy^NLh=@0.rAJ@gPN^,_Nu/,HNVA,-H09^y^m409^y^\09^29^AA]CBdN`Bn nn09^2.RA^A=@Bn n n09^2.AA=@0. 2.AAA^N20p@on09^n\09^2.A A]CBdH09^n\09^2.y^ΰA]CBd ?.?.?<?9^?.?.NLRn`PRn`"N^,_Nu/,HNVA-H09^29^XAAmn/<N^?9^?9^N?9^?9^NBn n n*0.2. 4.BBA^Np=@Rn`Rn`0.J@fNHN^,_Nu/,HNVA0-HNL2NNNNNf09^J@fNKN^,_Nu/,HNVA-HN3^09^`3^p 3^p3^3^p 3^By^p3^p3^`pj3^p3^p3^3^p3^p(3^p3^p3^`^3^p 3^p3^3^p3^p(3^p3^p3^` @b@0;N$fN^,_Nu/,HNVA-H09^y^3^09^U@3^09^29^AA3^09^29^UAA3^By^p3^p3^B_09^rAf09^@3^`09^@3^N^,_Nu/,HNVA-H09^rAf p=@`p =@?<BgBgBgp/BgBgBgBgBgBgBgBgBgBgHy^(Hy^Hy^Hy^Hy^Hy^Hy^NLh3^09^(`NKxNG3^0^3^2^3^4^3^6^09^y^ް|_09^y^ܰy^_CBd*?9^?9^?9^?9^?9^NNKxNG?9^HnHnHnHnN:0.rA^0.rA^CBd\BgNI?<NH?.?.?.?.NBF?9^HnHnHnHnN:0.J@W0.J@WÄCBd09^@ ?09^n?C6O$O"p!QN?09^@ ?09^2.AA?CO$O"p!QN?09^@ ?09^2.A?CO$O"p!QN?09^@ ?09^2.AA?C$O$O#p"QN?09^@ ?09^2.A?CO$O"p!QN?09^@ ?09^2.A?ClO$O"p!QN?NHNK`>@ @b2@0;N&&&&&&&&&&&&&&&&N^,_Nuright hand window corner to start.Click on the Full box in the upperball. Release the button to let go.down the right button to catch theWhen playing Catch, press and holdUse the mouse to move your paddle.A#\rA\v0B1|A]&01|NOJ@kNNND09^(rAW09^(rAWÄCBd09^(rAgNKxN\NLNNK`?9^N/9^HN)/9^HN'N\NP2Hy]&NS*BgNANu/,HNVNYA-HBn"n0.-I"n0)n m"n$n0*R@3@"n0)n m"n$n0*R@3@"n0n m"n$n0R@2"n0.0)r AJ@f0.R@=@`f0.n m4"n0.R@$n0.p"Q0.S@=@`N^,_ _\N/,HNVNYA -H"n 0-I"n0)rAfpT@=@`"n0)R@=@/. ?.N"n 0.-I"nBi"nBi"np. 3@"n3|"np 3@"np2"np3@"np3@"nBi"nBi "nB /. ?<?.N5/. ?.N6/. ?.A O"Op?"QBgBgN0pT@=@"n 0.Bi"n 0.=Q0.rAg@"n 0.$n 0.0*$n 2.j3@=n`"n $n 0.0*$n 2.j3@D/. "n ?)?<?<BgBgBgBg?<?<N4=@/. ?.N6"n 0.$n 0.0*$n 2.j3@=n0.N^,_ _ON/,HNVNYA-Hp=@0. U@S@=@"n$n0*=i0.rAo 0.S@=@"n0.=Q`/.?.?<BgBgp. ??<BgBgBgN4=@/.?.A O"Op?"QBgBgN0"n0.=iBn0.ng 0.R@=@"n0.=Q`"n0.3n/.?.N6"n0.0)"n2.io$"n0.$n0.3j"n0.=i"n0.$n0.3j"n0.3n=n0.N^,_ _ON/,HNVNYA-Hp@n =@?.N2-@/.?=@/.?.CO$OpQN=@/.?.CO$OpQN=@/.?.ClO$OpQN=@/.?.C2O$OpQN=@-n .N^,_ _ON Desk Accessory 6 Desk Accessory 5 Desk Accessory 4 Desk Accessory 3 Desk Accessory 2 Desk Accessory 1 -------------------- Desk /,HNVNYA-H/. N3bN^,_ _XNNu/,HNVtNYA8-H=n0. rA=@-nx?<HnHnHnxHntNQlN^,_ _PN/,HNVtNYA2-H=n p=@-nx?< HnHnHnxHntNQlN^,_ _\N/,HNVtNYA0-H=n Bn-nx?< HnHnHnxHntNQlN^,_ _\N/,HNVNYA*-H/.?. A O"Op?"QBgBgN0N^,_ _ON/,HNVnNYAL-H"n $n p*R@r=n"n / NS"-@r?<#HnHnzHnrHnnNQl0.N^,_ _\NNu/,HNVxNYp=@-n |?<HnHnHn|HnxNQlN^,_ _XN/,HNVxNYBn-n |?<HnHnHn|HnxNQlN^,_ _XN/,HNVxNY=n Bn-n|?<!HnHnHn|HnxNQlN^,_ _\N/,HNVxNY=n p=@-n|?<!HnHnHn|HnxNQlN^,_ _\NNu/,HNVNYAj-H0.T@=@?.N2-@/.?=n<-n$?<HnHnHnHnNQl=n"n2"n2"n2"n 2"n 2"n20.N^,_ _O3|NAXNu _4` _t6 Bo r aSB`2aNH?U _r ar a/L?UNu _r aN _4` _t"x0HgJJjDxvCUzp cRЀ`|e W0R"f`6 _4` _t2xJAjDAxvCUp0 2H@0RJAfJg<-RBlCSBr aQSCaQN _4v` _46"_JBjtJCkgCe4`BSCr aQSBk aQN _v` _60@d CTt`CTtJCgkCe4`BSCr aQSBavQNFALSETRUE _6kfv2_t Cc"4YBv` _6kfv"_t Cc4QBvSBkr a(QSCC" A0 9c^a JgYC`NH U"oA/ NUL UNuBy\b(_ _/ C( g  f4t4(H / /?(?<@NA LJkn gffNu4(SBraQNu(gN fH ??<NAXLNu f H ??<` f H ??<` f NuHyV` HyV0< LNPREWRITE required prior to WRITE or PUTDisk or directory full \dNu#X _ g\he\dd 9XNHyX`HyXNPt`t _"_0gR@| e.GX$S" ghjebb"*f&"`v&A%S"`l&J`ذ|gb*|f8"9Xg0$A#X`""9Xg$A#X`"9Xg $A#X"`"E\d&R"$b HyXNPJgr"QHd2S@k"QN _"_0" g\he\dd gR@ @mz @ e@EX"fB3@B$`\&A2+@ef "'I`F"3@B$`8$K`ư|f"X#X` |f"X#X` "X#XNHeap overruns stackPointer NILPointer not in heap _ hNVf 0(gr"OD@Hd2S@k "Q` _"y\de HyYhNPN#_~#_z .f -|YX`-|YX nNн_zf y_~NStack overruns heapH?_ _z gBjDRE"g8jDRE$6HBJBg8HAJAf,HBJBf$ւi EdD.` $HB8`B/L?_Nu0NvDNH_|` H_| _z f0NjDRE"g`jDREdJgR(`DfxJg<`DxSDbb JgHA8`"tcRЀ`xeWJg(MdD.`B/L_Nu09\bNu _3\`NBy\bNu[3][][ Abort ]Copyright 1986, CCD and OSS, Inc. ,*  XF    0:0,0,0,0,0.0   `Jx8  6  B     4 ~         &   &   Z    <  B  4. , "  8 R>    8   @                $  " & ( & ( (   $Z(d ($&$:42,0&$*,0.4\.0DX<"$>,$8(l*lrh\,&D0T>0,8&&,F.:FFFF*@4n(>2020nD(."F<"..ZJ"4\ZBBL:\  @@(&.$@$$2$*|4$&&$$6  LD"2 T &( 0&  >        p2J X L  <   , Fz V  ur de defecte disk aan ons terug. U krijgt dan direct een vervangende disk toegestuurd. ***** Teneinde het voor ons mogelijk te maken om productie fouten op te sporen en vervolgens in de toekomst te vermijden, zijn alle disks, geproduceerd door de Stichting ST, voorzien van een groen productie nummer. ********************************************************************