NNNNNN1p NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNN/O`  @`! #@%`')+-/1 3@5`79;=?A OE`GIKOQ S@U`WY[]_a c@e`gikmoq s@u`wy{} @` @ ` @ ` @ ` O ` ǀ ɠ @ ` ׀ ٠  @` O`!Aa   !Aa!!#A%a')+-/1!3A5a79;=?A!CAEaGKMOQ!SAUaWY]_a!cAeagikmoq!sAuawy}!Aa%!Aa!Aa!Aa!Aaǁɡ!Aaׁ١!Aa!Aa " B b  !"!B!b!!!!!"!""#B"%b"'")"+"-"/#1"#3B#5b#7#9#;#=#?$A"$CB$Eb$$I$K$M$O%Q"%SB%Ub%W%%[%]%_&a"&cB&o&O`  @`! #@%`')+-/1 3@5`79;=?A OE`GIKOQ S@U`WY[]_a c@e`gikmoq s@u`wy{} @` @ ` @ ` @ ` O ` ǀ ɠ @ ` ׀ ٠  @` O`!Aa   !Aa!!#A%a')+-/1!3A5a79;=?A!CAEaGKMOQ!SAUaWY]_a!cAeagikmoq!sAuawy}!Aa%!Aa!Aa!Aa!Aaǁɡ!Aaׁ١!Aa!Aa " B b  !"!B!b!!!!!"!""#B"%b"'")"+"-"/#1"#3B#5b#7#9#;#=#?$A"$CB$Eb$$I$K$M$O%Q"%SB%Ub%W%%[%]%_&a"&cB&o&CHEETAH F CONCORD F LDESKMG32 씃HHLEES DIT #Q `eKDTPAINT @F A385 ONX2NET lF s.  F..  FCHEETAH PRGF <CHEETAH V20F C!`\:tBKJ$f(By\O4/9n?<HNA\OJg.@n`6 - ЭЭйn"ҍ¼.A// Bg?<JNA #x yx/(,HhNrP/9/9?9NT?<NNVHNM|NRHnHnHnHn/9dNO?.?.?.?.BgBgBgBg?<NBONtNf/9?<IN\09`g0><`RG?<?<NTX GmB?< NA xNBgNTLN^NuNuNVH#Hy:?<&N\`P-y n1| n1| y*hBn`0.HBRn nm y# 9f#Hy:?<&N\`-y n1| y# 9fNH0<L N^NuNVHz?<&NN\`?<NATG6G|AA r!x~!xvGV!rG`!~Gl!vBgHzv?<=NAPJk ??<>NAXpG rgNup!Tr!R~!PvNu0:>ofa z4N0:,ofpNu z$N0:ofpNu zND:\X\00<`N^NuNV y#0<N^NuNVH=|,9d` B?<N\HnHnHnHnHnHnBgBgHnBgBgBgBgBgBgBgBgBgBg?<?<?<?<NO<>0|g0.| @ f><R`0.| @f09j6<@3j` x`0.| @fNN` V`HnHnHnHn/NOBG0.`?.?.?.?.BgBgBgBg?<NBONf6><`?.?.?.?.BgBgBgBg?<NBONm><`?.?.?.?.BgBgBgBg?<NBONq.><`~?.?.?.?.BgBgBgBg?<NBONT><`JBgNpT` Gf?<?<?<NT\` Gm Go G$mv G2nn0H/ </Nj  yd00|@f?<?<?<NT\` ,N0nfAl#Hy?<&N\ 9l"9tҼPl0H/ </Nj  yd-p n PH| gz GmH Gn@0|y6H/ </Nj  y200H y|0H@=@0.2|y6H/"</Nj" y220H y|0|C=@0|y6H/ </Nj  y200Hй|/?.BgN< PBgBgBgBg?<?</NOBgBgBgBg?<?</NOBgBgBgBg?<?<!/NOBgBgBgBg?<?<Q/NO`"0|$yH/ </Nj  y00H y0H@=@0.2|$yH/"</Nj" y20H y0|C=@0|$yH/ </Nj  y00Hй/?.?<N< PBgBgBgBg?<?</NOBgBgBgBg?<?<#/NOBgBgBgBg?<?<4/NON`:?NT=GAt#Hy?<&N\N7rN` G8m, GGn$=|8`0.ΰGgj0.H/ </Nj  yd00 |g>0.H/ </Nj  ydBp BgBgBgBg?<?./NO`0.H/ </Nj  yd00 |fh0.H/ </Nj  yd00 |f@0.H/ </Nj  yd1 BgBgBgBg?<?./NORn nGo0H/ </Nj  yd00 |fAl#Hy?<&N\ 9l"9tҼPlF0nf> yHg yg0.|f><` yg 0.|g><`fHnHnHnHnNO`HnHnHnHnNO0.|f=GAt#Hy?<&N\` GKg GIgNN7r0`B?<N\BgN8TNBgBgBgBg?<?</NOBgBgBgBg?<?<!/NOBgBgBgBg?<?<Q/NO`8B?<N\?<N8TBgBgBgBg?<?<#/NOBgBgBgBg?<?<4/NO`HnHn?<"/NO0.̰nlZBgBgNXHnHnHnHnNO`&BgBgNXHnHnHnHnNO0.|f`\?<BgNXHnHnHnHnNO`(?<BgNXHnHnHnHnNO0.|f`HnHn?<5/NO0.̰nl^Bg?<NXHnHnHnHnNO`(Bg?<NXHnHnHnHnNO0.|f``?<?<NXHnHnHnHnNO`*?<?<NXHnHnHnHnNO0.|f`"BgNT`?<NT`BgN1TN`?<N1TN`BgBgN4X`?<BgN4X`Bg?<N4X`?<?<N4X`?<NpT`BgNpT`tN#N`dNTN`TN,bN`DNtFN`4N3&N`$0<`$`"|2<4 |RN$N0<fLN^NuNVHJyHf0<`BBG`0H/ </Nj  y20g<H/,</Nj, y2<0h:H y|0XHHʼ 2H y|0HH¼၀* 2H y|0HH¼၀* 2H y|0HH¼&<础* ؀RG0H/ </Nj  y2 pf yd&htHy/NPBgBgBgBg?<?<O/9dNOJf(BgBgBgBg?<?<Q/9dNO0<`//NSP*S(M`RH| g`RRfBHy /NPBgBgBgBg?<?<O/9dNOBgBgBgBg?<?<Q/9dNO0<L8N^NuNVH*yNZ|. ѹBy8/ N]X38#0<L N^NuNVH09f0<`rBF`>0f:<`:<$BG`$BgBgBgBg?<0G?/9dNORG GmRF FmBgBgBgBg?<?<J/9dNOBy0<LN^NuNVH0.gRy yfBy`09f3SyBn`$0.f(=yH=y6-y2-y|=|`&=y=y-y-y=|$ nf`BF` A `RF F mBF`v:nH/*</Nj* n:0X09`0H n-pA*HG-mGA Z//.NSP.H| f|0`^A Z/0H n?0Nt\`:A Z/0H n?0N|\``|gX|g|g09gd0.FH/ </Nj  yd-p n*PA  n BgBgBgBg?<0.F?/9dNO n `$BgBgBgBg?<0.F?/9dNORF0nH/ </Nj  n pg Fm`Rn nm yd-h n*P09`6A(  n `6A.  n `$A4  n `|gư|gҰ|gBgBgBgBg?<?<J/9dNO n 0<L N^NuNVH>.|0.@=@0@>0.G=@>.|G0 |0 n 0 H@|0 n @ n |/>.|0 |0 n @0 H@|0 n @ n |/>.|GG|P0 |0 n @0 H@|0 n @ n B(0<LN^NuNVH>.|0.H=@0@>0.G=@>.|OO0 |0 n 0 H@|0 n @ n |:>.|O0 |0 n @0 H@|0 n @ n |:>.|G0 |0 n @0 H@|0 n @ n B(0<LN^NuNVH0.f=|"=|!-y2=|`=|5=|4-y=|$HnHn?./9dNOHnHn?./9dNOHnHn0.H/ </Nj  yd?00.H/ </Nj  yd?0?.?.?.?.0.H/ </Nj  yd?00.H/ </Nj  yd?0NNO=@0.f0<`Bn`Rn0.H/ </Nj  n pfnJnl0<`0.n0.H/ </Nj  yd002.H/"</Nj" ydp=@0.d2.RA=@>.dμ0.d2A2.HAc 02.AdRG0.f36`3Bn`0.nH/ </Nj  yd-p 0n/ </Nj Ю n 0n/ </Nj  n02.nH/"</Nj" yd|1 BgBgBgBgBg0.n?/9dNORn nm0?.NTBgBgBgBg?<?./9dNO0<LN^NuNVH0.f>96-y2=|!=|"`>9-y=|4=|5BF`RF0H/ </Nj  n pf0<@:.H/*</Nj* yd:0X2.H/"</Nj" ydp0:0:0.H/ </Nj  yd10<LN^NuNVH0.f-y28<!=|"`-y8<4=|5BE`RE0H/ </Nj  n pfRE0H/ </Nj  yd=p0.=@0.=@0.2H/"</Nj" yd20AeD0H/ </Nj  yd002.H/"</Nj" yd1`$0.H/ </Nj  yd10.H/ </Nj  ydBp0<LN^NuNVH0.f<96:<-y2=|!`<9:<#-y=|4BG`RG0H/ </Nj  n pf Gl?<?<?<NT\0<`0. f40f?<?<?<NT\0<`BD`SD0Dg Dn`@02|Al?<?<?<NT\0<`BD`RD0D|Gn DmBG`20R@GH/ </Nj  yd-p 0DGH/ </Nj Ю n 0DGH/ </Nj  n0H| f&0R@GH/ </Nj  ydBp`&0R@GH/ </Nj  yd1@0DGH/ </Nj  n02RAGH/"</Nj" yd|1 BgBgBgBg?<0R@G?/9dNORG Gm0D<0.f36`3?.NTBgBgBgBg?<?./9dNO0<LN^NuNVH nm nn<<`<<#0.H/ </Nj  yd00 |gBG`><0.H/ </Nj  yd1 BgBgBgBgBg?./9dNOHnHn?/9dNOHnHnHnHnNO`&?.?.?<?/9dNhO =@ ng0.H/ </Nj  yd00|@gl0.H/ </Nj  yd00 2Ag@0.H/ </Nj  yd1 BgBgBgBgBg?./9dNO`L0.nm,2.0H/ </Nj  ydp0.An2.0H/ </Nj  ydp*0.AlN7r FfBgBgN4X`Bg?<N4X0H/ </Nj  yd00"2Agf0H/ </Nj  yd00 |@g@0H/ </Nj  yd1"BgBgBgBgBg0R@?/9dNO`2.0H/ </Nj  ydp*0H/ </Nj  yd00.@0.AmN7r Ff?<BgN4X`?<?<N4X0H/ </Nj йd @0(r2Agl0H/ </Nj йd @0(p|@gD0H/ </Nj йd @1GrBgBgBgBgBg0|?/9dNO`?<?<?<NT\HnHnHnHnNO0.|f0<LN^NuNVH<$yHn?< BgNPHnHnHnHn/.NO?.?.?.?.BgBgBgBgBgNBO?.?.?.?.BgBgBgBg?<NBO n-h< n PBBgBgBgBg?< Bg/.NOBg/.N\=@ ng n PgBn`@0. n P0H|:g0. n P0H|\f0. n P_Rn0. n P0f nf&&y|*yA-H(y=yH`$&y*yAL-H(y\=y nf Hy:?<N\N+0<` Bn`Rn0.H3fBn`Rn0.H/ </Nj  n00fSn0.2.H/"</Nj" n20AAm0.f$Hyj?<N\N+0<``b<.H/,</Nj, n<0h`0<50 ue><`RG005g0le0lf Hy?<N\N+0<`0;0;0.H/ </Nj  nTp09Hyf^ nf,0 y10 y1`*0 y10 y10.HЋ-@Bn`0. nB0Rn nm><`RG005g0le0lf Hy?<N\N+0<`Bn`&0. n P02.4.Hԋ BRn n l0. n P0f`0.2.Hҋ A Rn n m0.H 0;?<,NT=@0.|2.H0.@2.H?<*NT=@0.|2.H0.@2.H0|2.H0H2.HBn` 0.B2Rn nm.=|` 6.HЃ @ Rn n m| 0|@0H@|. |.!=|"` 6.HЃ @ Rn n+m|+0.H/ </Nj  n00|@:0.H/ </Nj  n00H@;?.0U@@l ??</ ?<?<NTO nf6BgN$TBgNTBg/9?9HNJPBgN@T`<`f Gf(y2`(yBF`.0H/ </Nj 4H|g 0.G=@RF0H/ </Nj  tfRG Gm0.f.?<?<?<NT\Hy?<N\0<` nf.?<?<?<NT\Hy ?<N\0<`ZSn0.f(y2:9H*y|`(y:9*yBBBF`P0H/ </Nj 4H|g,0H/ </Nj 4H| fR`RRF0H/ </Nj  tfHn?<BgNP n/(96<<=|!`*y>9<<$=|40. gP0H/ </Nj йd @(h\ T(H| f?<?<?<NT\0<`RG`"0f?<?<?<NT\0<`SGBEBD`0EH/ </Nj  yd(p 0GH/ </Nj Ѝ(0GH/ </Nj 5H|2EH/"</Nj" yd1 BgBgBgBgBg0E?/9dNO0GH/ </Nj  ugRDRE Em40H/ </Nj йd @(h\ T(H| fJ0H/ </Nj йd @0(X|2H/"</Nj"ҹd A1@X`H0H/ </Nj йd @0(X|@2H/"</Nj"ҹd A1@X0.f36`3?.NTBgBgBgBg?<?./9dNO0<L0N^NuNVHBF`0f:96*y2=|`:9*y=|$BGBD`0GH/ </Nj  ufRD`0.DH/ </Nj  yd00 |g@0GH/ </Nj 5H|2GH/"</Nj"`>0GH/ </Nj 5H|2GH/"</Nj"RDRG Dm(RF Fm0<L N^NuNVH<0.f(*y-yA(H$y2&y|:<`&*y-y\AL(H$y&y:<BG`RG0H/ </Nj йd @0(J|f Gm GfdBF` 0H/ </Nj 2fRF`0H/ </Nj 02H3 H|g0H/ </Nj 02H3|=@0.@=@0.2H/"</Nj"22H3|C=@0H/ </Nj 02HЋ/?.?.N< PBgBgBgBg?<?/9dNO0<`0H/ </Nj 2H| f?<?<?<NT\HyJ?<N\0<`~0H/ </Nj йd @0(J|2H/"</Nj"ҹd A1@JBgBgBgBgBg0|8?/9dNO??<NTX-@Jf.?<?<?<NT\Hyz?<N\0<`BF`0H/ </Nj BRF Fdl0H/ </Nj  4f0.f#3H`#\3?./.?NJPHyBg?.N< PBgBgBgBg?<?/9dNOBgBgBgBg?<?<T/9dNO0<L9H-y|Aj*H=|`0(y&y\AL$H>9-yA4*H=|-M0<AGR:RBF0. f*8+?0+@R@??/.Bg?<NTO``RF\R0/ </Nj  2fBE` n 0P2¼/"</Nj"A P n 0PH| g n PRRE Ef6 n (H| f n ( H| f n ( H| g.R E exBD:. `2RD0:4JEfHy?<N\?.H4x H|H &<. .09J` 2.H4HHÀ. . 2.H4 HHÀ. . 2.H4 HHÀ.&X>.H4xHH . 2.H4HHÀ. . 2.H4HHÀ. . 2.H4HHÀ.&X>.H4xHH . 2.H4HHÀ. . 2.H4HHÀ. . 2.H4HHÀ.&X` 2.H4HH¼. . 2.H4HH¼. . 2.H4HH¼. &<&X>.H4xHHμ . 2.H4HH¼. . 2.H4HH¼. &<&XBX`0 g 2.H4HH¼. . 2.H4HH¼. . 2.H4HH¼. &<&X>.H4xHHμ . 2.H4HH¼. . 2.H4HH¼. &<&XBX`L 2.H4HHÀ. . 2.H4HHÀ. . 2.H4HHÀ.&X>.H4xHH . 2.H4HHÀ. . 2.H4HHÀ. . 2.H4HHÀ.&X>.H4xHH . 2.H4HHÀ. . 2.H4 HHÀ. . 2.H4 HHÀ.&X`&|"gְ|#g|$g|%gNCRnRn0.H4f@09pgF&nBn`. &<&X &<&X &<&XRn0.H4fBnBBBHn?<BgNP`DBn,<B&y y\<(TF` 0fRTRG0Fe ./ </Nj -@ yd/(/.NSP0<L8N^NuNVH N~38?<NT>0gHyNX`.?<?<?<NT\HyBgN\BgNTByHydBgBgNPHn?<BgNP?< NTT*(<BG3r` f0<8GH/ </Nj  yd00 |2<8GH/"</Nj" yd1 0<GH/ </Nj  n00 |2<GH/"</Nj" n1 `T GoN??<NTX*@JfHy?<N\??<N\BgNT/<P?<HN\#|f0?<?<?<NT\Hyv?<N\BgNT/<P?<HN\#f0?<?<?<NT\Hy?<N\BgNT/<P?<HN\#2f0?<?<?<NT\Hy?<N\BgNT/<P?<HN\#f0?<?<?<NT\Hy$?<N\BgNT/0|A:BgA T/?<GNP><`RGA0pfHy0AHЈ/NPHyHyNPHydBgBgNPHnHnHnHn/9dNO?.?.?.?.BgBgBgBgBgNBOBgBgBgBg?< Bg/9dNOBy8N\380<L0N^NuNVH*<`$ n  R / < /N X* .m`R.././N.X0<0G n  /0H/Nj  / < /N X*R Jn n B0<LN^NuNVHHnHnHnHn/9dNO?.?.?.?.BgBgBgBg?<NBOHn?<BgNPBG`HnHnHnHn/.NO?.?.?.?.BgBgBgBgBgNBO n/(/9 NSP/0`?.?.?.?.BgBgBgBg?<NBONq.`?.?.?.?.BgBgBgBg?<NBONm`?.?.?.?.BgBgBgBg?<NBONf6>0g><`~HnHyHyNO g 0.gNXp`RHnHyHyNO g 0.gN\`&`$|gΰ|g|g|g$|gL nBh nBh nBh G'g Gf Gg><"`RG0H/ </Nj  n00 |g0H/ </Nj  n00|g3J n3p n3j n3B`B?<N\BgN@T?<N@TB?<N\ nBh?.?.?.?.BgBgBgBg?<NBOHnHnHnHn/9dNO?.?.?.?.BgBgBgBgBgNBOBgBgBgBg?< Bg/9dNO0<LN^NuNVNZ|-@ .ѹNe"Bg/9?<NX0<` ./9/.?.?<@NO fHy?<N\?.?<>NX9H|AyHfBg/9?9HNJPBn`Rn0.A00f0.S@AB0.S@ABp0.S@AHp 0.S@A?0BgN< P9H|Ayf?</9\?9NJPBn`Rn0.AL00f0.S@ALB0.S@ALBp0.S@ALHp 0.S@AL?0?<N< P0<N^NuNVH *yHn?<BgNP n0( n0(@ n0(B@BF`RF0<"FH/ </Nj  n00 |f Fm0@ n0(@Hn?<BgNP n0(j@ n0(*@ n0(@ n0(@ n-h4 n(P`RRfBR n-h| n(P`RRfBR n-h n(P`RRfBR yHgV09HR<<`2BG\R` 2AA "0HЁ @RRG G mRF0A00f`RBR ygV09R<<`2BG\R` 2ALA "0HЁ @RRG G mRF0AL00f`RBR HL0N^NuNVH&y9f0<`Ne"=@ 96.HЃ*@Bg/9?<=NP=@J@l0098g"Hy?<N\?.?<>NX0<`x/ /9 ?.?<?NO -@f(HyD?<N\?.?<>NX0<`0?.?<>NX Ю#/ N]X#0<L8N^NuNVH*nHn?<BgNP n|1@H6<@ n1@- n|1@-H6<@ n1@-H3j- n|1@B-H6<@ n1@Z-H3`Bn`(0<"nH/ </Nj  nBp Rn nm0<"-HCH/ </Nj  n1 0<"-HC3J- n|1@-H3pHn?<BgNP- n|1@j-H6<@ n1@- n|1@*- n|1@-H6<@ n1@- n|1@-H6<@ n1@ n-h4 n(P`RRfBR n-h| n(P`RRfBR n-h n(P`RRfBRHnBgBgNPBn`*0<8nH/ </Nj  np Rn nm098g^HnHnHnHn/.NO?.?.?.?.BgBgBgBgBgNBOBgBgBgBg?< Bg/.NO g,0<8HCH/ </Nj  n00 |gR`(0<8HCH/ </Nj  np BgN8TBgBgBgBg?<?</.NOBgBgBgBg?<?<!/.NOBgBgBgBg?<?<Q/.NORBng=|`RBn`0.H/ </Nj  y20H| fBn`n=|Bn`RnRn n fRn2.0.H/ </Nj й2 @00.5f n m n fBn`Rn0.f\0.H/ </Nj  y20H| f `Rf`0.H/ </Nj  y2BgN8TBgBgBgBg?<?</.NOBgBgBgBg?<?<!/.NOBgBgBgBg?<?<Q/.NO g=|0.f|R g,0<8HCH/ </Nj  n00 |gR`0<8HCH/ </Nj  np ?<N8TBgBgBgBg?<?<#/.NOBgBgBgBg?<?<4/.NORBng=|`bRBn`0.H/ </Nj  y0H| fBn`n=|Bn`RnRn n fRn2.0.H/ </Nj й @00.5f n m n fBn`Rn0.f\0.H/ </Nj  y0H| f `Rf`|0.H/ </Nj  y?<N8TBgBgBgBg?<?<#/.NOBgBgBgBg?<?<4/.NO g=|0.f098g&?.?.?.?.BgBgBgBg?<NBO0<L8N^NuNV-yBn`0.A0 nRRn0.A0fSSn` nBSSn0.A0H|\fRBn`x0.A0 n nH| fN n.`Rn0.A0H| g0.A0H|.f0.A0fSnRRn0.A0fx nB .N^NuNVHHn?<BgNPHnHnHnHn/.NO?.?.?.?.BgBgBgBgBgNBOBgBgBgBg?< Bg/.NOBg/.N\>?.?.?.?.BgBgBgBg?<NBO Gf&BgN@T?<N@T/.Ng,X>`BG nBh nBh0LN^NuNVH By n-h4BE` n P0PAPRE E eBE`REA0Pf0g`A PRE E e n-h|BEBD`RE n P0Pf Ef n P(H|0 n P(H|0@8 n PH|0 n P(H|0@02AA8 n P(H|8 n P(H|0@02AAA8 n-hBEBn`RE n P0Pf Ef n P(H|0 n P(H|0@=G n PH|0 n P(H|0@0.2AA=@ n P(H|8 n P(H|0@0.2AAA=@ yHg yfHyn?<N\0<`bBF 9X*@ <й\(@BF><` 0fRFTRG0Te#XY B?<N\BG`0/ </Nj  y2B00296Ae>0296|Ad.0<Gy6/ </Nj  ydBp 0/ </Nj  y20H| g n0(jf`"9gBE=|`A0PH|*f Ed:<`:< `A0PH|?fRE`v Ed8A0P2¼/"</Nj"ҹ2 A0PgBn`6A0P2¼/"</Nj"ҹ2 A0PgBnREA0Pg0.f<0.f`<0g|:ʼ/*</Nj* y2:0XH y|0XHE02¼/"</Nj" y220H y|0|A:0Db`0.g~:ʼ/*</Nj* y2:0XH y|0XHE02¼/"</Nj" y220H y|0|A:0ne`8 n0(*|gf:ʼ/*</Nj* y2:0XH y|0X H| n0(|g 0f`` n0(|f0g`BE0/ </Nj  y200 y0 y1|BgN*T:0Fdv0@0/ </Nj  y20296Ae@0296|Ad00<Gy6/ </Nj  yd1 RG0/ </Nj  y2 pfYX 0<L0N^NuNVH A-HA-HHn?<BgNP=|`&0.H/ </Nj  n! Rn n!o n!n n!nHnHnHnHn/.NO?.?.?.?.BgBgBgBgBgNBOBgBgBgBg?< Bg/.NOBB?< NTT-@-|(y=|` .g?.?<NTX*@Jf .`?.?<?-/ Bg?<NTOBE8<`004fRERD0me>μ / </Nj . ܀/./NSP0.U@@H/ </Nj Ю @!nBgBgBgBgBg0<2.UAAA?/.NO0.U@@H/ </Nj Ю @!n>μU / </Nj . Ѯ/./NSP0.U@@\@H/ </Nj  n!$BgBgBgBgBg0<2.UAAA?/.NO0.U@@\@H/ </Nj  n!$ .Rn nm,/./NSP n!nBgBgBgBgBg?<0/.NO n!n/./.NSP n!nBgBgBgBgBg?<1/.NO n!nBg/.N\ nBh?.?.?.?.BgBgBgBg?<NBO0<L0N^NuNVH Hn?<BgNPHnHnHnHn/.NO?.?.?.?.BgBgBgBgBgNBOBgBgBgBg?< Bg/.NOBg/.N\> GfBG`RG0<GH/ </Nj  n00 |g0<GH/ </Nj  n00 |g~?<?<?<NT\Hy?<N\=@ nfJ??<NTX*@Jf.?<?<?<NT\Hy?<N\0<` 9 2- ¼ၰl.?<?<?<NT\Hy:?<N\0<`n(yBF`BRFX02- SAAAe??<0- S@?/9?<?<NTO??<NXNt0yHf(Bg/9?9HNJPHy`BgBgN< P0yf,?</9\?9NJPHylBg?<N< P nBh nBhBG`J0<GH/ </Nj  n00 |2<GH/"</Nj" n1 RG GmHnHnHnHn/.NO?.?.?.?.BgBgBgBg?<NBO0<L0N^NuNVH yHg yf.?<?<?<NT\Hyx?<N\0<`09HyfBF`RF0A 0fBG`RG0AL 0fSFSG0A002ALpf.?<?<?<NT\Hy?<N\0<``#|#|BGBF`h0/ </Nj  y20H|g:0/ </Nj  y2002¼ y1RFRG0/ </Nj  y2 pfp0f.?<?<?<NT\Hy?<N\0<`0 y10R@@ѹ 9 2RAA¼Ҽ(lHy:?<N\BgNT0R@@ N{<0f FfAt#Hy?<&N\?</9\?9NJP09HyfBg/9?9HNJP?<N@TBgBgBgBg?< ?<#/9dNOHn?<BgNPHnHnHnHn/.NO?.?.?.?.BgBgBgBg?<NBOHn?<BgNP n0(|g FfNHnHnHnHn/9dNO?.?.?.?.BgBgBgBg?<NBOHn?< BgNPHnHnHnHn/.NO?.?.?.?.BgBgBgBgBgNBOBgBgBgBg?< Bg/.NO><`&0/ </Nj  ydBp RG GcHn?<BgNPBG` n0(*|g<0/ </Nj  y20g0/ </Nj  y20H| f n0(|gl0/ </Nj  y200H y|0 H|2¼/"</Nj" y220H y| `j0/ </Nj  y200H y|0 H| 2¼/"</Nj" y220H y| 0/ </Nj  y20H|2¼/"</Nj" y2RG0/ </Nj  y2 pf>BgN@T n0(|g n0(*|g BgN$T><B`0 y00fRRG0 y\he / </Nj * yd/(/NSP?.?.?.?.BgBgBgBg?<NBO?9?<NXNt0R@@0R@@ѹ HnHnHnHn/9dNOBgBgBgBg?< Bg/9dNO0<LN^NuNVH -y (yByh`<09h@AB09h@ABp09h@ABpRyh yhmByhBy  o09jg 3`ByBgN*T>09g> 9 2¼/"< /Nj" lBy# #Hn?<BgNPHnHnHnHn/.NO?.?.?.?.BgBgBgBgBgNBO09hH-@ n/(0R@ѹ0R@們 ( l.?<?<?<NT\Hy?<N\0<`&N.< Fg# #0`BFBn8>< yBP``0 yJpfFRn0 yJpf.0 y10 y1`2¼ y200 yp0Af0 yRp`0 y00U@@ y\h 2¼ y10й @0(1@TF0Dc0?<?<?<NT\Hy6?<N\BgNT0 y10 y1RG0 y\2(TAAd 0.De0 y00U@@ y\h 2¼ y10й @0(1@0 yBp0nc.?<?<?<NT\Hyb?<N\0<`Hn?<BgNPHnHnHnHn/.NO?.?.?.?.BgBgBgBg?<NBOBgBgBgBg?< Bg/.NOAl#Hy?<&N\ 9 y2(| ¼l.?<?<?<NT\Hy”?<N\0<`# y0(T@ѹ y0(T@ *y y>(μTGBE`BREX0Ge?<N*T>NH y0(T@ y0(T@ѹ NP:0g*N?<N*T?<N$T?<NT# #By0L0N^NuNVHBD09HyfBF`RF0A 0g40AL 0g"0A002ALpg0A 0fBn`h:.H y:0XH y|0XHE02.H y20H y|0|C:0AL00Ef8Rn0.H y pfBn`>.H y>0xBF`Bn`Rn n l.0.2Hҹ| A02.4HԹ B0g n fBn0H y|0 H|=@0.2H y0 H|@=@0.f>0g,?<?<?<NT\Hy?<N\0<`X?<?NXRF0H y0f Rn0.H y pf/9N?PXNj0<LN^NuNVHBn`Rn0.AL 0fSnBn`Rn0.H y pfBn`Rn0.H y0f2.AL20A0.nAo0.f0?<?<?<NT\Hy?<N\BgNT>.AL>0p`0 y>00 y pe<<``RF0 y00f0 y\hc0?<?<?<NT\HyP?<N\BgNT0 y1>0 y18.AL80@D0.ALTp`$BE`0й @B0PRE E eRD2.AL20A0Ae2.AL20A0.nAn0<LN^NuNVH< `H0H5H|fRD`0>H5xHG02H5|C>0H5H|g 0nf0.g$MB5|B* 5|:?.0.nH/ </Nj  n00U@@l ??</ ?<?<NTO0.nH/ </Nj  n00Hထ0.nH/ </Nj  n00Hѹ 0.nH/ </Nj  nBp0.nH/ </Nj  nB0.nH/ </Nj  nBpSn0.nH/ </Nj  n*p8.nH/(</Nj( n80H0H5 H|2H 0.nH/ </Nj  n00@=@`,0H5 H|g0.nH/ </Nj  n!0.nH/ </Nj  n1RnBF`PBE``0g,?.0U@@l ??</ Bg?<NTO0>30fHy?<N\BgNTRE Ge0f>H5xHG02H5|C>$y <2¼/ /Nj ѹ <2¼/ /Nj  0.nH/ </Nj  n!0@2.nH/"</Nj" n10.nH/ </Nj  n1RF Fe8<0.nH/ </Nj  n*p0@=@`<0H`&<>μ>3x0BsJGf>< GeRD0.f Ge0<LB?<N\ Gf?<?<?<NT\Hy?<N\> GfBG`T0H/ </Nj  y20H|g*Bg0H/ </Nj  y2?0NXRG0H/ </Nj  y2 pf/9|N?PXBgN$TBgNTBg/9?9HNJPBgN@T09Hyf?</9\?9NJP nBh?.?.?.?.BgBgBgBg?<NBO0<L N^NuNVHBnBnBn0.g09fD-y 9/ </N XR#-y 9̐‘ -y-y BnBn`Rn0.A00f`Rn0.AL00fSnSn0.A00@=@BnBn0.A!|0.AL!` 0.f0. y=p0.й|*@H|.g H|fRn` \0.ngfP0.f0?<?<?<NT\Hy.?<N\BgNT nf8.nA80@-y(y>Bn` 0,nX0lS@De0Tn&y` 0+nX0+S@ne8n`N?90U@@ y\h ??</.?<?<NTO0 y80 De09fD0.nA00HX0.nA00HXѮ0.nABp0.nABp0.nAB0.nALBp0.nALBp0.nALBSn0.nA#|0.nAL#0.nA00@=@0.fRn`0.nA=p`-H@=@0.-|C=@=n=n nf0.fBn`Rn0. y0H|g0. y0H|f0.й|-@0.й-@BG` n  n XXRG GeBE0.gv0.`V`R0. y=p0.f0?<?<?<NT\Hyb?<N\BgNTRn ne``(0. y0. y=p ne``8. Dd0?<?<?<NT\HyĖ?<N\BgNT(y>Bn`>0,nX0f0?<?<?<NT\Hy?<N\BgNT0lS@De0Tn&y`>0+nX0f0?<?<?<NT\Hy?<N\BgNT0+S@ne>n0gL 92A¼Ё @0gHyP?<N\BgNT 92A¼Ё @0`60|2.¼ y0H2.¼ y:0 y=p nc0 y1 neL``|g|g|g,- H|g0.fRy0.f0.nA1`0.R@2.nA1Rn ndf0?<?<?<NT\HyŜ?<N\BgNT nf=n`-H@=@0.-|C=@0.nA10.nAL10.g 09fBn`nBn`\0.g:?9H0.U@@ yh ??</.Bg?<NTO0. y=pRn nd0.g09g0.f0.@2.nA1-n .2.RAAA¼l0?<?<?<NT\Hy?<N\BgNT0.@@X@Ѯ0.@@X@09g,0.Xѹ0.X 0.nA!0.nA=p nf<#0.nAL!0.@2.nAL109g0.f`Rn0.@A00g ne nf0?<?<?<NT\Hy?<N\BgNT0.@A!0.@2.AA10.@A1Bn nBRn ne`Bn`Rn0.@A00nf0.@A002.nA10.@A 02.nA! nf`0.@A#0.@A 02.nAL!0.@A002.nAL1=|0.nA#|0.nA00@=@`0.fRyh0.gRn`Rn0. y pf>0.f609f## 0.`0.`0<`` |g|g0<L8N^NuNVH<*y$y> y6(ƼЃT(@`P`Rf m&M`Rg m-M g& U@@ yh 4 .@5@X mBRBj0<L<N^NuNVHBGBG`R0f*y> y<( `*y y\<( `$0FT@:T0:T0fRG Gm0<L N^NuNVH 9/ </N X-@ .R(@ 9 / </N X-@ .U=@BnBFBGBDBE`*L`B?<?<NTXJ@gD?<?<NTX-@ af&HyX?<N\=@ nf0<`0.2¼ y>20EAet0 y>00E=@?9H0 y>00E??./ Bg?<NTO0.n0.n0.TGBE`V?9H0 y>00E??./ Bg?<NTO0.n0.0.@Bn0.g0 y>00f*L`h?<?<NTXJ@gD?<?<NTX-@ af&Hyƚ?<N\=@ nf0<`40.2¼ y20DAbL?90 y00D??./ ?<?<NTO0.@0.nBn`?90 y00D?0 y00D?/ ?<?<NTO0 y00Dn0 y00Dn0 y00DBDTF0.f0 y>00f0<L8N^NuNVH0.f(y*y=yH`(y*y\=y&L0-g(BEX<-`|0@RET0Fe`=|=|Bn`>.3p|<.3`|:.3P|8.3@|0|2.<|>|0@>0G<02.>|0@><|0H<8G02.VnXnTn0.med?.?<?-/ ?<?<NTO?.0<m??-/ ?<?<NTO0<L8N^NuNVH<0.f"A$H&y|*y<9H(y` AL$H&y*y\<9(yBG`RG0H/ </Nj 02f0f0?<?<?<NT\Hy?<N\BgNTSG0f&?0-@R@??-/ ?<?<NTO`d-K:H/*</Nj*:2X`>?0U@@m ??</.?<?<NTO0:4 Ee0<LT0<N^NuNVA# LA# PA# TA# XA # \Ab# `A L#:?< N>T38098N^NuNV33 3 3333333333 3"#$ 3(3*?<N>T n,0 n00 n40 n80 n<0 n@0 09N^NuNV3#  ?<4N>TN^NuNV# ?<6N>T n 0 n0 n0 n009N^NuNV33 3 333333 nf 383:3634?<3N>TN^NuNV n08 n 0: n06 n04N^NuNV# 3 ?<2N>TN^NuNV# #  ?<ZN>T n009N^NuNV33 3 33333?<GN>T n0 n009N^NuNV?<ON>T n0 n 0 n0 n0N^NuNV3#  ?<NN>TN^NuNV# 3 33333?<*N>TN^NuNV# 3 333?<+N>TN^NuNV# 3 ?<,N>T n0 n009N^NuNV33 3?<pN>TBy n b09N^Nu?BB6BKCq0gd2`4TBAf6C`2A0NuA BXyB !J!_ NMYyBA B"P$h/( J@NuA BXyB !J!_ NNYyBA B"P$h/( J@NuA BXyB !J!_ NAYyBA B"P$h/( J@NuNVH?<$Hn/.NO .6.HЃ-@ .3 .3B` Ю @ Ю R 2.Hm .6.HЃ-@B` / </Nj  n00`, / </Nj Ю @ ( Ю!@ `8`6|gа|gʰ|gİ|g|g|g|g|g| g ?/.ND\R 2.Hmb .6.HЃ-@B`p / </Nj Ю @ Ю / </Nj Ю @ (Ю!@ / </Nj Ю @ (Ю!@R 2.Hm .6.HЃ-@B` / <"/Nj  n 0Ю"/"<"/Nj" n! / <"/Nj  n 0Ю"/"<"/Nj" n! / <"/Nj Ю @ (Ю!@R 2.HmT .6.HЃ-@B`> / </Nj  n 0Ю"/"</Nj" n!R 2.Hm0<LN^NuNVH$.f BB`J". BnJlVnDJlRnDvd`Bbd nmDdD-@-A LN^NuNVHBG".l~D$. l GD&gHC H@J@g@HCBCւJGgD-C LN^.JNuNV n"n 2.HbH0|f |f`$ |g `Q`bA`2Q`VA`"Q`J0|f |f`$ |g ` Q`A`3 Q` A`# QN^NuNV 9rA<䀰|l yrXr 0<`0<N^NuNVH`Yr yr PN 9rA.=|\A d"HPgXHf0(LN^NuNVHHy/.NPfBG`Hy/.NPf><`Hy/.NPf><`0. |gR0. |?/.?<=NP>J@m 0. |g&JGm??<>NXBg/.?<`j0. |gD0. |?/.?<=NP>J@m"??<>NXBg/.?<`0. |?/.?<=NP>JGl 30<`?. ?NZX0LN^NuNV/.?<HN\-@ .f-|3 .N^NuNV0./NhXN^NuNV . @"n rJWfSWfN^NuLB@ggSBAgHJ@gHANuL rWfNuNVH*n (MBn ng?.NT| fA&H. nU|`|H| f S @  . nU| A|l0fB AH-@Hn/.?.?<@NO <g 30<`dA&H0f =@`J/ 0./?.?<@NO -@2.¼g .30<` .n0.L8N^NuNV30.| AHЈ-@=|` nR2.AAH1Rn nm/9:NX09N^NuA BXyB !J"/0<NBYyBA B"P$hNu NV# 3 ?<rN>TN^NuNVH$.f BB`&". Bvd d``bd-@-A LN^NuNVHL&gHC H@J@g@HCBCւ-C LN^.JNuNV?.?<LNXN^NuNV?.NTJnn0<`,?.?<>NX=@g30<``0<NqN^Nu Select All De-Select All\*.CN?CHEETAH .CNF   !"3456IKLMNQRS . B X h P  z ,    BytesSizeDateTime[3][ No Path selected | for operation ][ Okay ][2][ Root Directory Full! ][ Oh Well ][3][ Disk is Full! ][ Oh Well ][3][ Disk is Full! ][ Oh Well ][2][ But you haven't selected | any files....][ I Will ][2][ You must select files | from only one path ][ Oops! ][2][You must select a | drive/folder!][ Okay ][1][Error getting BPB][ Oops! ] [3][ Error Tracing Directory! ][ Bye.. ][3][ Directory is greater than 20K!][ Oops! ][3][ Fat is would | overflow Buffer ][ Abort! ][3][ Error Reading HD Fat! ][ Abort! ][3][ Fat is would | overflow Buffer ][ Abort! ][3][ Error Reading Floppy Fat!! ][ Abort ][3][ Cheetah does not | support low res! ][ Okay! ][3][ Error Getting BPB! ][ Abort ][3][ Error allocating Source | FAT Buffer][ Bye! ][3][ Error allocating Destination | FAT Buffer][ Bye! ][3][ Error allocating Source | Directory Buffer][ Bye! ][3][ Error allocating Destination | Directory Buffer][ Bye! ][3][ Error allocating Source | Window Buffer][ Bye! ][3][ Error allocating Destination | Window Buffer][ Bye! ][3][ Error allocating | Main Buffer][ Bye! ][3][ Main Buffer less than 10K!!| Free up some memory! ][ Okay ][2][ Error Opening File!! ][ Oops! ][2][ Error writing to File!! ][ Oops! ][2][ Error Opening File!! ][ Oops! ][2][ Error reading from File!! ][ Oops! ][2][ You must select both a source | and destination path!][ Okay ] [1][ Warning...| This will DESTROY all | data on this drive!][ Abort | Continue ][1][ Error getting BPB ][ Oops! ][1][ Main Buffer too small ][ Oops! ] [2][ How about selecting both | a Source and Destination?? ][ I guess. ][3][ Source and Destination Paths | are the same...][ Abort ][2][ But you haven't selected | any files!!! ][ I will ][3][ Main Buffer is too small || Free up some memory |][ Okay ][3][ Main Buffer is too small || Free up some memory |][ Okay ][3][ Main Buffer is too small || Free up some memory |][ Okay ][3][ Main Buffer is too small | free up some RAM! ][ Okay ][3][ Free Cluster List Full!! ][ Bye Bye ][3][ Not enough room | on this disk!][ Phooey! ][3][ Main Buffer is too small | free up some RAM! ][ Okay ][3][ Can not delete duplicate | from within source!! ][ Abort ][3][ This copy would overflow | the root Directory!][ See Ya! ][3][ Disk overflow | expanding Directory! ][ Boom! ][3][ System Error | Deleting with no directory! ][ Abort ][3][ Error Tracing Folder ][ Bye.. ][1][ Are you sure you want | to delete the originals?? ][ No | Yes ][3][ System Error | EOD with no depth! ][ Bye Bye ][3][ System Error| Error Tracing File ][ Bye Bye ][3][ Software Error| Error Re-Mapping File ][ Sorry ][3][ Failure! | Out of read commands | Re-Mapping File ][ Oops! ][3][ Failure!| Out of write commands | Re-Mapping File][ Oops! ][3][ SOFTWARE FAILURE !| Trying to assign a | non-free Cluster! ][ Abort ][3][ System Overflow!| Folder Depth beyond 100!! ][ Bye! ][3][ Main Buffer is too small! ][ Bye! ][3][ Buffer Overflow!| You have exceeded the 200 | folder per copy limit!][ Okay ][2][ Do you really want | to abort the copy?][ Abort |Continue][2][ Do you really want | to abort the copy?][ Abort |Continue][3][ System Error| No Directory to write! ][ Sorry ] DDDD$DD+0 Q+\Zero Drive Drives AbortZeroAuto Select MenuOnOffSelect FoldersArchive BitSensitiveSelect WhenOnOffOnOffWrite Src DirFile Maskfilenameext________.___FFFFFFFFFFFDate Masks######__/__/__999999######__/__/__999999Newer ThanOlder ThanSelectCancelHard Drive InfoFreeofC################################################################################################################################################################################################################################DEFGHIJKLMNOPTOTAL################OkayCopy CompletePerformance Statistics########Files########Folders########K BytesCopied in########SecAveraging########Mb/MinDelete OriginalsExitSelect DriveSourceSelectSelect DriveDestinationSelectCheetahv2.0 01/01/90(c)1989,1990 by Jay Jones SRC 1.EXT SRC 2.EXT SRC 3.EXT SRC 4.EXT SRC 5.EXT SRC 6.EXT SRC 7.EXT SRC 8.EXT SRC 9.EXT SRC 10.EXT SRC 11.EXT SRC 12.EXT SRC 13.EXT SRC 14.EXT SRC 15.EXT SRC 1.EXT SRC 2.EXT SRC 3.EXT SRC 4.EXT SRC 5.EXT SRC 6.EXT SRC 7.EXT SRC 8.EXT SRC 9.EXT SRC 10.EXT SRC 11.EXT SRC 12.EXT SRC 13.EXT SRC 14.EXT SRC 15.EXT Drives NameCreate FolderCopyExtras Destination Free Select All ExitDelete *** Extras Menu ***System StatusYesNoYesNoShow PerformanceFolder BufferingYesNoReset at ExitDefaultsMain Buffer SizeBytes################BytesMemory FreeLoad ConfigSave ConfigZero DriveFree SpaceAuto SelectFunctionsSort OptionsNameExtSizeTimeInverted Sort Exit Just a secCopying..One Moment...ReconfiguringReady to copy Files Folders K Bytes Go!! AbortCreate FolderFilenameext________.___pppppppppp>> Destination >><< Source <<CancelReady to Delete########Files########FoldersAbortDelete$/ 09 EV ^m no{ |}       %0 1< K[1 \a be ~ :G HO R[ ]j kw z            !/ 0> ?M N\ ]k lz {          # $2 3A BP Q_ `n o}       ! ! -> ?P Xf gp! q  ! ! >L M[    D " ABC DE F G  H I JK LMNO P`: %@  |WZ             $    @  \  x      =%D2  < Xf"!hq  z                % . 7 @  I !R [ #d$f%h&j'l(n )p *r +t ,v -x.z/|0 t12'             A# '4T;@9@ @ @P@   @\)@  @   @x@  !  8 T   p#!             4  P  l              @!@""@ !@7$6)% 0 & L ' h (  )  *  +  ,  - ., /H 0d 1 2 3 4@~655@ 4@#@I8H# 9A:B;C <D=E>F?G @HAIBJCK DLEMFNGO HP7JK  L($M@N@O@PDQ`+ R@ST@UU- T '1|/! #    &*      Q U !!$   @ !!@ @  !    \!x! '"&!! #$% &! '"-)  4      \ jsy  %  `   &/ G7a= $((` *p00)( < CON:AUX:PRT:* &  " (   L:  0 * * * :  6   4  <   &  (   &       &"$4 (  6*  HF6$ 2&* 2H"* 6@j""($"$(*,$&$:$  "&&<@$*""  H((  ,&   *$&.    @* "Z <` 6(4       4&$*.* $  ".$$&      "*$(  $"("*"&  $&$*"*( ($( ""< 4",8, "  ""  $F*.  0D&$ >h @8B(&$$ "  R  .     $ &            `   $ : >&"$@, & & r$ ,$      B8 ( (    (R0 4"$&28LJ.@28LJ,"$( 0$& 0      &4"4">R &    F$$,B2*0 ,$$,($*($  $ ,   .&,&   $       &&$"0 4"""& $       $  6($     ( $ &  $ *  ,", ," , $ 8   $ $($$($>B$>" 8($2v$&  r $"    ,0  F  *& ""(bJ 2 & "  *F " B"4 0 ( 8 " >D D P8 *0< * .( &$ (,:                :((L \8"&J  J "  (l@ (X&>&. . 4$f.,*   ."(~8 && r  Documentation for Cheetah (C) 1989 by Jay Jones This program is being distributed as Shareware. This means that you may give this program out to your friends or post it on Bulletin Boards freely as long as the program and this text file are kept together and remain unchanged. These files may not be distributed commercially without my written consent. All I ask is that if you like this program and use it, please send a donation ($20 Suggested?) to the address listed at the end of this file. The only way that I can continue to develop and support this program is if I receive some compensation for the MONTHS I have devoted to its development. Your registration also insures that you will be informed of any upgrades made available. Enough said. Cheetah is designed as a high speed file copying utility. Hard Drive users will find it the most useful, however it does fully support floppy drives also. Effective transfer rates vary depending on the hardware and the data being copied. Hard drive users can expect to see transfer rates ranging from 6 to 14 Mb/Min, averaging about 9 Mb/Min. Selecting Paths: There are two ways to select your source/destination paths. One is to highlight the drive letter and click in the "Select Path" boxes, the other is to double click the drive letter. When double clicking, first the source then the destination will be selected. After that, you can use normal double clicks to select source or hold down the right button when double clicking to change destination. To go into a folder, either double click it or highlight it and click in the "Select Path" box. Selecting Files: Once both source and destination paths are selected, files can be selected by clicking on them, or by holding down and dragging. "Select all" will toggle all files on/off. Also see "Auto Select" in the "Extras" menu below. Extras Menu: From this menu you can see buffer and mem free sizes, change the file sort order, choose whether or not to display the performance window after the copy, or go to either of the 3 submenus (Auto Select, Free Space or Zero Drive). Auto Select Menu: This routine will go through the source path top to bottom (as displayed) and select as many files as can fit into the destination free space. All previously selected files are ignored. The other items are for setting filtering of which files to select. The "File Mask" and the two date fields are ignored if left blank. Archive bit Sensitivity (In the Auto Select Menu): To enable archive bit sensitivity, highlight the "Archive bit sensitive" box. If this box is selected, the select routine will take into account archive bit status relative to the "Select when" option. If archive bit sensitivity is enabled, the directories in the main menu will display archive bit status by showing a ":" if the bit is on, and a "." if it is off. Any time the archive bit sensitivity is enabled and a copy is performed, the bit status of the copied files is changed in memory (ie: "Select when" set ON, all copied files are set to OFF). If "Write Src Dir" is ON, the modified source directory archive bit status will be saved to disk, otherwise it is changed IN MEMORY ONLY and is lost when source paths are changed or you exit the program. Quick Keys: From the main menu, there are several "Hot Keys" to get the sub-functions quickly. ^A Auto Select Menu ^F Free Space ^Z Zero Drive ^B Toggle Folder Buffering On/Off Aborting: Copies can be aborted by pressing the UNDO key, the program will then prompt you to verify the abort. This can be done during all but the final stage of the copy. Folder Buffering: If folder buffering is enabled the program will try to load all copied folders into the main buffer. If you are having problems with buffer size or errors try turning the buffering off to save memory. DO NOT exceed 200 folders in a copy with buffering on! Note: If you are using a version of TOS less than 1.4 you may notice that the double click is a bit SLOW!! This is due to slow return times from the AES. It may be easier with old TOS to make selections by using the path select boxes at the tops of the file windows. Disclaimer: Every effort has been made to ensure that this program is safe to use and error free.... HOWEVER, I accept no responsibility for any damage or data loss that may occur from the use of this program. *********************** Warning *********************** Cheetah does not use standard calls to its copying/deleting! This can cause problems when you exit the program with GEM not being updated properly as to the changes that have been made. Normally this is only a problem if you are running some sort of caching program, and can usually be resolved by hitting ESC on the affected drives at the desktop. If you are unsure as to whether GEM has been updated properly, play it safe, REBOOT! ********************************************************************** * Changes for ver 1.1 11/15/89 * ********************************************************************** Caching: Routines have been added when exiting Cheetah to force GEM to re-read the disks even when caching programs are resident! These routines have been tested with CACHExxx.PRG, HDACCEL.PRG, and ICD's v4.x.x booter, and all seem to work fine. The ONLY thing that we have found that can still cause a problem is if you have a window open into a folder, then delete that folder from within Cheetah. If you have any problems, please let me know. File Size,Date,Time Display A new item has been added to the main menu. By clicking on the arrows you can shift the display left or right through File Name, Size, Date and Time. This can also be acomplished through pressing the left/right cursor keys. ********************************************************************** * Changes for ver 2.0 12/16/89 * ********************************************************************** Media Change: New routines have been added to force a media change on any drive that is altered. This should help to eliminate the problem of having to reboot to access a newly created folder etc.. Many thanks to Don for his hours of work in developing and testing these routines. They have been heavily tested and seem to work fine, however if for any reason you are having problems getting the OS to recognize any changes that have been made, reboot IMMEDIATELY! Warm Boot: A new item has been added in the Extras Menu that allows you to automatically trigger a warm boot whenever you exit Cheetah. Sort Options: Sort Options have been moved into the Extras Menu. Since there is no longer a seperate menu for these, ^S now brings up the entire Extras Menu. Load/Save Config: Two new buttons in the Extras Menu now allow you to save all of your settings out to a file, or load them back in at any time. All of your on/off settings, Auto Select parameters and Source and Destination paths are saved. At startup the program will automatically try to load the file CHEETAH.CNF from the same path that the program was run, if it is not found, defaults will be used. Refresh: Hitting ESC from the main menu will force a complete refresh of both source and destination paths. Delete Originals: You are now asked for confirmation whenever you select to delete the originals after a copy. Byte Count: Displays the number of bytes selected in source directory. Note, this amount does not take into account any folders that may be selected. RAM Disks: RAM Disk compatibility has been increased. Cheetah should work fine now with most popular RAM Disks. **************************** ATTENTION ******************************* Version 2.xx will be the last major revision offered as shareware. Any future major revisions will be available only to those who have shown their support. Some of the areas under development for future updates are the ability to format floppies and increased options for the autoselect function. ********************************************************************** Donations, Comments, Questions or Suggestions: Please write. Jay Jones 9862 S 262nd Pl Kent, WA 98031 .  FL..  FPAUL CCDF MWORDS DCTF ACONCORD DOCF LCONCORD PRGF >O, o|, P: , Z,(|# r1k ,)d, L ( : ; : i, :,  T:K03 , :R R, :KUP::R", , P: -: 3:Z =Td&,  ._, ԄZR, "+O}. O , Ki, "T҄tZ ( f; , j[;o6:ZZ. : Z, "KZZ Z, :S 4; "O, "fiZZ . [rZ, , ":ZZ, (zL=,) " qZ, a.} :Y,  :; :_,  :.Q, aaO, } ::Z"U;.}r : OZ:m>" $; :_,  :. O[T:: aO, p.[O[T:R , N ;"\O; Y H Z.T 4U/, n `"U,   X ; Q"6UT:", `6, 6 ra, 87; z F,  gL k.:_, 6 F , Y :q,  :,   [,  .h: 4 , : , 1:N Yo,   / z, NO. .^UhZ: KY"O: , r, Ps> ; i "O,  q" ?L^. a6r: , :o , :3Ur ;niR, , , , ;  , [, , , ; ,, , , , , ', :O,T , , T,  ,  : NR, "6oU~, rC, zR". 0\ , Wq, H" :  ,  ; " C.zU >"RO: o. ^, Wq, " ,  C, " :R?B 0  ; r"C:_?z< P hZ[[ R;N :mq:6::N  f , X":zZ"U,  r , z,  [, + {, m_q"', _,  ; z, f,  =, :mq"p, :_,  :: OGi. aSa TA|TA:  aSa A$A; (rAU pd, zA.`, rA, A, ~, lrA, UoAZ:tXA,  } ,    {B>;)`h :., Po,  !A,  ",  ,  #"U , n aA; $"o, oU,%g, o, k    A.\ , r? "&oqr, ?" oqrop, op? "'/, o(?""A, A)?OZ, aO. C ,  ZA: zo*A,  O+.\+ ZA, r+ m ? r+O, A, h, N=   A?|Oro, O> 5; 8O"  , O 2 :z|O o, O>L;   O" , ,   r=; { O r, z. ,mY? B O  ?m: -, "Z7tm. r?  gtT ? W: , = , zmqo; aO, " [,  %`$.zdq, a? O N+? (aoq) W: mh? Y.Z; }$ao? r,, (a/ O,  a 0"a,) =', "p? { Op. m? U z6? G, G_: d1 , "6UR; aO, O, G, r>: O" %, O":<. 6URU, 6Uf  ; O"p, G, r>. DO  K 9; i 6 p ; 23O  :{O 4 :4U 5: ;:D 6U : =6r\:OGd .[" A, :NUA: "m{,  R  d.\6AG x: AO  .z[TAO , n7A 1;O ZR R": OG+:R ,  8;n/32"O:KY : o9, : N "U , ;: N, a, ;^5: "|p,  : $.O 2m? O;. A? ?? : zA.\<"oqOT6A.O| ? O| r? , : O >,   ,  +.mtUA? W: , =A. am" d&, a: , Yh? 7?, |Y] :; zrd. Y? ,  L mZ.[:"O,rA3, z A.z:"r, z $]">?, O m.a @Aq, ZKBT?,, U 6{U,  {U.O q:KrC. x ^Am , B+? a"LA: . LmA? `|L , B+? r , z+. |0 , o|# nw: "|&R", 6rQ; "DZ: & :NUr , zNE"d& , |# n w. , "| , L r: , B: (, A, z.6UA F, OU,   :A[: GAO, O G.\O , " 3; :S >:R (; r:"OA, z:"O ; NO&R,(aO, o&S R,) dK|,  , N,  #3ra 67.N, "| &S R, :"L, Q (. nr , | r~[, `|L4 ), 8GH U:|Ir; g; zL, w:; n ", |# r, |Le:. \LD:.[Lr$, "LD:;z, :KD, ]"hdT;NLd $,  LdJ. \n, =id:KKY^3,  ). rQ, zL: " + ?; ?, M;  M, : r ; O ;dklO6Z.`7T ^,  J5 ?.Noq> : Oopq P: .zQ , ", {7,  . m, n[, TT[. , `7, 7`:, , n`, T". rQ, zd, K[0R. , a>qyY,  ;  QR, "R : (WAL: zOrD`OGA.wST:v, "#r <TU, NOV"L:.zra , QO  Z.  >S, 3,  Z3, O >q, , Y.ZS. raL >" , QO Z: RL >:m, z ZO S $ZJ.>k S>; 6>3 Z$">, .)\a >Re R:m; Q> Ze RZJ".a>kWS7, Q>S.Ay, "  T. z., 3 T:"aYSZ, Q3$Z X"d. am?  , "3 T? W. , "U:,  ?r, "QSa7QY7QY?\U {iVY: "aLhT&, QX".$ f,   :^, "dqO i, "~ , " Fr.|"OOYT.[i, "i: "nT -G; YG . "| , | Z{: z"|, |Z.  9c:uZ, z =Zd. =r\$+Z~, " . 8 +{a [Z: z cZ, a3"U =T,  +{a [Z.r Z: UrA, z3.m? , UrA, z3? W.r, ":K c 9:,  9U:K; Z, BZ?z, "7 9, z3T" kLZ.nm T,  F 9.<p+ : a %+{ 9: 4 :YZY; Q[ +{ 9:Z.`7 9, 7 T.q#m3]U[ ? S3O .z[n T,   9:, +qZ,  S '".MO ; zZO X"d. Pr, , (:"A,) "AY oqaa|?rYIO iA:! IQa|; zI, gO TA! I.Qm, {! I, g :q, gP\: z!I, gO T"A; Q"gOG\, g :q., , U :A~; " :,  :NOT, "qZ.`7 , ], 7A, Xd{:qZ.z[UTA, "n7; "X,  r ^=.am? O A? W. , #r\, zA: #r\s, LA#, r_.z,  `, |Ra. TAL . L =TA{: z`e, b,  . , L  :", h: Z. ,  `, ,   . AO k,  k,  p,  p. Lm"OpZ? W. z, ", "Op; "  ."AO: z}c, a."5r: ؄, "r; z؄, ".m"r, ZA"O p.[mOG", z" ." ("O,  ,) Gp: :Oi; z :"Op7r.p"r: z'r, ".["r, OG", z" .7moA, ", `p, 'Oi.dA<1q:z A{, eA ,  Yf:AO{.Wgq"}! NgT~^?d. Qmi A; zi A. O \[Gm:U, Nr< , z<.A"Y TA .A r, "L  , h  ,  ,  :"A, Nr< , z<.6"U<   ; z6"U<.:iwO ; z:jwO " =.c O Z: Or?:A, 8u.Qm6"U 6. zUr , z, Q" Z. [qr, |O.  Z, ~O ; zO ". z"hT Z, |"hTk+Z ," Z. \, , U, r: , :< . < ,  : zl6~, .aSaU, 6U .r0:; z0m, , , &." 3 id, "U :  , mF; F,  ni; Q"i, "f. 9"o^5U r~:p i[.qN rs . L?:t, r, z NYuC , "TYw ."} 4v wxfW[. r6, zP, y, PzbP, "m, :{, 2d~.UT: z"OOr: oq, |?z" r, m i ? |.|d: ra]: z"}i~6. |"O  , |} -: . "RXfp:", :NUP: .K|, |: : , "|S.K|, |P:  K|P, |:  K|, |.ma:~?  , N ? |"r, zhR, |ri/R?!N: d? O ">."NO |"? O " , ,, "O, NO;v<, N}.#N T?  +, B,, B ,, B, B, B, Bi?$aO, $U R; U =a.%, R~Uz" 7.&} , "8, ", , ,  n, , :,',  #,  , e: T, Od. a , r,  } kl," I. "7T, : :NU; :K m,  ,  ,   wA,  v,  ;{U  8,  Ka e, NOR, . .ra Y . 6U rR, U:8, 6U ( , U6 R : z,  (P."O, 6U  , ~U r : z U m (. ^O , ;^5,  o. r^; z`#>,  d& ; (  nrM, 8lpB', " :, r?, z" #;) LZ!, . aO,  7, zP.am? O i? W.|:v, ]K,  ]K.QmO r", ", z". YZT, ^C h, "t,  "R.\Y|]K|,  K||.amZ, |7 0? NY?z, Wq, N"? a:", k?Yr!, C:t> KZ f,  Z? , s:t [,  :t\, i ][:D: "|t\ 0] ], |# Z,, K|YP, r, z?a|, , 7r;  !, Lr. :D, " LZ, U r; 6P  愥.= ,  @ ah, o T:|X,   8: o8Xt. a=d, L#o (, #$a,  $ZE.am? ", r<, :, O.z, <A, Yr:A. ? 6  r, za7?A. 6;";!aO, , o _ :  H $]r . j,  ' :O, "6T."6o, zr: .6n,  4:=, rZ.O SA:m>" $.v@OA, "q3.zON]^_, arc, NY:? ("O, :TW:)B, N Y? ("O, :hT.)z? O ,  ,  : "O, , ; "gi,  c"YT, T. iq $Z;  iOZ.  Y, H $]r . OG+ 1 : CRO aZR". HT.m6]K6r?  6K6r?  6?To? 6, L6? aO, 1U4"=,  * p!z6rR3. =, , NYd^?Qmx  ,  .za, 6r? C, YR,  @Z .za, r? _v, <Z:"U G,   og Ʉ xZ.z=Oc,  , Lh" r; LZ"r<.z:|, RZo  . am, Ys9? W. },  ( ,  *.Yrs9|. r Y? |}:, ,, 6 1,  c;  },  6".z Z? i: , Nr  :  .Qm;^5Oo :3. 3, mO G?: 3OG3. z ?, mOG3: XOGX.m? Yr"|:; zY,  7_(aO, Y6,  "6r ,  "6r?;) Z^. , = o8,  o,  o,  oZ: =  k"6r ,   [ S. am, 6"6? W: z, O Z, :<:. [  0,   0; ? :Z, a}, \ :j<:U  ,   .9 ,  q, z"T? k, O k:  k k, QU  F.   F ,  , noLn, ,  ik n;"r F. z", rk, zk.am,  F7 , ".;  g67 ,  i. r, z:r F,  |r.\ : ], ; z , ,   : . 6, 6<r  g, : Oe:.nOL,   :Yopn: ~,  F, Yn?r, , "^ , _+; " O:, W. QRT: aO, k,  9T:^O Z, `9.a, 6U + : za 6, 6U  . U T_.a r, [ g:Q~[r, "+6. YR g, "|R.!W # 0 ! U ,   (!"NY\ ? BNY$ ?#BNY_6:,  Z?$,  ,  :, U R: :K . . X Z\, , , "+ ,o , k, Z, O +v. r:^: z+ , "O "p,  ,  , .a, 36Z, :mq"OZ, r:`  z|]:`; z:`, aY :mq%.aS{>~,  R{rC :Q, n S, U>~,  m>{>.lm:3"O6:,  , =  :;B, = | ]d 1: B|", ];B|", ]P: |"<, = i; |", if; |", i. = T. "O'; M:"Op.  >:i;  f>; r >; ; ; ;  +; 1 ; :_ -; 6:.&Z: ,  r.)i"),  i" . C > . r, z: . r_+.:Gq''. 1xR. g, aa}Z, iR., rc, z, Z[: O, +O \; , .\c, ; |, : Q t].r%', z%'ip. =m_?Z n. OGz:  n"U .H\, :  6">: . Uro:p?, z:'. mr'? "Op,   C:|O :p. z"O', '; | 3ri: |O , o: ["'. %?, r[, z$.^U  : 6U , ^c.\:R: :K O J; :K; :K; f:K f.Gq, z:>: |"mYA. ^, rop, rP, r, rI , r_;   , O^, _, a. G:: \O A. ", 5, "[O 5: : [O dz`. O , O;<: =\s?,  =x]&. =, a; r 6, r , r; .zx],  tr , :  . "O >, z r:Q.> $"|R: , NO ,  D.=r""r;  =rrh": Y0.N" k|? :|B . , |h: Oe:t.>q>W: m. =mq  .|",  Z;  |"r, :|r. |", :, |< ;  |"r, :|r,  < .:,  Gq -:., Z;   ,  Z: \, B , U. :^S ,  E,  b, "| . zh? B ; ? RdR . O, a , , m :,  m g:. Qmm>:. =r\h>: zh^,, "GqxoB`: *.,  } , "O 3": z:":, :O .z yi J, [r. riJ, K .=rm+p':9OrJ ; z,  =,  kl.|"~=O :,  .=\<t=,  0>.JrX. RuU ; zO '"qNi .O p8: , :,  @, BO|, BO .k?  :d. gO |"r"|. |"O |, | r: O rO. m"U]: ,  r:P.=m>  p:.r; z, aO, "].7#7d~, " ?  .[ ? # Z:> ::"i>   >@, &d.>>, a0:.[a"Lo   , : Z 8: "@ ; aO, ^Ug:,  Z. |, ), ݅, i. , , R݅;  , R. , =, ok,  |":$; . [ZiR = , " T, kl. } Z, , "U, iR , e:>.w, ,  ZZ f, aZ , 3"O6:," :, 1, "ih, n9kl.\]3:.rP:3Yr |, :tA,  u,  c, ; Q"T,  O4Z, {., Q:, rL,  k M:zaO, :K|Lr, 6 :  6"r .U$:T:Z.z[lG~,,  lo '~S:ZZ;x6Y, :Z: : Z6,  :=]Z, _i+6.z[Z: Z -.YC :to -U;.YC;  6U. $ 9, O: Zc.`\ ^,  :^q, ZY. } >", `ZZ, .[ Z, , $,  , "fi+ f:;"T"r;  "v  -; "ZZi,  iZ.![= iZR. . qZZd , Oo| O;:">!, a -,  "!>gYZ: gY$oS,  . :N"j: ZKr̈́ , zR.  "O.  W, NOyZ.J, N]. , ,   , NU , N7d. . , d,  . . UZ. . "Z , U.  , N. , . ,  b \., , , , ,  Ui.,  , ,   ,  ,  R -Ui.>ik . Z.[ Z, , TU  $ :k;  !.6"Urd, z;  p@ " J#.+OZR. }*\]+$: zZ_Z"Op,  #'. =%+4_. 3d iZ. .;&,  ,  h,  ', , Z.(, N 2^ 7, Z.\,  } , )Z. /)Z,  *o.3d iZR. .[:"O:+Z:,  6, : , L _,z[O,   1, : ', \:R R::_,  . . ,, P: ,  d ,Z O;, :"U9, P: -, iR"md,  X:3 ZZ,  =, Td&,  T .Ԅ (]+$, 3O6Z;"mU-, R,   R ;axL8Z:Q"GZ; "d:NZZS, " d. O }, K7PZd. [ Z, , d, "RC,  " G Z; z"  NfC  CR. Y$ZZ, , U ., "U/Z. [^a, "m>Z, };  ;  ;  . O? L Z? B7Q?"QZ, z ;a"#Q\. QZ0: 1, rτQ.r:v, z:: ri@, n .6nO:"| ; zZUTO.O, _,  :3 .O _? O ? O 2^? Yrg^?<"r,  6:".3o,  Y<:z , Zo,  ZY ;zZUP,  Y, ,  . Oz;  4O$z. +, , "rS_< , rS, rSl, UP:zYg:5_;  Y :5U; 6,  U, Y, ,  Ur, :: "U:"G  .zU, NOZ,  ,  7,  2:", aO, |"8, =.  , , `e:Z, eri9 B, (ZZx.:r:Z, ,   . LiZ4,  ,   .   6L ri:@k, z; :"+r, z."U: r^, ^, ": :zo ,  ,  dZd:^: #6\, 6r . zaO, wYr, ], 8yYq, Y ". zY[ Z: R, , . qoq, qO? QGq, z. [0, r, zO; ""U/6:. , r@k, zkl; <i.zq9r: 6U Z: 8|, 6Uj=.z|"OR, |O$Gq.NY\ , "|>? z .  , , rZZaZ, zaZc,  aZ. Zi?,  riJ: 7re:, 8[Ue.Uc: $O Z,  ;,   , Urc,  a?{>, };  , } ; Urc?NmO,  NO , z K, a:mq? , @; z.Qm8O|"A, 8|"B; z"<.[|"A |"BU>:  mq>,:. Ufi: UC, U . :3O6Z, ao_D, j M,  E . z=mq|EF.  MGqz"Oj, O. [q ^ M, 2, f, G, H, I; mkX:  N, [t;  tJmkXfO.kX<|Y^F, |>o,.kX P, |: z|T; Qat.r"U,  "  Z?q , ; Ok,  U.=Gq J. qZ:_^, = oX, "|_.^O i. O, |_. , _, "6U.\=Gq. RU;ϒ, B, B, B, B", B, B, B:; RU; U;  O . =oqQ, a ,  K .O8K, "oqh }.ziOoc {"$Z, BkR: , hr\.3; }rL: z|"O.\h3d5, W, N:,  tM:  mmq . ~, , oVN: : + ; "r:` W"O, "G>ZOh>.N:PT?  k" <r>? [ <>, , ar0?[U, [U a, SaMT:  :$, "$iZ. `"Y  , a7 :: UoQZ,  :,  :. U $, zU _; U , zU ; U , zU . Z^,  ,  U ,  U ,  GR; , id: n , ; n", : nS, P: UaT,  U URZ^. 0r~:Z, za Z.  ; V,  rS 8: Z. Z, W.^UZZ;, NO,  }, NZY M, aKmm .[ UOh, a Ʉr:Z.z:Z_, ,  , r UOh, z.9O r, z.? ZZioX, B,   Y? O O N"O Z,  aOrQa, "> %. UOh,  r,, "|"Y^u9TZ.C, aZ~, z, $u, a Ʉ7,  "YQ^u,d, `Uf,  , id,:g>ZD , "T.+[O rp. r"o G\}?\ G, "o, aU . d O]:\= Z , ri G, 8i G^ ; zi  _ . 2ZZ7r:6i`: r&i`^, Bi, B, Bia; m  %. z[ZZr: Z6, q"OPoob, B, Bc, Bod, Boe, Bf; i>Gr:. ::h"UT? rh"Ub? z"UT. \x9Tc" . |PZ, lo f, :Ad,  rd -?r" -h?  $Z, U :hg %?r"h? ":^"?m:^",  :hNU .:+. OQ, "Oro_qZ? G, r>"e:h 1?z:Ai,  "d^.[\Oho 0Z, :A>i. r, ? r,c: i?,  ,  6,  "+ . r"r9? r: 8`, a, , j, kil, , , m, n, , 9. 7 Z: zU , zU9, zU,  d. RUZ, zRUrP: RU, zr=. ,   : z . [~O r, z;  ~. Yh,  gh.r"+ ,U{? m{,  t {o? W.? r"|O N:oO>~? , |, > .z|"O NZO>.. m"oqOT~; z|"p~.? r"+~OklO Z, ,  Ur+?U Zio Y: \@+~,  +, U. 5[] 2Z: O poqr:or.w, :! , =mq%,  =mr!I.=I Z% Jq:  %ZI.%Yr!~, zI:  IYr~, z%.6r>, L io5, "c:  ;  f, "Zr+r.z^s,   r."R7a. zmqYZ, ><^,  <".a\:t , Op6<a. z66, =: O :z:. Z ,  r, z, =r%WT! I: z gW, =!t, B`:! I:  =rIx9 %. z:, r: Yo%" $r,  g: i, =rx!9. rYI" $r,  |: i!, =!r^.IO9%,  %O9I: 7+ ; z[U6k.zW, =W. oBo Oru: zYP:=. , W%,  I? B , Wq,  %?zaY:mq, aYPm>, Q=. QvR.OqPnQ? =r w. OP+? =rQ. O3,  +O3, zJ.=mq<C|LP.Pn o|? .r: z | ,  ,.|"OP, n o|, Ow: |"OP, n , O|.U Zio Y; r 9., =mq, |OP, <i.[ G: R, a>"Y: }.\"^Op,, a, "O poqQ:. iZo%? r: .  To%? ro%.z , kr ;  o, gYr . w  : zZ.z^a, , 5O 8: (, "6" Qa 6#; 6" , a 6 r;  6"), a 6r;  6" , a 6r; 6"^, arx:  l^9. zZTy. |"Ot2" *:, |:!z|"O 2"U, | %."O+ 1o% o. tr2, "gk~ : zg"O 2, g! I.# ^+ ; r"so8Z, z"Oz,  "{T|.$zq`"|}~ , gD! ,  Q3, =|, |pr: =.%w|", lG_, zY,  YQ"| Z, .&Qm|"<!  ; z|"<! r  .'%O iAaa!I; z!I, gO;: :Kg; .(zgOgQ<, <R:  `". [a 6nZ/, "R . h, z. q`"|, |3a|]:.zq, CO\.a\3"UnZ/, "oO 3,  "O z>. "UP8, :B, (a8S,  S,)z:Oz >, &, KU R,  ;  >, KU R,  .O rmq" :  ioZ^ aonZo;  n O .zJQr:: 8, , U ; 8, r, U. zj^ o:"U . q k ;J, rO :3Un:/;   |, K ? z`Q,   , . , Jt:x, G {, t:x. }r? }r ? rd? UrX?rZ, }:Z: \U.\ :"O^,r: :?r:4o , o%, aa,  a ,  ?B , r: ?No5;? NAo p,  rq? BN o ,  r? ?a~aoq? BrAC? OAv, rr".  . ? B| &d ? d , G , ^ O: "|";  "|".  'ZZ, O o+c?  9^ Z, U r,? wr p^; zR,  . r"6 4k ?  6 |;[U 9i[?QY "6.z p~: 8~, "QZ: 7  : , z"qt[U. Ʉ, 3:: _Oj; , OZ, r!^, o,: z, o OtZ.O,m? C ", `, tT, "r. Ʉ TR, |ZR, " . Z Fao, " ; :"UA, aA, " "UA;:"UTA, aTA, (nrTA:, zA:,) " "UTA.: Fa , "  : }R:R, "Rj . ^ $, "iZ.r"6 Go GR, z>9? Q G, ". mq"OR. [6 :o ; z.\Q G, ra; Q, ra>":z Z~,   Y: "j, `{:, o. , , r", "Rd 87 ,  R; 7RQZv  ; RCJ; RC: 6 "_":  "_L.ziSƄLr: 677.[~7d, :Ars<', a6.8a, a7 ; aO, : ,  Eh:.8=o, a t,  >  . 8=, a ,  7 G. 8, a  z,  7 . [R~Z:  6Ud, K U. ="||. YGZzaO :q: zO }, NrZ:W"Ue; zito: :, "e:., , Tt.a:_; h؄a.t, Or? I, Or~?n SU>,   >~: UR 9">.< : Ur6 b 9[?am? "oO, B"On:/O?za, ", 6:,  r::  r"i.6t,  t: 6 9 ,   .<:? U$z|?RU, zRUrP: RU, zRr.=Gq, zmqf.Oa, " , ;G $:O ,  ."r Z:o ,  :; O dZ, , ;G $.zqaZZ, ^OnZ/, r$" H,  $: O ,  :, a, rc, z: O$k ?3o, }'" ?\, B, B, R:.  , 8:, :, : :!aR R, r\ , z  S, "6T. W, a} .[ Z, , " R,  Z , a :Z.zZ, "mqO;  rO q;  O .mq OB, l , .zmr"Bi!  j!: "OR>ag7.rr, =!: zoor:B, =!.oqu]r:  , =a|O  : zrOq.qOrr; zrq. 8Lq pr; zrq. ^U]r:]! . w8OqTr, 8rTq, . arO q, QO qr; zR. hc: Oz"orZ j?r"KZ, ", oqF, OoZ?zorF, Oo:!: ! FO6!o.zq:, G, 8.[^" NZZ Z r, "fr , z._R, `f , ?" Z;  . Z, "6UZ.`f\Y>, ^ Or: .m>d  :  >O I,  O .? r: :? B ,  "r? a:Z?  Z^? Z r.0"ZZ, "C |L*: `|#6 , | ,  , , : ^O~, O Z: ^ M.<C| t, `|#, , ^tO : ^, aa,  M.a Aa^,  ^t, t|.H^,  ^ t, ,  ~ .z=oq,  Q=" ,  " t.|" o,  o :, r~.^USU  Z,  S.hP, r$. z`U$, U, "ri.!, , `f:, >." q, =;~; "rfZm.   `. W[, , rZ."7, 89Z~ /, a7.Z: , "Gq #:  " Gqa"O, zkl.[U, zC. U, zC. U, zOCRR.zsO6:mq:  <.:>O6; : C; :C; :C; : ; : ; :; :  ; : : zR~"> , :mqa|. a~O>,  YS{,  R{">~, nS, U>~: QO . >URQY>~,  B,  uB ;  $R:Y>.~Or>, zS.a, }r<, }r~; O\r~? ]a, }rw, }r~; O\r~?}~7 w, 7  ? }7 , 7 ?z[Y {m>~, aY. 67R>, 7 ~?z[U6 S{, z>~. w6aZ<, G: :4, GZ., 3{~, :, U: 3{ ~, `: , ~J f;  d~, .dz, G: zY~f, l6 f:"  :"G~; z" {C .>. >, R{i; B>, R{)i.[U~,  {. Y  , _, 1, , <", m, , ,  .U R? U R1? U R? U R|?R? Ri ? R?z_F:  tZZo . Ʉi  ,  r, } a 3, Bo. ɄZ ,  R ,  R ;  ɄR, Q"  -,  r, }3. ɄJR:,  Ʉ~: P,  r,  3.,   O [; r; r", OrOh,r", :r!, Or, G';.rY, z . ;3R, $R, R, RR.VT: z , 6;  , 6;  , 9.  ,    . z`"OO, m"O 9. `Loj, aoj, `aoj, }aoj: z` Foq, x9. [ o, ; zm:: [ ; zma}\. [, , , ~; z C~O . <,  ', z," .|"N NrZ, zZ: Gq %; |N .z|"NZ: ,  P,  .|"N ; z|" ."Ri , z,"S: O |"z|"Ni , L|, " >.[, , ZZi ,  Z, L:Z, B , B, Bk? T" w, B, L6o, \OB?, N@:? Q , L L @: `, \O? Y. U, , QS,  O T. \r, Z"No,  |"N oZ. Q, =aU, ": . ="N "|. , , z O 2.Om? i,  i : i,  i .`i, |"%a; w ,  | %r ?C , zOr.Ԅ, i zR: #, @i , " K, z ; @ ., r  : ^ , z .AO, i    Z^;  R"6r?, . Uo, r:", z:"r: z= r"r, z.\} fY>,  Ri ,  3"U , B^, 6ra"U4?zR ,  >" $r, B> , |OR, |O$R: U ;  Q] |,  ^"OZo .Om, ? `f, m>ZYo, Yok, Yo , Yo, Y. =RZ.q , = , B; ,  "  ;  =>.zG, = Z  ;  =:,  :.=1B,  =h. [:" , =_=.R >>, "R,  R. 1U?:1.!Or , z=, aR -."=+ Z : OrqZ:; z6Uw :, aA.# 6, =;~: Oo: .$? eTZ? BeZZ?%q`:o, B, ="" 0ZZUJ.&zq, =.', , _: ,  Wr:i .(=R  . u, , NZZ{ZZ, 0,  ;UT,  Z؄{ZZ, .ZZ_R"0, " d: ; "|L {,  "| E : : "|L, m:<", |LW );{; K Z^, z U.<", |L; mR. R|L, a>M J5. }, "}r^:P, " . z3}؄}:  3L Lr; z.z6R: r, z3Li. \7 B6, Q,  Q. [{"| ET, a Z"OG ? zG , mOr: r, mO d6,  +O .,  UhI 3; "|h: K|rh, Q"r.r, mOr: r, +O ; U+.m6UU.^", UR.z[OT,   y" 6. _qe , qe  .aR , QR =.zmq : y; 6"U;.mx S, `|h9:, &; `|xR Rm .| $, |YxR4. "  O .|YxR4. z`|RUx, O "|O, xR. `RZ, m?Z"xR, "RR.6UQ, r;R? U6mQ? m?+d, . <i [;, , r? = ; : .!r: 'p.":,  r;  r : ^ :+.#z q a, Uh?  i~6?$ X, "Or, L :% ", r"~", z @,  , B  @:&z<o~aY,  :m (~.'R O rC : zO > [ ,   [,  ,   .(U  ,,  ,: zO >,   O .)O >,   l,   m: > T .*QO  . O '; O:+O '; O: O '4; O:,O 'o~; Oo~. Oo~,  Oo~.- QO, _qLo _;  L o.."L r_O, z"O;  "O./_qO , :  qO T:.0aO , U 6"U:  aO , U 6"U.1 a ~ ,  .2[^a, , "  69; 8.3, tZo ; rR, zR,4o, w, ; : ,  ,  .5^ x],  ^Z  x].6Q`^x],  ^Zx], m=:D"O, Oh.7W, O ? WE, O ?8O ;   ^O A.9z  :, <d.:\, , , , (X, =a"+Or. a[ -, a6 :>, Q._  C=m>Z, a Y, "G`. `, + j, :+Z. ^", 6i.[ZZ, `DC: DC. "<, ,  ^iZ, "]6.r Z[; z: o{iZ, .z ;W. o OZ,  U Sv. [;,  "|iZT: |X, a. =Gq\: z=, "|Z: wi. a 6d 擨, #:ZZi: zLr;R:;^5; z|`| 5. , , Z, .=R+i. Z, , (0, "Oy,  " 6: -,)"cZ,  :m>"|i,  .}*0  : "L ]+ 6 .6 : \"U.Z.  Z, i "O.RZ. >ik .  i\<.qr, = .3d iZ. iZR. . (, ,  d , Z O;, iR -UR:3 :Z =Td&,  T . , &d, &,  R;NRd +, "e:U , 0PU.ao T, Qd#.  Q, O +# , OCo: B, O +# . dZO , , "aU 9o, Q #.r, , Zd e:, "7 ~%, W ^, "": z#cP, "rP, z: NTQo,  g: K"|g; f , "Z jS 6S]d$. dO^, xd, " _, ri, z3, #d,  .:.  0ZZ, zB;  :S;a , "U+, aU X. ^Lw:ZZd, "o ; :DZYC,  :CZZ,  Z:=] .`\Lw, ? B" ,  : , "i,  ?za O , d ZLr ., , NL{Z,    ;, Lr , zL.RU ,  , Z.[|iZ,  Y , O ;NY,  6qd.o_, ":ZeraZ.r" +, zU+: . (z:^i, "r:Z.tZ v, NO|m"*, zCO v? 2^CZZ, , `e, ITK]:); lZR, "O ZR.  { 2ZZiS %; r" y, z".ZZ.zJ, |Yr y, z : "r ZR.#:oqO ^ , L! S.Q""] ,:,  , o>hi#I. Z"+  . :^S 0, "$Z, AR. :K,  :  @, :K @, +  @  ; ,: Ur%. &, `e:B: ,  oLZ, #G, hr': z ^, TYC.[  Z,  (:(,  / m.UZo /, "UT,  "|::>U /Z;  :/"Z". NO #~?UraS, : za_, za, x.  :qP? B, a , )*:Z, Bj *TZ?Ud7d, \ R:=aU +:7, ri,, zi 愥; r , z . :-:r"U#P:`aP; zd.O ;NYe  ; r=, z: =u, z<".z ,   /f, Lw, Q"  rv;  L:9:r ,w?  m ,  M. "Lw#G^,  "0. "O9L w, "(O w. m", 1 : rav,  xo &, "  rw:S"O2:z7_: W^(C &39 ;  & O9.zZ^, `vO,  &O.w`:,  &9.[O":  O, O .zR, i K 0ao, UYC T:,  a. %\ ^, a0,  r;z45, r, 67; zs 8P:mkx.zd7, O7:"U.:K^Y_r, w, NO , >Z.rP, z;  P+ 9$., Nw:>, Yd, :  .z^9 ], "9,  r.U ]m, r:; U , zr;; ", zr h; s, zr ; ( }4~ [, ""d~. U SZ$, ""dZ . Qm, z"Z. lC, aO, ,  \; ,  \;"|hgh,   iZ.RU + , "3<S=:.U r; z d 2q|, 1q O>.d , Ozo, o   X;{wr;U, z;Ur: UU ?; zUrU X. "d^ p7@, o, ri, X.^z, F : idOT::Q"n rh ."U^ pz, nA: r"B, z , "Ch".[|"Y |O , NY6Zq.\U ($, ", DU;~~, UZT:(, rx:)U$, a,  s,:ZT~,  :i. , ", BZ, .  RdR ; "m>>  ~, :"|Y,  pB ^. \,  L; zUZ;  U+E. qrPZZ, zZ`:]d$, ":  ,  r.  P, O :: BF, O +U.G; h, "> R, m7R: " | R, "6r FZ, zZ ,  E. FGq< : , \< , [ F G.\q , |O o : U9; , RU . RU , NY`:,  Y6:H;:{, "L, Z, rIZ;  YtZH.[mUJ, a Ʉ Z : Z K, `:.|Y: , NG; ". +m, a |fi, Z ">r3.(|, o5,  L: , [O 5; , [O .)wG , "rM:zR NPa ,  ?, S, , O,_, P, Q, , R, 0;S,  , , , kl, T, , , &]v< ], f , '^ p^: aU,   ; a,   \; a [,  , , ; a,  r ; a _,  S; a, S a; al3,   VR. W , dO KZZ, dOW. Ura, zUa+. [oC, (aZ  ,) W.rXYfi^: Yi?  Yi? ZYi[? B Y|" $i\? ]Yi/? U 愥; aY,  ,  ;  ,  6.T,   , ,  r;  >Z, o&ZZ,    , ^. l\~, , =-PTR_  , `.>; aGq, bGq, iGq.r^ :Z: d, "Ud:  iZ.O  Z, O [Z: }i, }cRd +., `7YC, d #G, z7]m; T7 d, b7 e.w, "3"Us, '; r, z#0|LZ, `|+q ', +, + ; Q". ɄZ vio=, r8, Ʉ8:  "C7YZ v, 7 zo ~. [), r"7 v, z"f:_: 7 v<o, ">3. I_:r:: zI. ^, "f<of, y |Z, ,  gc, ,  , ,  , ,  h ', ,  , ,  i! R c:j^ f. , Ʉ 2ZZ,  rU"# , U" , z"d .ZxZZ. \7+: ,  ek', LZR.l:Z, }r ; zaR:Z , Qd2,  d', Oho . 1O Z, D|zZR, i 0.)\"ZR. 6, , Z:{3]C;"om  n.Z 0.: , , ,   67 s;Oio">Z,    1: -. ^6, raX, z_3:,  Z." #', "a|# 8, Q|ZC3.\, a Tm,  ,  ,  ,   Rf,   +:,   " T^3.r, z`p,  :_+. 3d, ", |L a, + | F, "n a. ل q: ^OPZ, N 8d, r:, z: o4. [\ ; "aL om:, Q o ". _os , O :"oqY,   r:"|Yr.   r"r,  A:zs, " [;^5+ot  j, "ot + j: "s:aO, |"# #3;  |"# #G ].z  :, xCq .Y'Z.u|P; zn , |ZZ. i, { O R; r" , zNL:ii^3, Ou:C,    + :v^, "Gqw^Ou:x, rx, zx. id, K1yS, z[y,  Z.; ', |O z {Z: Bd, 6U ,   .t:,  d, $+,  d2]+$. a 6 1: -, O|: 0:Z:p+ , "Z:C, "L o4;  +YcS., d2Z^$; ", a,  : J6Ci,  7Z},  ("ar, )  ^C$2.\}:, "6dZZ,  thd<+~, ]#d, "C , ao f ~,  ra .z^a, | O;  | O.mqa|, Q=; r, B_: mo. O e:tR3 T Z; ", (lR.R,  T:mpX: (aO, |Y; |Y6:: (. [|" (:  +  ,  + ( ',  ]+;) n-m:R, <:. ^vr j -, zOSZ; f^ 6@+Z,  + Z,  ZR;  Z, <Z3Z. ZZ. b[ ZY , N } 6Z, znZ} Z:z Z, "r`}i", 0`: , `a : .  , r< :(dU rc, z:;),  m"" ,  Yfm}:; lom:iRW, `+O.w]< 2? q:"|O, =`^, ", a|O , QU . Ʉ"dm, Y6,  r+D, r : "raZj.  j, a6, U  ; z S O ,   . =>`^, ", aUj`UZ,  u`U. PrtP @, B Pi "q: z6,  <, Ur_. zr"Td %, z:%Y:, o%:ZZ.rPd%, a rZZ: Ua a:Z6 :r2Td %, "O,  ; zl, `+O , "WZ:d.,:~ Z,   r:"k :d<.z|"8, =.r|"QO, zKQ. : io :  ui.}Zi: cZ:>I, "Za o:.z, j, a> , Q+bT"O.|"x, Kr{, B >, r0, B, r, i.фLro c ?.z   , r ; z$ZR.t ", {:Z/?,  M, :Zv. `LiZ,  , L:Gq: "L :eTC :  R TnZZ,  Q  Z. a O, Gq^2~. ? Zr? . z؄, ", "`T '`; "6, 6ha. U I, |, Y. G ; OY.\O G a ; {S:?.a, =Gq`oX; , aoX>, ""o.",  r<, za7, ^2. "S< , .  ,  c U_., oqZY, oq Z, oqZ, oq , oqZ].a , a #$ . O, (,) }.U68? Q} . U6? Q} . U6 ( ? Q} .U6 ? (aoX) } ; , _W%, #, . 0_ >.L mi, {L , ̄, o o؄$;  A,  ,  ,,  \ ,  ,  /,  7,  ,  I; , R A,  , 0 A, u .3"UT, "x,  .R.NO ,  }r ? NO|,  r? %, \. &d, O, "r. /io, W::! ooL=,  ;. =OrP:. : .oqWV, (~, 6s; B~, 6s: ;) > h: :. oq, (~, B~, 6s: ;)"|L hYp,  @, Oroq: L.>: r, z\. Ʉ ':, roX; a : z[ , q`W"|:, B" |Z. W%, L6:o , : , W%.^Ä , "WT. |Z, 3O#:  ^O4. \,, ". \R, , ,  :, O$: `} , m}. } oX[;  : ]:$Z: 3}c ?, Ʉ3.  7 |ZR ?,  ,  c,  6. O7:, L "Lr:Z? ^ .,  5} ::Z;  r:Z: r, zZ:  ]r:hO, zO . c   Z; .Z,   7.zQ, rZ: w, n, Zi.to ZKZZ? #',  i o. 'to Z? rC?   rCE?, `"PZZ? d: z R, , +., , `, r7Za,  " hZZar:  , , , , , , , Q:  , `, Ԅ Z,  " S u,  r 4  6t. ^O  5 }:Z. B 3m 4.Zd,  Z, a7,  5;  nZ[ 0: ,  :R, ", , r:_o$, :Or , zOZ. |L 4, |. U , zi Z.c, ; +3. r+3, "OZ, L?z""Ur.[:"G'; r", z""O, a.3 , z . U*, `U ,  U:  ^,  +. \ 0~nZ, n, :Y6:,  r:D. , , . , p, > , =;   =iZ. >ik . R -Z.3,  ,  kl,  iZR. . ^, , (r, 8q, z,  &, NT;) RUi, Z>:3 :Z =T&,  T d,Nd, "|gT^', : d&::K  . . "UQ T"PZY3Z:Or; z " Z,  .z , BT:, ZZz"{ZZ, =. ad, Qa[, q ZZz"0, =. [ L, B? B:? , r|. zZ, , "L{Or<q. 80q, 8L, z. 5 v, "%" ,  : vWS\ , n e 8.z`, NT T U,  P 3,:, "; ri  :8h::7d; zY,  Z.m<h:: ,  iF.z, .[ 0ZZ, , d, r.meY~ E; LZ7:z6#, "|" [{| . 6ӄ. mV<h:i,  'i . h,  Z", z I:70, j G, B# G, .z8', NLi, no, L :Q: "I7=, Ney:d, "6Y::K, G, r; "  iZ.z~N:, (67, G f:: Gk :) 6N: !3::z", `6"+LtZ, a  L Z;(|" |: , CL :) `, ,  4, N:, 3"L6Z, 6: v; " Z,  6Z . 6 " ; CL :. z`L:@, :, |L:M. d"eT, |i: z`67, | , 7 .  i; "L89i.z`"6 r: , Zd R, , no, <,  ra, :a?NU ,  r,"oqOr?A, z, , ",  r?A: ?AG .z, {:, PUh, O \ ? W.  , to.A}:A, "Z.} i: w; r, z:  "[ , N 7,  .r3:  A, mO. {Wg, NYZ, "r , d{ Y$ , Z?^Z, 0?A, B ?UQg? l 8, U[ ?QS?  .|\":Z,  Z, | ?A, B ?a ,  L =:.\"6U, CU  .  Y, " , {dZ , , R R. Qm6Ui } . aSaU?AU: O, O m>"rRUA:. z"GqOAx, O : , p. AOr: z, q". Y TA, no: O, O m>"]on:" ]; ">., <;  zok,  8, Gq, B .[:   (7. |r, : , aS; za>, : (, O. ^a, " , "L8d, A, L ) 5<, 6, "t .  A, O G: z : .m= A? L!,  (:KL;  L <o.[oOro >, zO>.O Am? W: #$oA6 6", C$A.z YYR, "6:".zde, 7A, hZm[.ALd: Z, ".z<"O, UGo.UR .aSZa$QYx].O8, O8u , O8 K L: UR>.  , mUݏ (,  F:. b[a, "  , aa|Ooj, 3To|, |R;zO LW5 &.Q, `7 , 7:z`5L, , or, A,:"7A, ">m . U , YY+, ?, , &.Go|, zo;  o, m .m, `r, vZUG8. z[, <"\, B,U\, :  ,  ':? ,  ,  ,  . }'Z, Z. , Z, a}; } aU: r;R. p {ZZ;_. L r,  ; z0a,  a.OmA? Z, ", #$ g,  + ,  6:.}\ +, sZ ?6Z, z r; , 6Z, ".zO p: (o p,  r`}iZ. , Ky\WZ, ':iZ[,  :K;  Z.s, " ':A, r?A?O, " # , >o, o.z|NL LM< ; z|L .U: ~U; >T , :, O.^O ,  :[O,  Oi! .zOWO , ObR.O, ),  "r; I , "r:  EYS zgYI.[, , a L, U .zam|"LM< ""LM <, QO [.w Y? s !: r i.Qm, , Ur , z . \0Y ,  ri., aZZ, "Q,  Z3.:mq"OQ, "|Oo :}A.O G ZZ, HZUA; UT3. |.8 , +; z. G; N Z"r ?^x r" #Z. o G\}. Z, "w: z|"ZR, H|. , ,  ,  ,? mO n . 67 Z. , , $PZ;  r`: , z>.RAO>,  ^; a.z >, "r>.^ am, ,  rs . ,   :  ~U >:: Q"6".z, UrA.[? U, U~; p, , 4, ,t, , , j, , [, ;, , ,, , 6, ,  : sZd, aZ 5 , "6r9.zqO, , =, , , , ,Y, Z: OGA. 6"U  i ., =.=rW, >, >. , oqo 0, U, >Y; , .>f ,  QA.oq`: , `|O3, | .z=mqX,  m|,  r.mq.="OZ"Rp.r; Or : oq O, "|.|" O:  ; z|" O:" '. =r :  J ~,  r. a\ , =pZR, rZNUZ.   Io=ZZi\<. aSa ':to t , 6Z:Q; 6 ,n. 86NUQ ZA; z ':ZQ, "6+ .z W", nd, KO Z,  Z.8 , +, zo . aSa:^, = ],  ,  .T F=Gq : ~., 3d i+. . , , : -U;,  : }:3 :Z,  =, Td&,  T .  &d, NYiR :a|Yd M, "k Twd:lZm :, :pR,: 3, |Y.K2,  , : 03;|Y. R ; l\Z , :pR|Y: " |f>R, U:,  U];  : K , n: NR< : ": , N_ . K , <" , +: K<", 7i"k,Oqd W2", Z ., <+,  ZR -,r: Z, Z f;"d, &, ZZ  : + n; "O,   0  -, O :N, : ,| |, `|T,    ;v<,WR ,  ,  ,  ,  m"O, r^, z"O:: YxR 4,  : R : ,O~, " RR. V ZY|, N7 :5  : ^, :, "[ W:KR#d  d ,     ;  7 [, a.z, NO a, 0| 7,`7, Yfi, (3UT;) Y hf,   f :" :|t 03  .3UT;  "rc: O Z: r?, q". U , pZp?, Yd ".  , "n 5  , NUP+"OP  ; ";"57T, nT,  T, lG,  T: z[N7 U .|Od=, NY>,  Y  1;l2 Z,  AJ  ; :t>q, Q =; "|Z>~n, lZ=: e {=:Z7 ,  :"7 .K>Z&.[\UG  , zi -,  Z; U^ M 1, n ;KRf Zk:KUf.  ^U,  Z,3O6::"|\Z ; (a 2G@,, `,    ) Lr\Z , aO[[Zk 1;",  C~,  9:]Lo , :Z36Z .Z, N} zR -, O^36, " 0; :tR  O  , T Y$7, N pR: :A"[Z n \ , : X |d: K Ki.  '" r;LZ, O+.^U Z&d,K}: O,"| Z, : 0, :iQq;" +; ", n  ,e:iR -O ,  ,  #,  ; :,  , "iR.[Z"Oe:.WR"B`, :",Z  R , TS. . E\,  , Z"~0UP,iR Y, i, >; : Z!u=.O >~,  >, aUP>+;>, >, >V,> &R, NO WR,  R,  ZR.zZm>O63:%Z.|, `|h], |f.,  Z. (["|, Oz"|`_Y",? |"`OC"h WR, "|R.) | , ;  , 1;  , #;  , $ ; ` -, X, ~: R!,   , Zoq, Z%:" F G , : %,  84imk, &,   ', 6 |: J;z , hYR, O,  :TK}~ Nf ("m), : %m , ~Z".^a\,  , " Fra, t ,l k, n*T" "O, :Nn +6Z , :XR 4i,.zrQ;Q",  $, a O:"xq, O: ; >+ ; "x]q, <O p .9, mq i: U{>.S,  r: =r+[:8:.=" JG: z,=, i Op, "|::".=G +, z"Op:, " 3Z. -rk, UZ2.=R,  [,  x,  .,  ', x9TZ, iR^:  [>:, /, 0>, a$YZ. \W, a ; , aY 7,  Y6i o:o1/.z,  R 4, B , =r{Z, a -;8_, g , 2, Ur : z, w .^, "G3,  , q, NOc, Y 9 .=Gq JZi@: ~x[ W.r\ 9i.7, z[U : a : (qO R  ;) OZ. Gi 2?, z,w. Oo:3U. zR"UQU: tO.|, " ,  T,  . m"4, ra , za_,55, U'.r, z O. ri, O -; zi;:c 6 7, 8 9+:;w (RZ &d;:c>:.Q, cZ+, aZ.IO%, aO :  |O ~.\a O?Z, Q=  Q :m., + Q, a 7 ,  ;"| -i w,"|:ow , rl;, B<, B; z"k T=.Q]: Qa ,. |"m%m.GqP ; z> ?, a :U{~,  ,   3.^Uoq^& b,   NZ%,  6> . ^Oo : z  .!w=m>ZQ%a;  %  "g ! I.  , +O: ^Ov.f& b; O_i;"i,   |]. ,  8, <r+ :[: zh@ .9, A:"U+ : , i , +, aZ;riA, aB; za 9, T;ip v, a:,  r::"pq, C|>, | uB . , , CZ, C: "+O:; 8Oi. , , ,  . x]}&, "e:D. Er  , z,  n,  ^,  . ZZ}&, "e:',  lR, :.\, l+I4i ,  l]F; +4 i ;=;WR,  G, 0e:RHI . J,  i, O:O (iR  ,  .KiRL R -; , "6Z, " K , :t\ ,}M: "  , a]:.z"N,   , , o } , t\:ZR:KZZC , "dN,  " |+.= :,  i, T& .3 iR"d_. . OV ;,  9, :R -U;, iP Q:3 ZZ,  =, Td&,  T .Ԅm MZ,(m \ZRi,+T_W[;n$^c, "|Y 8opXZ W:aO^:`^ZR, Z; a,   R, RU 93.O,  <ZR. ^, "+ T    RR; ""U ; "S T ; ni], U, Z . z , , " Z,ZT; Q"UR ,  R; S, U$, U:T. u  ;;  p:>9, rV, 5: ::z, "} .m? ), m,  , B , O{;  ), ,  )."^:+ ,  t,:qN  , "3 , z" iR, a (, Q [&~,  ", B.::O ,  : O .z , ^O q: ؄Wr.}o?X, lo ':W,  :i; O  :w:< O Z. l^, "< iZR+T ;"+:Z.=+a: "τ  Z, BZ, ?+N, ">, i> Yf; 3 +v: O: ~, z:Z,  ".ZZO6$, r:], z:$;lCZ,  [?: . 5 \#, , ,  ,, ", lC, n >, > .= 3 ;B[; z =q\ z.wrmq], zmq].=^ Z, L:N, n , }r]: }i:zG0,   o|,  L: nh laoq, |^,  FAZ, n. Y ,  6oOWm: ";m ,  :,   ,   ; " m g"O , :&. , , a (3, ra , z[9, X+i . OZ: : pR.RT_ `:" H,  , T , FoH , K>aX;"; "), "r G, 8.,  n v+, ,  )iZR.CU,  )i.z:;_ZZ, "p, `+ .Gq, Na .+ .R, rU.z$, ", aoi&, |Y/i.\: , Q a i.z"_. y::Zb, ,  c,  d, z+,  |":e.|f<ZR,  L, "#"|#$.u|L Z: z#];  r], z], II.\g, ", ` , ),  " _.>\iR ;  0:X|L Z, rh", :t+ ]v . , , ). : 0C:Z, :uO r , zZO .H0, H'|, Hi.U , ,  ),  G .Ʉ . q"|Y]| , :Q , ,  *, l8; a 6A, o.;, j ; 6OA, .z7 :, 3 m.,  Rz 9 Ԅ: KR,  z o, "k, h, rl\, OA, z"O, O: ",   ,  o, nlZ; jZ . ra Ʉ#u, 7u: z<, ""}. , r:: z^ >, m3U,  nZ3Ud, i  T.=\, aSa, w:  w, ^ZZ.w, ou, =C, = C., Wf,  TQap.(S, KZ A,  [sZ, "6U n:{SO D, {O ,  { O , N .)dO:; Tw, :NKd~, "qZw~, : |Oe:rRZ. \, ,  f,  , Q,  . s,  t, "6C . P, u, 3i, iv,  i w, {U ".) S:   a, ).=+x\ZR. O ;<.3; zm  i<=+y\Z. =, R ,  Z+ ., , U , U , U p, U , U z, U p^;   ,    , `]~. 3, ,  0,  ,  , :  =iZ. z , "[; + .Y{; 7, z . r" j: ,  }, | : . : ,  : T: m R} a: : I, : T :. R}.), "i .[ݘO, " , `TC, G ia w q, z.`{ Z_.r 'oZ: z 'q" T:+.zR,  T: }, l0b7 TZ, To ~, o, :.zԄtR+: 0.[Z d&  . .m. UiZ.R -Z, -6"UZ.3d iZR. . , ,  ;d ,: - }U;: 3 ZZ,  =, Td& . : &d, O (Z,_+,   :R -,OjhZ:, ]d ;OZZ, aO R;  oq, a Z, _,  3 :ad F, NOZo } ;NZ+. ^U, _, r:Z,  : '"i R  ; "~ZR, nmpX,   ; iR, :w, ZR ? i; w Z&, Y^: 9  -: NYT,  Y Y9:K2,   :NO , m :7R p, "U:,  "U,  , 6 j, B, B, B n: R7 p,  : |OdR,  R. |O~,  : NO , T; "R |.& "R ; , l=n, :RZ; , a, 6 , B:. Z, "7* +  ?, [Y|`~ , :Zk  x:  ,   r9T, ,   L{:m O:; ]}o ;N[)oZ,  h"OS $, O :]}o , :O6:Z, :;  Y$7T  TS, z[O: -::Kt\O  0^ ; OZ, :K, mq,  mqR; "mq:, Y: , . "ZZ,   ;,   aSar ;", nf,  ZR 0 , : ,  &,  ;KU7R . ^a, qZi:@. ɄZ , }iZ,  0+ ,  +.a\0, Q : ^h,  , a$,  i<.HqZ  , < , <,  r<.  RS. U, OR  : KUQi T, ~  : {iV, Ui , NYT. Z, n+ ++ , Y|fi, lZR; "L, L :,  , :n;  l n, |ot, .=Gq\hZJ, B, B, B l, B:Uo:; z~O .=GqZ+,o , Y3|Yr, Oh , r , TR~ l,  f, i.iT, , a , U?: ,(r; r; r;RU:|i;) <J ?uot,  ,  ~; r f: . mi, 3UW,  ]v<. +]W, r]].U,  +"O7i.`, NO d", , mi.l\+{U; , 4, , 'a,  , Ot:$[x] W: 5, `,.z[xR~; x, [, ^, , +. r>:,  "xqi6; x]q, O> < " p: O8,  +, , , u : zO R,  R. x]\, a d, k , , ,  , Y, ; >,  0>, qo : a @Z, Q . WR~x] , Ou. ==+, :UP>~;  .= ZR;  > 6 7, 8i3+:. Bu,  R, w : &.Q, cZ+, aO., + Q,  r. , + OR: ^OZ.8, <r+ : x, 6.9, R+ : ; riA, aB; z, : ,  , a:,  rZ;">, : .z|" > |Y:  OG.  , Z+ 9"Op }; "o:. ,  Ci<;< O, " KZo, : , }:"t, a]:. "UT, 55.=+  Si3, i-, "]: mq.R  NZZ, NO o,  o }  F:KZZC , "|+ ,  +; i, o } , NO> Z. 6t\ZZRU . )Z,  , 9:, ( 6K0J: |ZZ, >;) , OP, NU . ~U Z9, $oZ. , NO> Z, o|, )Z, (Z f, " R. , "|YoZ,  "U  ., ,  , Z.U,  ,   O. `^7OZ, U" ;  " 7 T. a:, :k0, ". <ޒ. . 3 iZ. . S,  ,  ;, Z O &  : 3 ZZ,  =, Td&,  . : (ZR, Zd f;T+X,  ,  ?d, x d&;, , +.derZZ, z,  kl,  ; a7Z+$.  FW,  , l0 , ikl:Q"7:R"C .TZ rC , zm+:-O ; Q"r:. 6t #ZZ,  *:T/:  䄥; : |T:, K|T,  , T[:. c, , dZZ, "Lr:z<"#d,  7 S , a, ;, 7d:ZZi9.dPL r ,  4, :za7:xi, Q; ra, z, d.8;5 p@, a, o ; O : , 8Z,  , `$, a.z7Z, ao?! :QnWZ, 7s:ZZ, r, zd, 7Z.  , , d y:  , rZZ, {ZZ. U 3,  ,  n PZ": a   m>Z, ao&  , "~, NYPZZ9 . ^UT, , `0, 0 ra , zaO , , Z"., , FWU: +, a6 :N ,  1,  ";  6r,  U :R:R::"6T, :h S: [O:m.z, , nTZo85 , r, D.: +i '.ZZ, , { ; z:.O d, B, B ? U r d;?Ud . ` G, }p:;p; ٓ;, d,  ,  d, :=Z,  :Z+:"Gq~S: c"U K.C, `7iZ, Zd" +; ae:D,  .^U, ` G, :+,  jZ,  d.z[`;eTZZ,  =p + ,  "p M (,  : , a:  Z:\, , 7ZRd  ,+:[, .   :Z, R0+ dd;   O e" +,  "O +? [ d&,  d, dZZ. tZ: T> ,  R, a Z: :S|++d, d&, ;diR -.  &m Z, ,  Z , "a0]: :, Q  T .JZ.^O,  +7, "-T:"m>Z: K7 f;rsa, ar:"Gq  6 f: "O R, aZ .YrPZ 4, zZ.|\", rq, z, NY6Zk. za 6r" 0ZZ: cU:>. u RURC: z Z, , " ; ":,  :+>,  :Xi+, awZ; " "UT,  "  ]3. zrZ:, , U, "Ir, aG."  E, Qi.^aZZ, "U =  ZrU. T:io, i,  i:  _:mU =   hfi o, :^:  Qi.>i~@. Iz   , , G" 0ZZ.c "Qxao {.`6a, = ,; mDx, ayorij;  6r :.z, , Ur, ""Zao {.UR ,   : Ur, .\=r, a ; z=  F.6";  6" U .z=, NU, F, ]F ;  J, . Yr :[, z:d, N , ", B, fi. cf,  >, a.  Z, , :Z,  UZ,  Z; :\c $.   ;=c.[Z, , "U, ,  ,  R. " ''Zq; z"Op, c,  :R.).T.m : ^OZ.r.r.R; "Op.-TR'. c=Zs;   +} _ ~Zd.}O |" #Z, N., .Rik .Z"^7ZRk.3d iZ. . u,  ,  ;, Z d& :3ZZ,  =, Td& .U i: (Z, , aO^, "+ e,  m>ZR q;Q"PZ+ ? R+ : L" V:O o R, " m~9, : O oi: +:" Z; :ZNUi, `[T:i,t +]"r,  "rd: N(i 'DT ,  T; `|: -,  :R" (dxZL) ".  (Z, "dZ~^ ,  RpR ,  Xi: "dZ,  , :3d . [ Z, , d,   d fZ,"r ~ , B, 8, , =aT, a"O;<.=Gq JZj: "r, Lo9_,  "q[, ~;N WR"OP, B"O; Q"|a , "|O.r, ", `LiZ, Z~? ["|[5. YuX: |N[=, W|. m"[, Ki,  i{: , {O< iR   c, iR"|; 60r , "6T. ^U, "6o: "6R Nr , z#R. zU i: S:Z, , YT Z:7  :|PZd, :d.\, , ,  $, , Bd7.[d,  , d&, Y 7,  Y6 '# p3,+,  +Zmp X. , , , "  ,  , aO iZ: "To : R r.zO }, N+Z,  ZZ T'.  6Z, " Z. +Y,  Y".[Z, , d, "cTm",  r< |0.c]:: rPZ;8k ; z |i y , "r:Z: rr, z:tPpZZ:. `7iZ, ^wZ, "rX, 8|. ?"U Z, r;R, zU. ["U d, "iF6X,  . z, , r . qrd^7,  "q,  G6i, "| . ra, z ao.[=Z= (Rj.  iZR. i\<, O m7: Q 0.3d iZR. . c, d,  , O d;Z,  : 3, ,   =, Td& d.a:< ;, `YC, "  "6KGk,8: ,  , ,zO: Q.[SOo,   op,   T:T l*+Z;:A; 86a, ]60.z"AO p, oq; ^, "AOroq, z , ? ,  ,   8  9, , , " il, , , ,  "O :k; :w, Lt:. d, NY, "| m }, Y; NLdo,  o,  : z,   g. 3dLi O.^O o },  ~R, "eY:; K}.^U, "_tR, o: ]:" '.[Z X, , , _,  f  . .^oZ, , :d], " op;,  op;  lx9:KO ; KZ, "6r: . h\, ", _R, , f, ,   w , R;M,   R"Um; "o "R .^O p xd;NR:T,  :Z  .O >,  > 1 , q;No R, : J5.} o,  , ( ,   r;) o .\"m, hk, T[ i. , ", i ; ri F, B, B1, BS ; z () ip?. =r iR. zror:K, : mq, z: . L_, m. Lr, zrnL.)gT , 6   i. ^O o , oq ' o , |opX.o m , I>%, , F, p, 6:, :K;r6:, G, r; z, ro, r;>", l iR;(oqr:, | . ?)ro, n hi |Ym.| op^UT; |Y  8.  Q E, r, r6:, r;  o. =~_1; m= o, nh . Q  Q E, r, F, }R. =Q>%,   . 6" p o:op ,  O.~ 0Z, :Z_:z , " | :, O  愥,  b . TO : L , , , {Z, ], 0hY. [N, " WT, w: ,  ;! 6; l"io#;R:,  v :-T , Y p:0i<  .m O p,  3:j, 0i<:O9 .x M~, op , \h@ pk, k.zb $,  , Z.S  : zOzZR, l""[O,  "O:. ^O o } ~R. \  ,  愥, NOR, m3". ~ K. =Gq \; zv', , , , , , %. , &:, :P, :k.5rZ"O, L6 , i ]'.%~; s:; "(:R.Z,  Zk; :  ^,  "?. r, zP ao&;   a;a 9; a e, iR%.f"Uu.z g B), =_:t*;~,  :+O: "Op d.[g"Oo gu,  E, ,,   f .zg"RO{g. ~, "6.z1r,  m3, |Y ,  Oz\. =ro gY @}, l$%>q, Op?; g=h , g , g -4, g. Q, gmpX. zb: `6 8: U/, 6; l , 6s_. <6: , 04T:;  r, z1 , 6]r.\",  , , `:d:2. Uu*+<.qBr" $, =3,  =r  ; "3"Uu.= " m~4 f, r6N k. Y, rr". , O ~,.>r , zdB 3." dR, ". d,  ,   d, " ~T>d, 35. ]Gq, 8 : Z.Gw, zo6$ c A. U K n, d:R;   6<.p?  U n;  6"U67. =aS 9aU~R f, "  kr. 6" , =r, 6U; z, v, 6U } , 9. ~K .qK,  r:7@,  @d,  :kO:;|O , 3, z84  @, ]x , ;, 9, ':, `,  ; , 5" O: T.zi<O .=3Y^ ,  O  3. l  D=| . z6" aY o8,  Y Sg = , >D ~.  OkR': { <, 6?T,  iS P. z, Wq, ~;  <, , , , ?, Y. p, ] X", P,  kop@dS 3. x, NR,  d , Nd7op;" Z^ T;, A, WBd: |t, NO  ͙C, M,   ;NY, GqDZ; KGqY,  : :K f  '. ."U a^, "6r,  0, z 愥, N<R:E;"6p, "6 ap?, :, s:;hop M5:, "6] X".W, Z"Ot:, v  E,  FG(QP: ?. 3 i. . H>, , :"O,:,  : 3, ,   =, T& d., KT Ii, "T҄ M f ; : , nJ %, "i;`: MT"O, ._KL,  bM;  } ".x M"hZ, O].Yr6; z,  ,  o .r\ xd,  : zS:; NYT,  P ik, r:d?, z:  3, L6d, zO[Bd, NY2,  Y=" :: } o,  ,  o. U~: w}r : K,  } "|Oe: Z"tZ".  @, k,  O."pLtZ Zkl .^ , "R6U*9T; KUN O.ZP; |,  Lr :z, `|L, | c,  h. Z"|7":  S|Z;,  c. \, , 3"O. "kS 3, Co: }, Ne:K.\ V P, aop.Gq"QRiN^ "; "|NY:o. oqS,  O|rT, L|.s" _].؄a;   R." ( LT::  , a'U,  Z; zOr i. \ VR a , "6Oi X. O o }: i, i: , $i: h, |h: r,  | }: |6h.~x  M, O d"6r4@:G , z :3.:tZ, o9"r: ,  .zV  E: 6Z. aoW: KO X;N ?, " O u;  5 .w M >, l^, "U. , =m>"YWTY.zoUr ] 2, zG ;  : f,  :.oq\T~, |o KZ f, 9,  ^Z,   ZmpX.[ : z, , , =, i"]o.zg  !, "6\. | r; zZR, :K, ,Y]3"^; O_:_ ; " 6 8, NU.;. ^, " ` .a3, , , , , :O, , ,T, b, I, c, , 3"Up,d, e, , aza;lo , zf: T9.^fU6gY,  .hi, 9i ,~,  Ve::  .[ai jv, Q~ : , . z6 G : ZR, aL. zk\k, ", , , , , ?, :, S, eZ;@, ; , ;;  :: z R. ,  R" ,. z' k U , l,  n.z k k$m, Kk; "Tojk\k , Ue:t_ZO.R YO 6n,  O zk, o, p, q:"q,  ZRp?. b \d,  , Nh ;B 9;; 1 ~,  ~; w, , iR k.5`6r Vk; z< 6:, lr; 69 T ,  *Z.z R, VS, X , t$.}[ :n,  5sO;<.op,  b , :FOjho , , h, ;":  r:, zZR"B. f:_Z: Y h, l 7^,  OZ`; t:>, 'Zu. ͍Oi. T,  i: |Oz:. :. ";Biv, `, i,  , z rw.x': ,:?:K; |Y d@.;_ Gqi, zR :  "rj:.)i,  ; "6\,  " R?:  Ly. gTm'X,   Z9: :K  . .z ,  ZP. ;: z;{.f:d ^. |},  ~,  ,  ,  R. i. 3 iZ. . ', o|,  , : d,  _ O<; X", , "6, rd;zY J 6, OtZ:d;:', \ < : 3, ,   =, T& d.^U, "  "U,  v m/, a# :, I>%, l } r B.o , a x; r, r S, r6:, G, r6:;zo, op, F, p, k, ;  }a|Y$, "|ek: :. US  U, m6 : { {, N}, 6]r, $. >,  o, , U S, ' [, . ^ O .  , "6;r w:,  J, "T .ZRU : zZ"U  O 3; z  O .6U"6Ą; z?6h, n,  ,  ZmpX. z k:"F, E, , , ,  ?. , "6 a, rI, r6:, p;"6K:F, :, : ,: , , E;~, p, A:, "r. :Fw.Rop?: k , , _, , "6; "|"O  , lG':aZ.  9:AZ,   : R; r; r, zRp; "6kdR. 3"oY:R, ", f  , , ,  , ^; ",  wB섥 d;N, "|TRY,  RZo, p?.~,  ,  iRm. =Gq. x :?: n, :D, : :mpX,:'Gq, :G, z , RYZR.P7g, , ,   , ^ , ,   >.z<" d q,r?, z:|T,   i,  kl;| ;].d;"n3, F: X".^O o },  ~"0, "6:p?. ~Up zZ. z!g ,  ,  /,  4A; 6U  . oq"O<_  ; "|"OO,  p, n. `Z, B, y:Z:: :: ^.   ]6, "3Z. = X:p?, "6r 2.R"Ui. ". 3 iZR. . S, o ,  d , Zd,  , :d ,  dd,  : :3:Z,  =, Td& .Ԅ,  ( f, , k ,  R -;" _mpOZ. #,  -U, ., Ʉ:"O , $, , n>a,  [o . , K: 5 L: , z[z: :: K: \>, "O, \: Ki, "K|Z:zT 3; "ra7_, z.|\o ~, ">;r[ao|, zWo|, o, m:, zZ,  ,  ?\oz, >a.|Ya, B ], x"]\; i\<, : ra: EZc1., , =: .l 2Z, "za.z <@o: "+ f6ZZ., ;, , , , w.3d i+. . (KJV)matthewthebookofgenerationjesuschristsondavidabrahambegatisaacandjacobjudashisbrethrenphareszarathamaresromaramaminadabnaassonsalmonboozrachabobedruthjessekingsolomonherthathadbeenwifeuriasroboamabiaasajosaphatjoramoziasjoathamachazezekiasmanassesamonjosiasjechoniasabouttimetheywerecarriedawaytobabylonafterbroughtsalathielzorobabelabiudeliakimazorsadocachimeliudeleazarmatthanjosephhusbandmarywhomwasbornwhoiscalledsoallgenerationsfromarefourteenuntilcarryingintountonowbirthonthiswisewhenasmotherespousedbeforecametogethershefoundwithchildholyghostthenbeingajustmannotwillingmakepublicexamplemindedputprivilybutwhilehethoughtthesethingsbeholdangellordappearedhimindreamsayingthoufeartaketheethyforwhichconceivedshallbringforthshaltcallnamesavepeopletheirsinsdoneitmightbefulfilledspokenbyprophetvirginemmanuelinterpretedgodusraisedsleepdidbiddentookknewtillfirstbornbethlehemjudaeadaysherodtheremeneastjerusalemwherejewswehaveseenstarcomeworshipheardtroubledgatheredchiefpriestsscribesdemandedthemshouldsaidthuswrittenlandjudaartleastamongprincesoutgovernorrulemyisraelinquireddiligentlywhatsentgosearchyoungyemewordagainimayalsodepartedlosawwentstoodoverrejoicedexceedinggreatjoyhousefelldownworshippedopenedtreasurespresentedgiftsgoldfrankincensemyrrhwarnedreturnowncountryanotherwayappearetharisefleeegyptwillseekdestroyarosenightdeathmockedwrothslewchildrencoaststhereoftwoyearsoldunderaccordingjeremyramavoicelamentationweepingmourningrachelwouldcomfortedbecausedeadansoughtchild'slifearchelausreignroomfatherafraidthithernotwithstandingturnedasidepartsgalileedweltcitynazarethprophetsnazarenethosejohnbaptistpreachingwildernessrepentkingdomheavenathandesaiasonecryingpreparepathsstraightsameraimentcamel'shairleatherngirdleloinsmeatlocustswildhoneyregionroundjordanbaptizedconfessingmanyphariseessadduceesbaptismovipershathyouwraththereforefruitsmeetrepentancethinksaywithinyourselvesourablestonesraiseupaxlaidroottreeseverytreebringethgoodfruithewncastfireindeedbaptizewatercomethmightierthanwhoseshoesamworthybearfanthoroughlypurgefloorgatherwheatgarnerburnchaffunquenchableforbadneedcomestansweringsufferbecomethfulfilrighteousnesssufferedstraightwayheavensspiritdescendinglikedovelightinguponbelovedwellpleasedledtempteddevilfastedfortynightsafterwardhungeredtempterifcommandmadebreadansweredlivealoneproceedethmouthtakethsettethpinnacletemplesaiththyselfgiveangelschargeconcerninghandslestanydashfootagainststonetempthighmountainshowethkingdomsworldglorywiltfallgethencesatanonlyserveleavethministeredprisonleavingcapernaumseacoastborderszabulonnephthalimbeyondgentilessatdarknesslightshadowsprungbeganpreachwalkingsimonpeterandrewbrothercastingnetfishersfollowleftnetsfollowedgoingthenceotherjameszebedeeshipmendingimmediatelyteachingsynagoguesgospelhealingmannersicknessdiseasefamethroughoutsyriasicktakendiversdiseasestormentspossesseddevilslunaticpalsyhealedmultitudesdecapolisseeingsetdisciplestaughtblessedpoortheirsmournmeekinheritearthdohungerthirstfilledmercifulobtainmercypureheartseepeacemakerspersecutedrighteousness'sakerevilepersecuteevilfalselyrejoicegladyourrewardsaltlostsavourwherewithsaltedthenceforthnothingtroddenhillcannothidneithercandlebushelcandlestickgivethletshineworksglorifylaworverilypassjottittlenowhosoeverbreakcommandmentsteachexceptexceedcaseenterkilldangerjudgmentangrywithoutcauseracacouncilfoolhellgiftaltarrememberestoughtleavefirstreconciledofferagreethineadversaryquicklywhilesdeliverjudgeofficermeanshastpaiduttermostfarthingcommitadulterylookethwomanlustcommittedalreadyrighteyeoffendpluckprofitablemembersperishwholebodycutoffwritingdivorcementsavingfornicationcausethmarrydivorcedcommittethforswearperformoathssweargod'sthronenorfootstoolheadcanstwhiteblackcommunicationyeanaywhatsoevermoretoothresistsmitecheekturnsuecoatcloakcompelmiletwainaskethborrowloveneighbourhateenemyenemiesblesscursepraydespitefullyusemakethsunrisesendethrainunjustevenpublicanssaluteothersperfectheedalmsotherwisedoestsoundtrumpethypocritesstreetsknowdoethsecretseethhimselfopenlyprayeststandingcornersclosetshutdoorvainrepetitionsheathenmuchspeakingknowethaskhalloweddaydailyforgivedebtsdebtorsleadtemptationpowereveramentrespassesheavenlymoreoverfastsadcountenancedisfigurefacesappearfastestanointwashfacelaymothrustdothcorruptthievesthroughstealtreasuresinglefullhowcanmasterseitherelseholddespisemammoneatdrinkyetfowlsairsowreapbarnsfeedethbettertakingaddcubitstaturewhyconsiderliliesfieldgrowtoilspinarrayedwhereforeclothegrassmorrowovenlittlefaithwherewithalclothedaddeditselfsufficientjudgedmeasuremetemeasuredbeholdestmotebrother'sconsiderestbeampullhypocriteclearlydogspearlsswinetramplefeetrendgivenfindknockreceivethseekethfindethknockethfishserpentstraitgatewidebroadleadethdestructionthereatnarrowfewbewarefalsesheep'sclothinginwardlyraveningwolvesgrapesthornsfigsthistlesprophesiedwonderfulprofessneverdepartworkiniquityhearethsayingsminelikenbuiltrockdescendedfloodswindsblewbeatfoundedlikenedfoolishsandendedastonisheddoctrinehavingauthoritylepercleantouchedleprosycleansedtellshowpriestmosescommandedtestimonyenteredcenturionbeseechingservantliethhomegrievouslytormentedhealshouldestroofspeaksoldiersgoethmarvelledwestsitoutergnashingteethbelievedselfsamehourpeter'swife'sfeverspiritsinfirmitiesbaresicknessesgavecommandmentsidecertainscribemasterwhithersoevergoestfoxesholesbirdsnestsburytempestinsomuchcoveredwavesasleepawokefearfulrebukedcalmobeygergesenesmetcomingtombsfiercecriedhithertormentherdfeedingbesoughtranviolentlysteepplaceperishedwaterskeptfledwaystoldthingbefallenpassedlyingbedcheerforgiventhemselvesblasphemethknowingthoughtsheartswhethereasierwalkmultitudeglorifiedsuchnamedsittingreceiptcustomsinnerseatethphysicianlearnmeanethsacrificerighteousoftbridechamberlongbridegroomputtethpiecenewclothgarmentfillrentworsewinebottlesrunnethbothpreservedspakerulerdaughterdiseasedissuebloodtwelvebehindhemherselftouchcomfortruler'sminstrelsmakingnoisemaidsleepethlaughedscornhereofabroadblindbelieveeyesstraitlychargedspreaddumbcastethprincecitiesvillagesmovedcompassionfaintedscatteredsheepshepherdharvesttrulyplenteouslabourerssenduncleannamesapostlesphilipbartholomewthomaspublicanalphaeuslebbaeussurnamethaddaeuscanaaniteiscariotbetrayedsamaritansrathercleanselepersfreelyreceivedprovidesilverbrasspursesscripjourneycoatsstavesworkmantowninquireabidepeacereceivehearwordsshakedusttolerablesodomgomorrhamidstserpentsharmlessdovescouncilsscourgegovernorskingsspeakethparentshatedname'sendurethendsavedgonediscipleaboveenoughbeelzebubhouseholdrevealedknownearhousetopssoulsparrowssoldgroundveryhairsnumberedvalueconfessdenyswordvarianceman'sfoeslovethcrossfollowethloselosethprophet'sonescupcoldcommandinglooksightlamedeafpreachedoffendedreedshakenwindsoftwearkings'housesmessengerwomenrisengreatersufferethviolenceviolentforceeliasearswhereuntomarketscallingfellowspipeddancedmournedlamentedeatingdrinkinggluttonouswinebibberfriendwisdomjustifiedupbraidwhereinmostmightyrepentedwoechorazinbethsaidatyresidonagosackclothashesexaltedremainedthankprudentbabesseemeddeliveredwhomsoeverreveallabourheavyladenrestyokelowlysoulseasyburdensabbathcornhungredlawfulreadshowbreadprofaneblamelesscondemnedguiltlesssynagoguewitheredaskedaccusepitliftstretchstretchedrestoredheldwithdrewchosenstrivecrybruisedsmokingflaxquenchvictorytrustamazedfellowdivideddesolationstandjudgesstrongspoilgoodsbindgatherethscatterethsinblasphemyabundanceidleaccountsignadulterousjonasthreewhale'sbellyninevehcondemnherequeensouthwalkethdryplacesseekingnonewhenceemptysweptgarnishedsevenwickeddwelllaststatetalkeddesiringtowardsistershoreparablessowersowedsomeseedsdevouredstonyforthwithdeepnessscorchedchokedhundredfoldsixtyfoldthirtyfoldspeakestmysterieshearingunderstandprophecyperceivepeople'swaxedgrossdullclosedconverteddesiredparableunderstandethcatchethsownseedanondurethtribulationpersecutionarisethcaredeceitfulnessricheschokeunfruitfulbearethsixtythirtyslepttaresbladeservantshouseholdersirdidstreapersbundlesbarngrainmustardgrowngreatestherbslodgebranchesleavenmeasuresmealleavenedopenutterfoundationdeclaresowethburnedfurnacewailinghidethsellethbuyethmerchantgoodlypearlpriceboughtkinddrewvesselsbadseverunderstoodinstructedfinishedcarpenter'sjosessistershonourunbelieftetrarchboundherodias'philip'sfearedcountedherod'sbirthdayherodiaswhereuponpromisedoathbaptist'schargersorryneverthelessoath'sbeheadeddamselburieddesertaparteveningpastbuyvictualsfiveloavesfisheslookingbrakefragmentsbasketseatenthousandbesideconstrainedtossedcontraryfourthwatchbidwalkedboisterousbeginningsinkcaughtdoubtceasedtruthgennesaretknowledgeperfectlytransgresstraditionelderscursethdiemightestprofitedfreeeffectprophesydrawethnighhonourethlipsfardoctrinesdefilethknowestplantplantedrootedleadersditchunderstandingenterethdraughtproceeddefilemurdersadulteriesfornicationstheftswitnessblasphemiesunwashencanaanvexedcriethhelpchildren'scrumbsmasters'tablemaimedjesus'wonderedcontinuefastingfaintthanksbrokenfourmagdalatemptingfairweatherskyredmorningfoulloweringdiscernsignstimesforgottenreasonedperceivedreasonrememberbadecaesareaphilippijeremiaslivingbarjonafleshbuildchurchgatesprevailkeyslooseloosedmustkilledthirdrebukeoffencesavourestgainexchangetastesixtransfiguredtalkingtabernaclesbrightcloudovershadowedsoreliftedvisionrestorelistedlikewisekneelingofttimesfallethcouldcurefaithlessperversecuredremoveyonderimpossiblehowbeitprayerabodetributemoneypayyespreventedthinkeststrangershookbecomehumblewhosomillstonehangedneckdrowneddepthoffencesneedshalteverlastingalwayshundredastrayninetyninemountainsrejoicethtrespassfaultbetweengainedwitnessesestablishedneglecttouchingseventybegunreckonowedtentalentsforasmuchpaymentpatienceforgavedebtfellowservantspencethroatowestfellowservantdesiredstpitytormentorsduemalefemalecleavejoinedasunderhardnesswivesmarrietheunuchsmother'swombheaven'sforbideternalcallestkeepmurderyouthlacksellsorrowfulpossessionsrichhardlycamelneedleexceedinglybeheldpossibleforsakenregenerationthronesjudgingtribeslandsearlyhirevineyardagreedpennymarketplacesixthnintheleventhhiredstewardsupposedmurmuredgoodmanwroughtequalborneheatwrongmockcrucifyzebedee'ssonsworshippinggrantpreparedindignationexercisedominionministerransomjerichostillbethphagemountolivesvillageasstiedcoltsionfoalclothesthereongarmentsstrowedhosannahighestoverthrewtablesmoneychangersseatsdendispleasedhearestsucklingsperfectedpraisebethanylodgedreturnedfigleaveshenceforwardpresentlysoonremovedbelievingsecondharlotshedgeddiggedwinepresstowerhusbandmennearstonedreverenceheirseizeinheritancemiserablyrenderseasonsscripturesbuildersrejectedcornerlord'sdoingmarvellousnationbringinggrindpowdermarriageweddingdinneroxenfatlingsreadyfarmmerchandiseremnantentreatedspitefullyarmiesdestroyedmurderershighwaysfurnishedguestscamestspeechlesscounselentangletalkherodianstrueteachestcarestregardestpersoncaesarwickednessimagesuperscriptioncaesar'sresurrectionmarrieddeceasedseventhdiederrsilencelawyerquestionmindhanganswerdurstquestionsmoses'seatobserveburdensgrievousmen'sshouldersmovefingersphylacteriesenlargeuppermostroomsfeastsgreetingsrabbiexaltabasedenteringdevourwidows'pretencedamnationcompassproselytetwofoldguidesdebtorfoolssanctifiethswearethguiltydwelleththereinsittethtithemintanisecumminomittedweightiermattersundonestraingnatswallowoutsideplatterextortionexcessphariseewhitedsepulchresbeautifuloutwardbonesuncleannessoutwardlyhypocrisygarnishfatherspartakersescapeshedabelzachariasbarachiaskilleststonestoftenhenchickenswingsdesolatehenceforthbuildingsthrownprivatelydeceivewarsrumoursfaminespestilencesearthquakessorrowsafflictednationsbetrayaboundwaxendureabominationdanielreadethhousetopbacksuckflightwintersinceshortenedelect'schristswonderselectchamberslightningshinethwheresoevercarcaseeaglesdarkenedmoonstarspowerscloudsbranchtendersummerdoorsnoefloodmarryinggivingarkgrindingmillthiefwatchedfaithfulseasondelayethbegindrunkenawareappointportionvirginslampsoiltarriedslumberedmidnighttrimmedtravellingseveralabilitytradedreckonethdeliveredsttalenthardreapinggatheringslothfulknewestoughtestexchangersusuryunprofitableseparatedividethgoatsthirstystrangernakedvisitedfedinasmuchcursedathirstpunishmentfeastpassovercrucifiedassembledpalacecaiaphasconsultedsubtletyuproaralabasterboxpreciousointmentpouredpurposewastetroubleburialmemorialcovenantedpiecesopportunityunleavenedappointeddippethdishtestamentremissionvinefather'ssunghymnflockthoughcockcrowthricegethsemanetarryfartherprayedweakswordskisshailkissedstruckpriest'ssmotelegionsforsookafaranswerestadjurehereafterfurtherspitbuffetedpalmswastdeniedsayestporchsurelyspeechbewrayethcrewrememberedweptbitterlypontiuspilatesinnedinnocenttreasurypotter'svaluedaccusedgreatlywontreleaseprisonernotablebarabbasenvypersuadedtumultwashedreleasedscourgedcommonhallbandstrippedscarletrobeplattedcrownbowedkneecyrenecompelledgolgothaskullvinegarmingledgalltastedpartedlotsvestureaccusationreviledwaggingheadsdestroyestbuildestmockingtrustedloudelilamasabachthanicallethspongeyieldedveiltopbottomquakerocksgravesbodiessaintswatchingearthquakebeholdingministeringmagdalenearimathaeabeggedwrappedlinentombrolledsepulchrenextpreparationdeceiveralivesureerrorsealingsettingdawnweeksnowkeepersbecamerunshowedlargestolegovernor'spersuadesecurecommonlyreportedelevendoubtedbaptizingalwaymarkriverskinlatchetstoopunloosedrivethbeaststornquestionedcommandethsimon'srisingsolitarytownscleansingpublishblazematterquarternoisedpressuncoveredreasoningfashionresortedlevidrinkethusedsewethburstspilledmarredfieldsabiatharlookedangergrievedidumaeasmallwaitthrongpressedplaguesordainedsurnamedboanergesthunderfriendssoeverblasphemeforgivenesshearkenspranggrewyieldincreasedmysterygladnessafflictionword'scareslustsmanifestedspringsicklecomparisoncomparelessgrowethshootethexpoundedshipsstormhinderpartpillowawakegadarenesdwellingchainsfetterspluckedtamecuttinglegionbefellmarvelrulersjairuspointthrongedphysiciansspentbetteredfountaindriedfeltplaguevirtueseestthrongingfearingtremblingsynagogue'stroublestwailedadoweeptalithacumiageastonishmentsomethingcarpenterkinfolkstaffpurseshodsandalsanointedquarrelobservedgladlyconvenientsupperlordscaptainsestatesswarehalfhastesakesrejectexecutionercorpseleisuredepartingafootoutwentpennyworthcompaniesgreenrankshundredsfiftiestoilingrowingconsideredmiraclehardenedcarrybedsborderdefiledholdingmarketwashingcupspotsbrazenlayingcorbanpurgingmeatscovetousnessdeceitlasciviousnesspridefoolishnessgreeksyrophenicianimpedimentbeseechtonguesighedephphathastringplaindealpublishedsatisfydalmanuthadeeplyloafanswerethgospel'sprofitashamedsinfulshiningfullerwistsuddenlyquestioningmeanrestorethnoughtrunningsalutedtearethfoamethgnashethpinethtarewallowedfoamingbelievethtearsdisputeddesirearmslightlybelongquenchedwormdiethsaltnessresortwritebillwrotepreceptcreationkneeleddefraudlovedlackestmotherspersecutionshappenwithalaccountedlordshipchiefestnumberbartimaeustimaeushighwaybeggingrosewhereonloosingeventidehungryhaplyvesselrootsremembrancecursedstprayinghedgewinefatwoundedshamefullyhandledbeatingkillingwellbelovedoursscripturecatchdyingbushperceivingstrengthnamelyburntofferingssacrificesdiscreetlysalutationsmarketplacesprayerswidowthrewmiteswanttroublesbeginningsbeatenbeforehandpremeditatecreatedseduceforetoldportercockcrowingsleepingcraftspikenardwhensoeveraforehandburyingconvenientlymayestbearingpitcherguestchamberupperdrankalthoughtwicevehementlyforwardabbasleepestcouldestbetrayethtokensafelywarmedcoverbuffetstrikebeneathmaidswarminggalilaeanagreeththeretoconsultationinsurrectionaloudcontentpraetoriumpurplebowingkneescyrenianalexanderrufustransgressorsrailedahdescendeloisalomehonourablecounsellorwaitedboldlycravedfinesweetspicesrollaffrightedtrembledformresidueupbraidedcreaturedamnedtonguesdeadlyhurtrecoverworkingconfirmingfollowinglukeorderdeclarationeyewitnessesministersexcellenttheophiluscertaintycoursedaughtersaaronelisabethordinancesbarrenstrickenexecutedofficelotincensedisobedientwherebygabrielpresencetidingsperformedbelievestbeckonedministrationaccomplishedmonthsdealtreproachmonthvirgin'shighlyfavouredsalutationfavourconceiveovershadowcousinhandmaidbabeleapedsoundedperformancemagnifysaviourregardedlowestatehandmaidenarmproudimaginationdegreeholpenelisabeth'sneighbourscousinseighthcircumcisekindredpraisedredeemedhornsalvationcovenantholinessdayspringguidedesertsshowingdecreeaugustustaxedtaxingcyreniuslineageswaddlingmangerinnshepherdsabidingkeepingshonehostpraisingponderedglorifyingeightcircumcisingpurificationpresentopenethpairturtledovespigeonssimeondevoutwaitingconsolationlettestlightenpierceannaprophetessphanueltribeaserlivedvirginityfourscoreservedfastingsinstantredemptiongraceyearsupposingcompanyday'skinsfolkacquaintancedoctorsaskinganswerssorrowingbusinesssubjectfifteenthtiberiusituraeatrachonitislysaniasabileneannasvalleycrookedroughsmoothimpartexactwagesexpectationmusedexhortationreprovedevilsbodilyshapehelimatthatmelchijannamattathiasamosnaumeslinaggemaathsemeijoannarhesaneriaddicosamelmodamerjoseeliezerjorimjonanmeleamenanmattathanathantharanachorsaruchragauphalechebersalacainanarphaxadsemlamechmathusalaenochjaredmaleleelenossethadammomentbrokenhearteddeliverancecaptivesrecoveringlibertyacceptablefastenedgraciousproceededjoseph'sproverbacceptedwidowsfaminesareptaeliseusnaamansyrianthrustbrowheadlongpassingrebukingstayedlakefishermenlaunchdeeptoiledenclosedpartnerstilingcouchstrangedrunkdesirethrubbingmadnesscommunedcontinuedchosezelotestraitoryourslaughleapsmitethlendhopehopingunthankfulbosomperceivestbramblestreamruinaudiencecenturion'sdearinstantlymyselfreturningnainbierrumourmessengersgorgeouslyapparelleddelicatelycourtslawyerspharisee'ssinnerwipetouchethsomewhatcreditorfiftyfranklysupposerightlygavestwipedforgivethchuzasusannasubstancelackedmoisturepleasuresperfectionhonestlightedcoverethmanifestseemethlaunchedsailedjeopardyragingarrivedwareoftentimesbandsdrivenstanchedsomebodyfallingdeclaredmaidenbewailedapieceperplexedbelongingslainadvantagedalteredglisteringdeceaseaccomplishclosebruisingdepartethstedfastlyconsumelivesfarewellplowfitwhitherlambsremainlabourercleavethdespisethtreadscorpionsreadestjustifychancelevitesamaritanjourneyedwoundspouringbeastspendestrepaymarthacumberedservingdostcarefulneedfulindebtedimportunityneedetheggscorpionfingerarmedkeepethstrongerovercomearmourspoilsfindingpapssuckedthickninevitesutmostninevedarkdineinwardruereproachestladeallowdeedsslayrequiredkeyhinderedurgeprovokeinnumerabletrodeclosetsproclaimedforewarnfarthingsdeniethmagistratesdividedividerconsistethpossessethplentifullybestoweasemerryprovidedlayethravensstorehousedoubtfulpleasurebagsfailethapproachethcorruptethgirdedlightsburninggirdmenservantsmaidenssunderunbelieversstripeskindledstraiteneddivisionshowerblowmagistratediligencehalemitegalilaeanseighteensiloamdressercumberethdigdunginfirmityeachoxstallwateringbondadversariesgloriousresemblegardenjourneyingonceworkersnorthfoxcuresbrooddropsyfallenmarkedshamelowesthigherexaltethhumblethmakestkinsmenrecompenserecompensedconsentexcuseexcusedprovelaneshedgesintendingcountethcostfinishwarconsultethtwentyambassageconditionsforsakethseasoneddunghillrejoicingrepentethpersonssweepyoungerwastedriotouscitizenfeedfainhuskssparebestringfattedcalfeldermusicdancingmeantsafetransgressedkidstewardshiplongerbegresolvedcommendedwiselywiserunrighteousnessfailhabitationsunrighteouscovetousderidedesteemedpressethfaredsumptuouslybeggarlazarussoreslickedabraham'sdiptipcoolflamelifetimereceivedstgulffixedwouldesttestifyincreasesycamineplowingcattlesuptrowdutysamariavoicesobservationlightenethbuildedrainedbrimstonestufflot'spreserveavengeregardtroublethcontinualwearyspeedilydespisedextortionersadultererstithespossessbreastinfantsdistributeneedle'smanifoldspittedpassethzacchaeusclimbedsycamorejoyfullyguestfourfoldforsomuchnoblemanpoundsoccupycitizensmessagetradingpoundnapkinausteretakestlayedstreapestbankascendingownersdescenthadsttrenchvisitationattentivespiesfeignacceptestcraftinesschildlessdavid'spsalmsrobespenuryadorneddeceivedcommotionsterrifiedsightsdeliveringprisonssettlemeditategainsaykinsfolkscompassedcountriesthereintovengeancedistressedgecaptiveperplexityroaringfailingshootselvesoverchargedsurfeitingdrunkennessunawaressnareabsencedeterminedstrifebenefactorsservethtemptationssiftstrengthenreckonedwithdrawnstone'sstrengtheningagonyearnestlysweatdropssorrowbetrayestspaceconfidentlyaffirmedblindfoldedblasphemouslyourselvespervertingforbiddingstirrethjewrybelongedjurisdictiondesiroushopedgorgeousenmitypervertethexaminedwhereofchastisenecessityseditionrequiringprevailedsentenceturningwombshillsmalefactorscalvaryofferingletterslatinhebrewcondemnationjustlyamissparadisecommendcertainlybreastsconsenteddeedointmentsrestedthereabouttalesstoopingwonderingemmausthreescorefurlongshappenedholdencommunicationscleopasslowvanishedbreakinghandlebroiledhoneycombbehovedpromiseenduedcontinuallyblessingcomprehendedlightethbegottenpreferredfulnessrecordlevitesconfessedbaptizeststandethshoe'sbethabaralambremainingbaptizethdwellesttenthmessiasjonacephasinterpretationnathanaelisraeliteguilecanawantedwaterpotspurifyingcontainingfirkinsbrimdrawmiraclesjews'changerscordsdrovechangers'zealshowestbuildingrearneedednicodemusteacherblowethlistethearthlyascendedhatethaenonsalimjohn'sbarestbridebridegroom'sdecreasetestifiethsealabidethsycharparceljacob'sweariedjewaskestdealingsspringinghusbandssaidstworshippersseekesttalkestwaterpotreapethhereinbestowedlabouredlabourstestifiederelivethamendyesterdaypoolbethesdaporchesimpotentmovingtroublingsteppedliesteppethconveyedworkethhithertoraisethquickenethjudgethexecuteselfwitnessethaccusethwritingstiberiasladbarleydistributedroweddrawingwillinglyboatwhereintoboatsshippingperishethsealedmannaevermoremurmurlearnedstroveascendprofitethmurmuringdeceivethcircumcisionwhitappearanceofficersdispersedflowriversactstoopedconvictedconscienceeldestaccusersbearestpleasebondagemurdererliarconvincethdishonourspatclayspittleaforetimewhereasworshipperaltogethertalkethremainethsheepfoldclimbethrobberrobberspastureabundantlyhirelingwolffleethcarethfoldmaddedicationsolomon'splainlygodssanctifiedblasphemestescapedlovesttherebylatehoursstumblethintentdidymusfellowdiscipleslaingravefifteensecretlyhastilygroanedcausedgroaningcavestinkethgraveclothesromansexpedientephraimpurifycostlyodourcaredbagpalmass'sgreekstelleththunderedsignifyinghidereportblindedrejectethrisethtowelpourethbasindisciples'another'shappyheeldoubtingleaningsopdippedafterwardsmansionssufficethworks'comfortercomfortlesshusbandmanpurgethkillethservicereprovelamenttravailrememberethanguishproverbsneedestperditionsanctifylovedstbrookcedronlanternstorchesweaponsbackwardservant'smalchussheathcaptaincoalssmitestkinsmanmalefactorfightwearingpavementgabbathatitlesoldierseamwovencleophashyssoplegsspearpiercedbonemixturealoesweightwoundoutrunweepestgardenerrabbonibreathedremitremittedretainretainedprintnailsreachfishinggirtfisher'scubitsdraggingdinedgirdedstwalkedstleanedcontainbooksactsformertreatisepassioninfallibleproofspertainingapparelgazingolivetaccordsupplicationobtainedministrypurchasedbowelsgusheddwellersproperaceldamahabitationbishopriccompaniedbarsabasjustusmatthiasapostleshiptransgressionpentecostfullyrushingclovenutteranceconfoundedlanguageparthiansmedeselamitesmesopotamiacappadociapontusasiaphrygiapamphylialibyaromeproselytescretesarabiansjoelpourvisionsdreamshandmaidensvapoursmokeapproveddeterminateforeknowledgepainsforesawcorruptionpatriarchswornassuredlyprickedexhortuntowardapostles'fellowshipcontinuingsinglenessfasteningexpectingankleleapingwonderamazementgrantedsoundnesswotignoranceblottedrefreshingrestitutionsamuelkindredsiniquitiesboldnessunlearnedignorantconferredthreatenthreatenedpunishrageimaginethreateningsstretchingpossessorspricesdistributionbarnabascyprusananiassapphirapossessionprivyliedjoinmagnifiedbelieverscouchesfolkssectsenatesafetyintendgamalieldoctorreputationtheudasboastingobeyedrefrainoverthrowmultipliedgrecianshebrewsneglectedstephenprochorusnicanortimonparmenasnicolasantiochobedientlibertinescyreniansalexandriansciliciadisputingsubornedblasphemousstirredceasethchangecustomscharranchaldaeanssojournentreatcircumcisedpatriarchsafflictionspharaohdearthchanaansustenancesychemsumemmorsubtlynourishedpharaoh'segyptiansvisitdefendedavengedoppressedegyptiansirsdiddestmadianexpiredsinastandestrefuseddelivererlivelyoraclesofferedidoltabernaclemolochremphanfiguresdravetemplesstiffneckeduncircumcisedbetrayersdispositiongnashedstoppedsaulconsentingregionshavockhalingpalsiesbeforetimesorcerybewitchedsorceriesperhapsbitternessgazaethiopiaeunuchcandaceethiopianschariotunderstandestslaughtershearerhumiliationazotusbreathingdamascusshinedpersecutestkickpricksstreettarsusprayethputtingscalesstrengthenedprovingawaitwallbasketassayedchurchesedifiedquarterslyddaaeneassaronjoppatabithadorcasalmsdeedschamberdelaytannercorneliusitalianevidentlylodgethtrancesheetknitfourfootedcreepinginquiryfearethaccompaniedunlawfulgainsayingrespecterquickcontendedwentestrehearseddrawnwithstandtravelledpheniceexhortedchristiansagabussignifiedclaudiusreliefvexapprehendedquaternionseasterceasingwardironsuretyknockedrhodaconstantlyknockingbeckoningstirblastusking'schamberlainroyalorationshoutwormsteachersnigerluciusmanaenseleuciasalamisislepaphossorcererbarjesusdeputysergiuspauluselymaswithstoodpaulmischiefceasepervertmistpergapisidiareadingmannerscisbenjaminstockcondemningpsalmmerciesdespiserscongregationreligiousalmostcontradictingblasphemingboldnecessaryunworthyendsexpelledshookiconiumunbelievingmindsaffectedassaultlystraderbelycaoniacrippleuprightlikenessjupitermercuriusspeakergarlandspassionsvanitiesfruitfulfillingfoodscarcerestrainedexhortingattaliarecommendeddissensiondisputationdeclaringconversionchoicedifferenceruinsabstainpollutionsidolsstrangledsilasgreetingsubvertinghazardedfaredismissedepistleconfirmedcontentionsharptimotheusjewessdecreesgalatiaforbiddenmysiabithyniatroasmacedoniaendeavouredsamothracianeapoliscolonylydiasellerthyatiraattendeddivinationsoothsayinggainschargingjailorinnerstockssangpraisesprisonersfoundationsone'skeeperawakingharmserjeantsuncondemnedfetchamphipolisapolloniathessalonicaopeningallegingconsortedlewdbasersortassaultedjasonupsidesecuritybereanoblereadinesssearchedconductedathensreceivingspeedwhollyidolatryphilosophersepicureansstoicksencounteredbabblersetterareopagusbringestatheniansmars'toosuperstitiousdevotionsinscriptionunknownignorantlybreathboundsfeelpoetsoffspringgodheadgravendevicewinkedassuranceclavedionysiusareopagitedamariscorinthaquilalatelyitalypriscillaoccupationtentmakersopposedblasphemedcrispuscorinthiansgallioachaiapersuadethlewdnesssosthenesshorncenchreavowephesuslandedapollosalexandriaeloquentferventdisposedhelpedmightilyconvincedpubliclypersuadingseparatedschooltyrannusspecialhandkerchiefsapronsvagabondexorcistspreachethscevaovercamecuriousartspurposederastusdemetriussilversmithshrinesdianacraftsmenworkmenwealthgoddessmagnificenceworshippethephesiansconfusiongaiusaristarchuspaul'scompanionstravelrushedtheatreadventureassemblyconfuseddefencetownclerkappeasedquietrashlyblasphemersdeputiesimpleadconcourseembracedgreecesailsopaterthessalonianssecundustychicustrophimuswindoweutychussunkloftembracingassosmindingmitylenechiossamostrogylliummiletusspendhastedhumilitytestifyingbefallbondscountshunnedoverseerssparingwarncovetednecessitieslabouringsupportgottencoosrhodespatarasailingpheniciaaboarddiscoveredunladeptolemaisevangelistownethcarriagesmnasonparticularlythousandszealousinformedforsakechargesshavewalkestorderlykeepestconcludedsignifyaccomplishmentteachethpollutedephesiancenturionscastlestairsmadestleddestlicencebindingpunishednoontarriestimprisonedmartyrscourgingthongsromanfreedomsittestcommandestsmittenrevilestpharisees'pulledbandedconspiracysister'shorsemenspearmenfelixletterlysiasarmyrescuedantipatrisprovinceoratortertullusenjoyquietnessprovidenceacceptthankfulnesstediousclemencypestilentmoverringleadernazarenesexaminingassentedcheerfullyraisingheresyvoidpurifiedobjectdeferreddrusillatemperanceoftenerporciusfestusfelix'shortlycomplaintsoffenderrefuseappealappealedagrippabernicecrimesuperstitionreservedpompprincipalfestus'speciallyexaminationunreasonablecrimespermittedespeciallyexpertpatientlystraitestreligionhope'sincrediblecommissionmiddaybrightnesscauseswitnessinglearningsobernesshiddenpersuadestchristianjuliusaugustus'adramyttiummeaningmacedoniancourteouslyrefreshmyralyciaslowlycnidussufferingcretesalmonehavenslaseadangerousadmonishedvoyagedamageladingownerhavencommodiousadvisedattainsoftlytempestuouseuroclydondriveislandclaudahelpsundergirdingquicksandslightenedtacklingabstinencehearkenedlossfourteenthadriashipmendeemedfathomsanchorssternwishedcolourforeshipropeshealthsixteencreekrudderhoistedmainsailseasagroundforepartstuckunmoveablesoldiers'swimboardsmelitabarbarouskindnessbundlesticksviperbarbariansvenomousswollenchangedpubliusbloodyfluxhonouredhonoursladedwinteredcastorpolluxlandingsyracusefetchedrhegiumputeoliappiiforumtavernsthankedcourageguardchainlodgingconcernconfidenceapostleaforeobediencementionrequestlengthprosperousspiritualmutualunwiseungodlinessinvisiblethankfulimaginationsprofessinguncorruptiblecorruptiblecreatorvileaffectionsnaturalnatureunseemlyreprobatemaliciousnessdebatemalignitywhisperersbackbitershatersdespitefulboastersinventorscovenantbreakersaffectionimplacableunmercifulinexcusablejudgestcondemnestdespisestgoodnessforbearancelongsufferingimpenitenttreasurestrevelationpatientcontinuanceimmortalitycontentiousgentilerespecthearersdoerscontainedaccusingexcusingsecretsrestestboastapprovestconfidentinstructorpreachestabhorrestsacrilegedishonourestbreakeruncircumcisionadvantagechieflyaboundedslanderouslyaffirmprovedpoisonaspscursingswiftmiserywitnessedshortpropitiationjustifierexcludedconcludeestablishjustifiethungodlydescribethblessednessimputethimputeimputedstepsheirsdeadnesssarah'sstaggeredjustificationaccesstribulationsexperiencescarcelyperadventuredarecommendethatonementreignedsimilitudeadam'sfiguredisobediencenewnessfreedmortalinstrumentsadulteressmotionsoldnesscovetoccasionconcupiscencerevivedcarnaldelightwarringcaptivitywretchedsendingcarnallyspirituallyquickenmortifyadoptionjoint-heirssufferingscomparedearnestwaitethmanifestationvanitysubjectedgroanethtravailethpainfirstfruitsgroanwithelpethintercessiongroaningsutteredsearchethforeknowpredestinateconformedsparedcondemnethnakednessperilconquerorsprincipalitiesheightheavinesswishaccursedisraelitespertainethcovenantspromisessarahrebeccaelectionesauwillethhardenethresistedrepliestformedpotterlumpenduredfittedoseesabaothsodomaattainedstumbledstumblingstoneheart'ssubmittedconfessionpreacherjealousyforeknewaltarsbaalslumbertrapstumblingblockbowdiminishingemulationreconcilingfirstfruitolivewertgraftedpartakestfatnesshighmindedseveritygraftconceitsblindnessfathers'unsearchablejudgmentsreasonabletransformedrenewingsoberlydifferingproportionexhortethsimplicityrulethcheerfulnessdissimulationabhorkindlyaffectionedbrotherlypreferringdistributinghospitalitycondescendpeaceablydearlyheapresistethordinanceterrorrevengerattendingduesowebrieflyillfulfillingnearerhonestlyriotingchamberingwantonnessenvyingprovisiondisputationsesteemethalikeregardethcharitablyedifyallowethdoubtethedificationreproachesreproachedlikemindedconfirmsinglaudadmonishpertainillyricumstrivedspainthitherwardcontributionchrist'srefreshedphebeassistsuccourergreethelpersnecksepaenetusandronicusjuniafellowprisonersnoteampliasurbanehelperstachysapellesaristobulus'herodionnarcissustryphenatryphosapersisasyncritusphlegonhermaspatrobashermesphilologusjulianereusolympasdivisionsavoidspeechessimplebehalfbruiseworkfellowsosipatertertiussalutethquartusstablish1Corinthiansenrichedchloecontentionsstephanasbesidesdisputerrequireweaknessconfoundbasesanctificationgloriethexcellencyenticingdemonstrationcomparingdiscernedinstructmilkwateredplantethwaterethhusbandrymasterbuilderbuildeththereuponwoodhaystubbletrystewardsherebycounselstransferredpuffeddifferspectacledwellingplacedefamedfilthoffscouringinstructorsfollowersrodmeeknessabsentgloryingleavenethsacrificedmalicesincerityfornicatorsidolatersfornicatoridolaterrailerdrunkardextortionersmallestutterlydefraudedeffeminateabusersmankinddrunkardsrevilersharlotsinnethbenevolenceincontinencypermissionunmarriedcasesordainfreemanabusingcarefulnesscomelyattenddistractionbehavethuncomelyflowerstedfastdecreedhappierpuffethcharityedifiethidol'semboldeneddoubtlessexamineforbearwarfaremuzzletreadethploweththreshethpartakerdispensationabuseraceprizestrivethmasterytemperateincorruptibleuncertainlybeatethsubjectioncastawayoverthrownexampleslustedplaydestroyerensamplesadmonitionthinkethcommunionshamblesprophesyingdishonourethprophesiethshavencoveringseempartlyheresiessuppedunworthilydiscerningsicklychasteneddiversitiesdifferencesadministrationsoperationskindsdividingseverallymembersmellingfeebleabundantcomelinesstemperedschismparticularsecondarilythirdlyhealingsgovernmentsinterpretsoundingtinklingcymbalenviethvauntethbehaveeasilyprovokedhopethpropheciesvanishchildishglassdarklyedifyingpipeharpdistinctionsoundsharpeduncertainbattlesignificationbarbarianexceloccupiethgivestinterpreterauthoracknowledgedecentlymemoryunlessmiserableexceptedsubduedprotestfoughtadvantagethsowestquickenedcelestialterrestrialdifferethincorruptionquickeningearthytwinklingtrumpswallowedstingaboundingcollectionstoreprosperedgatheringsapproveliberalitypermiteffectualconductquitaddictedsubmitlabourethfortunatusachaicuslackingsuppliedanathemamaranatha2Corinthianstimothycomfortethaboundethenduringdespairedhelpinggodlyfleshlyconversationyou-wardacknowledgedbenefitlightnesssilvanusstablishethgriefoverchargeinflictedcontrariwiseovermuchproofdevicesfurthermoretitustriumphepistlescommendationmanifestlyinkgod-wardsufficiencyengravenexcellethplainnessabolisheduntakenrenounceddishonestyhandlingdeceitfullycommendingearthendistresseddespairthanksgivingredoundrenewedtemporaldissolvedburdenedunclothedmortalitywhilstconsciencessoberconstrainethreconciliationimputingambassadorssteadsuccouredblamedapprovingdistressesimprisonmentstumultswatchingspurenessunfeigneddeceiverspossessingenlargedunequallyyokedconcordbelialinfidelagreementalmightyfilthinessperfectingwrongedcorruptedjoyfulfightingsfearssorrowedclearingvehementrevengeclearjoyedboastedtrialpovertyentreatyforwardnessadviceeasedequalitysupplyadministeredavoidingblameprovidingdiligentpartnerfellowhelpersuperfluousunpreparedbountynoticesparinglybountifullypurposethgrudginglycheerfulgiverministerethmultiplybountifulnessadministrationsupplieththanksgivingsexperimentprofessedliberalunspeakablegentlenesspullingholdsterrifyweightypowerfulcontemptiblemeasuringreachedlinefollyjealouschastebeguiledeverudeabasingrobbedchargeableburdensomestopdeceitfultransformingfoolishlywhereinsoeverfrequentdeathsrodsshipwreckjourneyingsperilscountrymenwearinesspainfulnessaretasdamascenesgarrisonapprehendrevelationsthorninferiorcraftydebatesenvyingswrathsstrifesbackbitingswhisperingsswellingsbewailforetellheretoforereprobatessharpnessfinallygalatianscertifyequalstraditionsarabiacommunicatedspyacceptethconferenceeffectuallypillarsdissembleduprightlylivestcompellesttransgressorfrustrateforeseeingcontinuethevidenthangethdisannullethaddethdisannultransgressionsmediatorschoolmastertutorselementsredeembeggarlyinjuredzealouslyaffectexcludebondmaidfreewomanbondwomanallegorysinaigenderethagartravailestentangledavailethpersuasionbiteconsumedlustethwitchcrafthatredemulationsseditionsrevellingsprovokingovertakenconsideringcommunicateconstrainmarksblessingspredestinatedprudenceenlightenedgreatnessus-wardprincipalityfillethdesiresagesworkmanshipalienscommonwealthsometimesmiddlepartitionreconcileforeignersfellowcitizensfitlyframedfellowheirsfamilygroundedcomprehendbreadthvocationlowlinessforbearingendeavouringunitylowerevangelistspastorsfrosleightcunningcompactedjointalienatedfeelinggreedinessgrieveclamourtenderheartedforgivingsweetsmellingjestingwhoremongercircumspectlyredeeminghymnssongssingingmelodysubmittingspotwrinkleblemishnourishethcherishethnurtureeyeservicemenpleasersthreateningwileswrestlebreastplateshieldfierydartshelmetthereuntoperseveranceambassadoraffairsphilippiansbishopsdeaconsconfirmationsincerefurtherancewaxingsincerelychoosebetwixtstrivingconflictvaingloryesteemrobberyhumbledmurmuringsdisputingsnaturallyepaphrodituscompanionfellowsoldierwantslongedcarefullyregardingconcisionpersecutingwinconformableforgettingreachingwheretoensamplefashionedsubdueeuodiassyntycheyokefellowclementfellowlabourersmoderationrequestslovelyflourishedtherewithstrengthenethsmellwellpleasingsaintcolossianscolosseepaphraspleasingincreasingjoyfulnesstranslatedvisibledominionsconsistpreeminencesometimeunblameableunreproveablesettledbody'swarninglaodiceaacknowledgmentbeguilejoyingstedfastnessstablishedphilosophyrudimentscompleteoperationblottinghandwritingnailingspoiledtriumphingholydayvoluntaryintrudingvainlyjointsnourishmentincreasethusingneglectingsatisfyinginordinatethings'filthyscythianhumblenessperfectnessrichlyadmonishingbitterdiscouragedheartilyonesimusfellowprisonermarcusfellowworkersferventlyhierapolisdemasnymphaslaodiceansarchippus1Thessaloniansrememberingentranceallowedtriethflatteringgentlenurseaffectionatelyimpartedholilyunblameablybehavedfellowlabourerdirectavengerforewarnedstudypreventarchangelsuddenovertakewakework'sunrulyfeeblemindedprophesyings2Thessaloniansflamingadmiredopposethwithholdethlettethdeceivablenessdelusionbeliefobtainingwithdrawdisorderlybusybodies2timothyfablesendlessgenealogiesswervedjanglinglawfullylawlessunholymanslayerswhoremongersmenstealersliarsperjuredenabledblasphemerpersecutorinjuriousacceptationpatternimmortalhymenaeussupplicationsintercessionspeaceablegodlinesshonestyverityliftingadornmodestshamefacednesssobrietybroidedarrayusurpchildbearingbishopvigilantbehaviouraptstrikergreedylucrebrawlergravitynovicedoubletongueddeaconslanderersrulingpurchasepillarcontroversyexpresslylatterseducingliessearedhotwives'purityattendancepresbyteryprofitingnephewspietyrequitetrustethsaints'relievedwantonwanderingtattlersreproachfullyrelievedoublepartialitystomach'swholesomedotingrailingssurmisingsdestitutecontentmenthurtfuldrownerredprofessionunrebukeableappearingpotentateapproachbabblingsoppositionsscience2Timothyforefathersmindfulgrandmotherloiseunicephygellushermogenesonesiphoruswarrethentanglethmasteriescrowneddoershuncankerphiletusnamethmaster'syouthfulgenderinstructingopposeacknowledgingperilousloverstrucebreakersincontinenttraitorsheadydenyingcreepsillyjannesjambresseducersdeceivingassuredinspirationreproofcorrectioninstructionitchingdeparturecrescensdalmatiacarpusparchmentscoppersmithlionpriscamiletumeubulusgreetethpudenslinusclaudiawantingriotselfwilledloverconvincegainsayerstalkersmouthssubvertlucre'scretiansbelliessharplyjewishabominableageddiscreetuncorruptnesspurloiningfidelityworldlyrighteouslypeculiarbrawlershatefulhatingmaintainstrivingshereticsubvertedartemasnicopoliszenasusesphilemonapphiaenjoinlove'sowethalbeitlucassundryworldsexpressupholdingpurgedmajestyfirstbegottensceptreremainestslipvisitestcrownedstsuccourfirmhardenprovocationcarcasesmixedlimitethsharpertwoedgedpiercingmarrowdiscernerintentspointsmelchisedecprinciplesusethunskilfulbelongethsensesexercisedbaptismsrenewafreshdressedbriersaccompanyforgetmultiplyingimmutabilityimmutablerefugeanchorforerunnersalempriesthoodcontradictionpayedleviticaldisannullingunprofitablenessunchangeableundefiledconsecratedsanctuarypitchedfaultlessjudahlawsdecayethwaxethdivineholiestgoldencenseroverlaidpotaaron'sbuddedcherubimsshadowingmercyseataccomplishingerrorsdrinkswashingsimposedreformationcalvesbullsheifersprinklingtestatordedicatedwoolsprinkledenjoinedsheddingpatternscomersvolumewaveringforsakingassemblingapproachingwilfullysorerdespiteilluminatedgazingstockspoilingevidencecaintranslationrewardernoahsojournedbuildermakersarapilgrimstriedaccountingchoosingesteemingassayingwallsrahabgedeonbaraksamsonjephthaelionsvalianttorturedacceptingcruelmockingsscourgingsimprisonmentsawnwanderedsheepskinsgoatskinsdenscavesbesetfinisherdespisingchasteningchastenethscourgethdealethchastisementbastardscorrectedjoyousyieldethmorselbirthrightinheritedblacknessdartterriblegeneralsignifiethremovingacceptablyconsumingforgetfulentertainentertainedadversityoccupiedcampsoonertryingentireliberallyupbraidethwaverethwaveunstablewitherethfadetemptethenticedvariablenesscreaturessuperfluitynaughtinessengraftedhearerbeholdethforgettethbridlethfatherlessunspottedwearethgaypartialoppresstremblebridlebitshorses'helmboastethkindlethtamedberriesfreshdescendethsensualdevilishadulteressesfriendshiplaughterlawgivervanishethboastingshowlmiseriesmotheatencankeredheapedreapedfraudcriesgrudgejobpitifulanointingfaultsconvertconverteth1Peterfadethsearchingfashioningsojourningforeordainedobeyinghypocrisiesenviesspeakingsnewborndisallowedstumblingstumbleevildoerssupremebrotherhoodfrowardthankworthywrongfullyhereuntowoncoupledadorningplaitingornamentweakercourteousrenderingrailingeschewensuepreparingauthoritiessufficebanquetingsidolatriesgrudgingrestethevildoerbusybodyoversightconstraintheritageelected2Peterlackethnegligentendeavourcunninglydevisedprivatedamnableperniciousfeignedlingerethslumberethreservegovernmentpresumptuousdignitiesbrutespotsblemishessportingdeceivingsbeguilingpracticesbalaambosorwellsswellingalluredogvomitwallowingmirescoffersoverflowedslackslacknessmelthastingwrest1Johncleansethadvocateantichristantichristsunctionacknowledgethpurifiethtransgressethworld'sshuttethassureconfessethovercomethpetitions2Johnladytruth'sbiddethpaper3Johnprosperprosperethfaithfullyfellowhelpersdiotrephespratingmaliciousforbiddethpenjudecontendcreptdreamersmichaelcontendinggreedilycoreforevermurmurerscomplainersadmirationmockersspottedwailalphaomegaendingpatmossmyrnapergamossardisphiladelphiacandlestickssawestholdethhatestnicolaitanesedgessatan'sholdestantipasbalacsufferestjezebelreinsdepthsshiverswatchfulblotlukewarmspueeyesalvechastenjaspersardinerainbowemeraldcrownslightningsthunderingscrystalflyingeaglebacksidesealsproclaiminghornsharpsvialsodourssonghorseconqueringconquerbalancespalefifthuntimelyscrollbondmanforeheadsreubengadissacharfountainstrumpetsangel'slampwormwoodinhabitersbottomlessstrikethshapeshorsesbreastplateschariotstailsstingsabaddonapollyonwoeseuphratesjacinthissuedroareththundersatepeoplescourtdevourethascendethtravailingpaineddragontailaccuserflyleopardexercisethharpersharpingforeheadripeclustersbridlesgirdlesvialnoisomescorchgnawedfrogswatchetharmageddonfiercenesswhoreinhabitantscoloureddeckedabominationsmartyrscarriethreignethcagebirdmerchantsdelicaciesrewardeddeliciouslyalassilkthyineivorymarblecinnamonflourslavesdaintyshipmastersailorstradecostlinessmusicianspiperstrumpeterscraftsmanalleluiaomnipotentthighgogmagogsorcerersburnethlamb'sfoursquaresapphirechalcedonysardonyxsardiuschrysolyteberyltopazchrysoprasustwelfthamethysttransparentproceeding1Timothy SpiritWare Concordance Program For the Atari ST (Version 2.0) January 1, 1990 INTRODUCTION The SpiritWare concordance program is a Bible-study tool that makes maximum use of mouse, window, and menu capabilities of the GEM desktop system to provide the user with a fast, easy and powerful way to access words and phrases that occur in Scripture. It is designed to be used on STs that have at least one megabyte of memory. This archive file should contain the following files: CONCORD.PRG -- A GEM-based concordance program for the Atari ST. PAUL.CCD -- The King James Version of the Pauline epistles (Romans through Philemon) WORDS.DCT -- A dictionary file used by CONCORD.PRG. CONCORD.DOC -- This document. Please copy and distribute this file as widely as possible but please do not modify its contents! INSTRUCTIONS This section gives a few brief instructions on how to use the concordance program. When you order from SpiritWare you will recieve the complete instruction manual. The manual contains a tutorial with many examples and illustrations, along with instructions for functions that are not discussed here. OPENING THE TEXT After starting up the program, load in the text by selecting Open from the File menu and choosing PAUL.CCD from the File Selector. VIEWING THE TEXT The Text window Scroll Bar can be used to position the text. The Scroll Box shows your position within the book you are currently looking at. Clicking on the Up or Down Arrow moves the text up or down one verse. You can also click on the gray area above or below the Scroll Box to move the text up or down one screen. Pressing the Alternate key redefines the Text window Scroll Bar to show your position within the entire text file, rather than with respect to the book you are currently looking at. To move to the next book, press the Alternate key while you click on the gray area below the Scroll Box. Clicking on the gray area above the Scroll Box with the Alternate key pressed will move you back one book. SEARCHING FOR A WORD OR PHRASE Type the word (or phrase) into the Search Command window and press Return. The results of the search will appear in the List window, and the first verse will appear at the top of the Text window. (If you are searching for a phrase, do not puctuate it. Punctuation contained in the text is ignored during the search.) VIEWING VERSES To view a verse that was found during a search, activate the List window and click on the verse. The verse will be displayed at the top of the Text window. SEARCHING FOR SEVERAL WORDS AT ONCE To search for verses that contain one of several words, separate the words by slashes (/) when entering them into the Search Command window. For example, to search for verses that contain "love" or "charity" type love/charity. (The slash only works on words, not phrases.) SEARCHING FOR WORDS WITH A COMMON ROOT To search for verses that contain words that have a common root, type the root with a plus (+) at the end. For example, to search for verses that refer to baptism, type bapt+. SEARCHING FOR WORDS IN THE SAME VERSE To search for verses that contain several words, but not necessarily in order, separate the words by commas. For example, to search for verses that contain "grace" and "peace" type grace,peace. COMBINATION SEARCH The above search commands can be combined to conduct more complex searches. OTHER FUNCTIONS This program was designed to operate in an intuitive manner. Feel free to experiment with the windows and the various menu options. ORDERING Both the King James Version and the New International Version of the Bible are available from SpiritWare. Information about ordering is available from within the program. Simply select the About... option from the Desk menu. UPGRADES In an effort to provide you with the highest quality software possible, we will continue to upgrade the concordance program. Announcements about upgrades will be sent automatically to those who have ordered from us. If you do not wish to order, but would like to be on our mailing list, please write to us. SPIRITWARE SpiritWare is produced by servants of our Lord Jesus Christ at Fifteenth Avenue Bible Church in Seattle, Washington, for the edification of His body. While SpiritWare is copyrighted, permission is granted for unlimited noncommercial copying and distribution of SpiritWare programs. `b[D*o"m #.I+I/ BBBg/ / Bg?<JNA NT ?N?<LNANVHNp?NNTO3%.f"/<p?N2\ONBgNTOSy%./</</</<p?BgNb09yS@309yS@3Jy%.f.p 3p 3p-330<3"3BgBgN0XO3 p?p?N0XO/</<^/</<NT309%.R@y/<r/</<N /<^p?N\Op?09%./N\O/< /<NPO#%*/<pH?NA\O#5VfNB&/<:pH?NA\O#fNB&~ Gad0H@B@H@ @0RG`p/pH?NA\O'# lNB&/9pH?NA\O#JfNB&Hnp?NA\OBg/<pN?NAPOJf/<N;(XOJ@fp3p?NATO309@a%Lp:%M09R@?/<%NpG?NAPO/<%L/<N PO/<#/<%LNPO/<*/<NPO/<NXO/<//<NPO/<NXOJ@g&/< yHh N POp?NTO`B |/ / ?<N 3BgBg/<9p??9N BgBg/<>p??9N |/ / ?9N |/ / ?<N 3BgBg/<Ip??9N BgBg/<Np??9N |$/ / ?9N |/ / p)?N 3BgBg/<Pp??9N |/ / ?9N 3%H/</</</< p??9Nb/</</</<p??9Nb/<"/< /</<p??9Nb/</</<?9Nr?9?9N>XOyfp3/<^p?`By/<^BgN\OBy(3*Byp309@3ByBy09%. @0309%. @23JygZ/<^/< |\/ / / / Bg?</< |/ / ?9 |/ / ?9p?09R@?p??9NT<3/<^/<^/<^/<%Hp ??9Nb09%HygNM09%.(@͞09%.&@͆09%.$@n09%."@V09%. @>0QRSTg JygN/<^BgN\OBy`6Jyf./<^09%Hyf?9`BgN\Op3Jygf09@fBgBgBg 9搹//< 9/NdPO/NPO?p ??9N By`^09@gRBgBgBg09S@H//<09%JH/NdPO/NPO?p ??9N p309@gN\09@g^09%HyfNN,09%HyfN`$09%HyfNb`Jyg |\/ / / / N`09@gN R09@g$Jy%gy?9NNTOBy%09@g6 yJyg&/<^09%Hyf?9`BgN\O09@ gJygNM0`?9NTO?9N"TO?9NTO?9N"TO?9NTO?9N"TO?9NTOp??9 N0XO/9%*NXO?9\p>?NAXONJg p?NTOBgNTOLN^NuNV=y09@ @bRH0@b PN`@N `6?.N!$`& y(lp?`?9 ydlpd?`?9?9?9p??.N 0.yf`=y=y/</</</< p??.Nb09nl09nl|?9`B0.yf*/</</</<p??.Nb0.yf.=y =y"/<"/< /</<p??.Nb09 nl09"nl?9`09%Hyf4NMBy09*y??9?9(?9NT>POBgBgBg?.p ??.N 3%H0.yf09*y??9?9(?9NT>POp?p?09%./NPOp?p?09%./NPOp?p?09%./NPO`0.yfDBgp?09%./NPOBgp?09%./NPOBg`0.yfj`0.yf?9NZ*TO0.yfB?9Nh`20.yf?9N_^TO0.yf?9NgTON^NuNV09W@ @b^H0@ PN`LN,`B09@ @b0H0@`N1R`N`N(`By`09@ @bH0@`NF`NF`NG`09@ @bH0@`NN&J`Nw&`p?N".TO`|Bg`p` y`09%. @>Jy`gp`B@0?9N0`09@% @b,H0@`N#`N#`N$X`Nzp??909%./NFPON^NuNVy09 |2<`XHXW PN`N1R`09%. @0@fjN(``By`V09%. @0@f:N`009%. @60@fNF` 09%. @N0@fNF`09%. @f0@fNG`09%. @ϖ0@fN&J`09%. @Ϯ0@f|Nw&`r09%. @0@fVp?N".`F09%. @0@f,Bg`09%. @0@f p`09%. @>0@f y`09%. @>Jy`gp`B@0?9N0`09%. @n0@fN#`09%. @І0@fpN#`h09%. @ж0@fNN$X`F09%. @0@f,Nz`$p309%Hyf?9NB`TON^NuNV?9NNTO/<^BgN\OHnHnHnHn09%.X/NVA/ / A/ / BgNA/ / p?Bg09%.X/NBg09%.X/N\O=@ @f0Hn/</<N 09%.X @ƖBP` ng09%.X @0@gP09%.X @0@g609%.X @.0@g09%.X @&0@fpHn/9NPO/<HnN POp\?HnN\O-@/<Jg nHh`HnN PO09%.X @ Pf/<_`/<aHnNPO-@09%.X @ PfD/<Z/<c/.N 09%.X @BP09%.X @p009%.X @ PfpK`p=@09%.X @ PfBn0.yl0."@5Z0@H@B@H@ @5V 9zА-@0. @5\? nHh nH?NTO?/<x/.N0. @5^ Pg&0. @5^?/</.N /</.NPORn`*/</.NPOp3` 09%.X @ Pf(?./.09L5Z/N p`09%.X @. Pf>Bn0.yl(?./.0.5Z/N Rn`p`b09%.X @& Pf\/</.NPOBn0.y%l:Hn0.H @/NPO?./.HnN Rn`/.NXO09%.X @p009%.X @BPHnNXO2.09%.XЁ @BPA/ / A/ / p?NN^NuNV?9NNTO/<^BgN\OHnHnHnHn09%.Ɍ/NVA/ / A/ / BgNA/ / p?Bg09%.Ɍ/NBg09%.Ɍ/N\O=@ ngz09%. @ɮ0@gP09%. @0@g609%. @0@g09%. @.0@fHn/9NPO09%. @ Pf/</9%*NPO09%. @ʆ PfF/<Z/</9%*N 09%. @ʆBP09%. @ʞp009%. @ɮ PfBn0.yl0."@5Z0@H@B@H@ @5V 9zА-@0. @5\? nHh nH?NTO?/</9%*N0. @5^ Pg(0. @5^?/</9%*N /</9%*NPORn`$/</9%*NPOp3`09%. @ Pf*pK?/9%*09L5Z/N p`09%. @ Pf@Bn0.yl*pK?/9%*0.5Z/N Rn`p`^09%. @. Pf`/</9%*NPOBn0.y%l#BgBgBg 9搹//< 9/NdPO/NPO?p ??9N ?9N0TO`N/< `~2.09%.Ё @¦BPA/ / A/ / p?NN^NuNVNr-@/<^p?N\O?9NNTOyBy%By%Hn/9NPOB909%.X @&p009%. @.p0/<ZN"XOJfByp=@`.N*Nr-@ByBnHnHn?.N?8 =@gB?.?.N+zXO?9/<ZN\O=@JnlBy` 0.y`Nr-@ | / / | / / p?NByLByBgBgBgBgp ??9N ?9N0TOByBy3 ?9N0TOJyfHnNXO#?9N0TO/<^BgN\O0. @g @g/<`/<@`/<zp?N2\O/<^09%Hyf?9`BgN\Op=@ nnV2.09%.XЁ @p02.09%.Ё @ɖp0Rn`/<5ZNXO#?9N0TOBgBgBg 9搹//< 9/NdPO/NPO?p ??9N /<^09%Hyf?9`BgN\Op=@ nnf2.09%.XЁ @0.yfp`B@02.09%.Ё @ɖ0.yfp`B@0Rn`09%.X @p009%.X @BP09%. @ʆp009%. @ʞBPNr-@Jygp//</.NPO/NdPO?/</.NPO?p//</.NPO/NdPO?/</.NPO?/<HnNHnp?N2\OByN^NuNV/</</</<09%.ü/NV | / / | / / BgN | / / p?Bg09%.ü/NN^NuNV0.H@B@H@"@,0@H@B@H@ @5V 9zА//<N PO9H0@ H@f9H?NTO0.n g/</<NPO/<NXO=@0. H@B@H@"@,0@H@B@H@ @5V 9zА//<NPO0nH0@ H@f$0nH?NTO0nB9 | / / p?p?09%.ü/NN^NuNVp(=@p(=@HnHnHnHn09%.0|/NV N/ / N/ / BgN0.@ =@29A0.yA=@ N/ / p?Bg09%.0|/N?9NTOBn nl\0.4 @\H??9NXO0.4]/?.?.?9N 09nRn`?9NNTO/<^BgN\OBg09%.0|/N\O/<p?N2\O=@ nfV-|. nJg&/9%* nH?N\O nRH`/9%*p ?N\O/9%*NXO N/ / N/ / p?NN^NuNVBnp=@0.@gr/<^Hn |\/ / / / Bgp?/<BgBgBgBgBgBgBgBgBgBgp?p?p?p!?NT<=@0.@g0.@ @fp`B@N^NuNVHn /<NPO0. S@n0. S@nHn p??.NXPON^NuNV/<^Bg?.NXPON^NuNV0.n m&0. nnm0. nm0.nn lB@`pN^NuNVp??9NXOp??9NXOBg?9NXOp??9NXO=n=n 0.n =@0. n=@Hn?9N\ON^NuNVp??9NXOp??9NXOp??9NXOp??9NXO=n=n 0.n =@0. n=@Hn?9N\ON^NuNVp=@=yBn=nHnHnHnHnp??.NbHnp??9NPON^NuNV^BB?9NNTOHn/</<%LN ?9N!$TO?9N!$TO?9N!$TOJng n/<^p?N\O/<%L/<N POp\?/<N\O-@/<Jg nHh`/<N POJyfF/<HnN PO/<݊HnNXO0@HhN POHnN;(XOJ@fHnpp?NA\OBg/<pN?NAPOJg&/<^BgN\O/<ݎp?N2\O`z09%. @p009%. @p009%. @ϖp009%. @Ϯp009%. @p009%. @p009%. @p009%. @>p009%. @np009%. @жp009%. @p009%. @Іp009%.X @&p009%. @.p0p=@ nnF2.09%.XЁ @p02.09%.Ё @ɖp0Rn`Bn nBl^2.A09%.Ё @~p02.VA09%.Ё @np00.H @2BRn`Jy\g?9\p>?NAXOBg/<p=?NAPO3\n/<^BgN\O/<ݳ`Hnp/?9\p??NA Jn@/<^BgN\O/<p?N2\O?9\p>?NAXOBy\By`JngH n8g@/<^BgN\O/<p?N2\O?9\p>?NAXOByBy\`-n n8fHnp/?9\p??NA /<,/<0?9\p??NA pB3 9RT@#/9/.?9\p??NA 9Ю# .8-@ .`TBBn .d0.H @. 0.H @,00.H @:p0.H @6 nBf /<`Hnp/?9\p??NA XJngn ne/<^BgN\O/<X`x0.R@HH@B@H@Ѯ .d0Bg?9\/.pB?NA Hnp/?9\p??NA `Rn`30.H @. 0.H @,BP 9RT@#"9 9U-@ .dBg?9\/9.pB?NA /9/.?9\p??NA d/<^BgN\O/<y`# .й#Bn0.ynB0.H @. й2.H A2 Rn`BgN=TOBy%JB@3L309%. @BP09%. @BP09%. @ϖBP09%. @ϮBP09%. @>BP09%. @nBP09%. @жBP09%. @BPHn/9NPOHnNXO#BgBgBgBgp ??9N /<^BgN\O/9z/<ޝNPOJg209%.0-@fp=@j09%. @>p0`409%.0<-@fp =@j09%. @>BPBy`HndHnbHn`Hn^/.fNVAf/ / Af/ / BgN0.^@ =@n29A0.`yA=@lAf/ / p?Bg/.fN?9NTOBn0.njl`09%.0 @ܱff0.&P`0.&4/?.l?.n?9N Rn09nl`?9NNTOBg/.fN\O nfBh"Af/ / Af/ / p?NN^NuNVH xHnp?NA\OBg/.pN?NAPOJg/<^BgN\O/<ޣ`&By| Fad0H@B@H@ @0RF`Bg/.p=?NAPO=@oB*y #z .oNB&p3?.p>?NAXO`/9z/.?.p??NA l$/<^BgN\O/<p?N2\O` 9zЮ#RRd-MBy~~g209~Ry~H@B@H@ @H@HG2I0HA>`09~Ry~H@B@H@ @B(p0aH@>x0@R@:0H@B@H@ @0< @g(E Gae p0aH@>0RD @ac/<`"0H@B@H@ @009RyH@B@H@ @5V .Ȑz `?.p>?NAXO| FBd20H@B@H@/N8XO2HABAHA A0RF`B@`/<!p?N2\OpL N^NuNV/0.H"@.0.R@H @. -@Jy\gT3%J0.H @2Jg&0.H @2# .й` By%09%.X @&p009%. @.p0Bn nFl0.H @2BRn`Bg?9\0.H @./pB?NA &./9 ./?9\p??NA l>/<^BgN\O/<Lp?N2\O?9\p>?NAXOByBy\`00.H @2 9 # .й#&N^NuNVJy\g0.yl40.H @:Jg0.H @6 fRn` n 00.ymB@` 9##Bn0.yl0.H @2JfRn`0.nf0.yl0.H @:Jg0.H @6 gf0.H @2Jgf0.H$@20.H"@.0.R@H @. В# n0Rn`^0.H @2Jg0.yf0.`p=n0.yl0.H @2BRn`"9撹 9U-@0.H"@.0.R@H @. -@-y .o0.yl0.H @:Jg0.H @6 gpBg?9\0.H @./pB?NA /./.?9\p??NA 0.H @2 .Ю-@ . n0Rn0.H"@.0.R@H @. -@`#0.N^NuNV/<^BgN\O/<pp?N2\ONBgNTON^NuNVJy%fPy09S@309S@3p33p3p3%?9NTO nfx09yg09yfSy=y=y0.y l$0.Rn0@Z0.Rn2@Z`09y=@` n m^09yf0=y 0.yo`0nZ2nYSn`=y09R@=@0.y l$0.Rn0@Z0.Rn2@Z`09yR@=@09Ry0@Z0.0.y 0y ZB093309(H=@0.R@=@0.yn0.H @0.PRn`NM |/ / ?9N/T =y=y(=y 09ny=@=|=yJng0.S@?NJPTO`09=@0.H @0.PfJno0.` 0.yn` A/ / N/PO0.S@?NJPTO09nA/ / N/POJnfJnf0.H @00.Rn?NJPTO=@Jnf09y fJng409no(=y A/ / N/PO0.S@?NJPTO=y Jng^0.H @0.PgF0.H @009nA/ / N/PO0.Rn?NJPTO=@`JnfP309n2.y09A=@A/ / N/PO09H @0 ?9N/TON^NuNV09ygNFJg p?NB`TON^NuNVJf /<ߎ`09%HyfNf09%HyfNV`09%HyfZ09ygLJgD09yH/09HZ/p?N J@g/<p?N2\ON^NuNVBJg4p?HnHnp?N J@g(/<p?N2\O`/<p?N2\OJg o/<_`29y ./0H =@JnoF09 n=@=y 0.ymr0.Sn0@Z0.Sn2@Z`JnlH09HЮ=@=y0.y n$0.Rn0@Z0.Rn2@Z`Jg2Bn0.HlL0.y0@Z2nRn`/90.?p?09HZ/N 0.y09330.y 0y ZB?9NTO |/ / ?9N/T NI?9N/TO?9NNTON^NuNVp=@ |/ / N/POJy gByJng0?9NJPTO=@Ry09H @0`09H @0 09yg609%Hyf(09*y??9?9(?9NT>PON^NuNVH p=@0.R@=@p??9NXO0.H @>y l0HZ*@zH0@ H@ f 'f0RE0@]`0RE0@U0EB(09<0nynHn0.yY@?0.y R@??9N yn40Gyo(09Gn30.y3(yn,0Gyo 09Gn33*nE`y m09y f0.H"@0y YH0@ H@ f0y Y 'f0S@`0QT@30.yo09U@HT@309y f30.y3(`3'3*B@`n09y f^:0GZ  fNRG0yf0.H @0PT@330.y3(3*`0L N^NuNVp??9NXOBg?9NXONMbN^NuNVp??9NXOp??9NXONMbN^NuNV09%Hyf09yf?9NTO |/ / ?9N/T 09y =@09(y=@09y =@09(yyS@=@Hnp??9N4PO?9N/TO?9NNTON^NuNVNr-@ .N ddp`B@=@ |/ / ?9?9N/ J@gHnHn?.HnHnHnNRFNM09@f~09*y??9?9(?9NT>PO=n=n0.=@3Jng?.?.?.?.NT>PO0.=@=@0.=@=@`09yf>?.?.09*y??9NT>PO=y=y(=y`H?.Jng?.`?.?9(?9NT>PO=y09*y=@=y yfj=n=n=nHnHn?.HnHnHnNRFJng0.nn =n=n0.nn40.nm*?.?.?.?.NT>PO?.?.?.?.`n0.nn,0.nm"?.?.?.?.NT>PO?.?.`0.nn 0.no0.nm"0.nm?.?.?.?.NT>PO/<^/< |\/ / / / Bgp?/< |/ / Bg |/ / Bgp?p?p?p"?NT<3`0.nm0.nfD0.nl:333(0.y3*33`T3Jng0.`0.33(0.y3*3Jng0.`0.309ygD09y f609*y??<'09*y??9NT>PO3'By#NN^NuNV09yH=@0.ym09S@=@=y `0.H @09y yU@HP=@0.R@H @0.Po0.R@H @=PJngP0nZH0@ H@ g0Jnm&0nZH0@ H@ gSn`Rn0.H"@0.QT@ n00. n 0 n0Jng09y @o0nZH0@ H@ g20.y l60nZH0@ H@ gRn`0.y lRn0.H"@0.QT@ n0 n0`"n n0"n n0N^NuNV |/ / ?9N/T p??9NXOp??9NXOp??9NXOp??9NXO0. noF0.y =@0. y =@=n 0. y=@0.y=@ =n`(09 n09 n 09n 09n0. nfZ0.n l =n0. ` =n 0.S@=@0.nl=n 0. yS@=@?9NTO`=n=n 09 yR@=@0. yS@=@?9NTOHn?9N\O09 S@=@0. y=@0.S@=@0.noHn?9N\O=n0. S@=@0.yS@=@Hn?9N\O?9NNTO?9N/TON^NuNV09H/N^XO-@-@f/<p?N2\O`Bn0.yl0."@5Z0@H@B@H@ @5V 9zА-@0. @5^?0. @5\? nHh nH?NTO?/</.N nJgR`Rn`X .H//.p?N /.NfXON^NuNVNY |/ / N/PO09HyR@=@=y0.yl0.nl0."@5Z0@H@B@H@ @5V 9zА-@0. @5\? nHh nH?NTO?/<HnNHnNXO=@0. @5^ Pg,0. @5^?/< NHhN Hn29%.I0.yR@yU@A??9?9N Rn`NXN^NuNVJyg=y09Lyy=@09S@=@=y N/ / N0tPO?9Lp?09%./NPO09S@yLgp?`Bgp!?09%./NPOp?p ?09%./NPON^NuNVJyg0 yo?9/</<bN `/<`/</<bNPOBgBg/<bp??9N N^NuNV09H=@09R@=@=@=@09R@=@=@09yS@=@=@09yS@=@=@=y=y09S@=@ nf09n09n nf:09n09n0.S@n09ynS@=@0. @bH0@ PN`Jyg0.yJylBy?9N!$`09nyo0.y09nyl09n3`JygZ?9NTO |/ / ?9N/T NXSy/<8/<$Hnp??9NA/ / N/PO09"@5Z0@H@B@H@ @5V 9zА-@09 @5\? nHh nH?NTO?/<HnNHnNXO=@09 @5^ Pg.09 @5^?/< NHhN Hn09yY@??9?9N `09nyo?9NTO |/ / ?9N/T NXRy/<8/<$Hnp??9NA/ / N/POBn nlJ0.nyyn*09nnS@"@5Z0@H@B@H@ @5V 9zА-@09nnS@ @5\? nHh nH?NTO?/<HnNHnNXO=@09nnS@ @5^ Pg809nnS@ @5^?/< NHhN Hn0.nyY@??9?9N Rn`NX?9N/TO?9NNTOBgBgBg0.yl409nH//<09H/NdPO/NPO?`Bgp ??9N N^NuNV09H=@BgBgBg?.p ??9N 0.yl0/<09nH/0.H/NdPO/NPO`B@3?9NTO |/ / ?9N/T NWt?9N/TO?9NNTON^NuNV |/ / ?9?9N/ J@g09yHy=@0.yl?9NTO |/ / ?9N/T NX3LNX?9N/TO?9NNTO09L5Z/NXO#?9N!$TOBgBgBg 9搹//< 9/NdPO/NPO?p ??9N N^NuNV09H=@09Lyl2.A09LA3JylBy?9N!$TOBgBgBg0.yl409nH//<09H/NdPO/NPO?`Bgp ??9N B@`R09nS@yLl<2.A09LnAR@309nylD09n`0pN^NuNV-yJg, |$/ / ?9?9N/ J@g?9NTO |$/ / ?9N/T =y09 S@=@09yHR@=@p=@Bn0.nl*Jngd-yHnN0XO=@0.n`#09@f NuBy% yc%m$?9NNTO/<p?N2\O`Jy%gBn0.y%l0.H"@ ncRn`0.y%gV0.H"@ nf>Sy%0.y%l0.H @0.R@H"@ Rn`=y%0.no*0.H @0.S@H"@ Sn`0.H @ Ry%`#p3%0.nyR@=@0.S@=@A/ / N0tPO09%.X @&Jy%gp`p009%. @.Jy%gp`p0Jy%gp=@ nnZ2.09%.XЁ @0@g32.09%.Ё @ɖ0@g32.09%.XЁ @ Pg2.09%.XЁ @BP2.09%.Ё @ɖ Pg2.09%.Ё @ɖBPRn`09%.X @0@f"2909%.XЁ @p009%. @ɮ0@f"2909%.Ё @ɖp0 |$/ / ?9N/ ?9NNTO#N^NuNVN^NuNV |$/ / N/POJy\gLNgHn/9NPOBg09"HR@?Bg?.?./9Nm|NuN^NuNVHn/9NPO0.@H@B@H@ @5V 9zА-@?. nHh nH?NTO?/<@/<N3BgBg/<p??9N N^NuNVBgBgBg?.p ??9N JygL/<09S@H/0.H/NdPO/NPO3%J?9%JN=TO#`>/< 9搹/0.H/NdPO/NPOй#Hn/9NPOHnNXO#?9N!$TON^NuNV09"H=@-y09=@=@=@09R@=@=@=@09y R@=@=@09"yS@=@=@=y 0. @bH0@ PN`JygPJy%Jg4Sy%J09%J?N=TO#Hn/9NPOHnNXO#`FHnNXOJ@g0.nl"-yHnNXOJ@g 0.n`#?9N!$`Jyg09S@y%Jo~Ry%J`HJygj#`JygHn/9NPO ng8Snp=@`*Jyg@Hn/9NPORnp=@HnNXO-@Jg#` nd GdF0@ |2<`XHXW PN`Jyg G gx| n: EdF Ec@ E g: EeJy`g EeRDJy`f Eg0RFH@B@H@ @` Ecl0@@H@B@H@ @5V 9zА/NXO@0RFH@B@H@ @: Ed$ Ec E g EeJy`g EeRD`0y%yc NuBy%Jy`f$ G f n Pf?<NthTORDp=@0@?NthTORy%`0 |2<`XHXW`p3``NuBy%`Pn?.?9NXO`4n?.?9NXO nT>09@y` *nx Ue8 Uc.0@@H@B@H@ @5V 9zА/NXO@T`09D@H8NuBy%JDgp ?NthTOSD`p?`@Jy`g><[`~ nT Pf n P fT`JngBn`H><`J><]`BJng NuJ@f>p=@GJyg JngBy09L @5Z0. Pf409L @5\0.Pf09L @5^Pfp`B@=@ .U#0.y3 Gg8p??9NXO?NtTOp ?NthTOBg?9NXOp3%`LJGglNup??9NXOp3/.NtXOp ?NthTO0=@3?NtTOnBg?9NXOT` n0=@ 3"nT0@H@B@H@ @5V 9zА-@`0@@H@B@H@ @5V 9zА-@/.NXO=@|x n: Ed6 Ec0 E g* EeJy`g EeRD0RFH@B@H@ @`09%DnycNuJ@f By%0@3JngdG|yd20H@B@H@ @%Pfn?.?9NXORF`/.NtXOn?.?9N` /.NtXO0.y% nT>Jy`f. Gf(p=@?<NthTOp ?NthTOTy%`: Gd Gg Gg Gf p ?NthTORy%` NuBg?9NXOL N^NuNV0.@B.Jyg Hn?9?9?9N 09y n fp`B@3N^NuNV?./<IHnN HnNtXON^NuNVJyg& nH?NTO?NthTORByJyg2 nJg" nRH?NTO?NthTO`By`@Jyg /.?9?9?9N /.NXOyByN^NuNV09y309yRy09ymp`B@N^NuNV09"H=@-yJy%gBn0.y%l 0.H @ PdRn`0.y%g=y09 S@=@Bn0.nn0.H @ PfxHnN0XO=@0.yR@=@0.S@=@A/ / N0tPOJngD0.H @ PdRn0.y%m`HnN0XO0.n`L#N^NuNVBn0.yl~Bn nBlj0.H"@,0.H @0Qf>0.H @:Jgp`B@4.B29%.҂ A~0`Rn`Rn`x?9NNTO/<^BgN\OHnHnHnHn09%.t/NVA/ / A/ / BgNA/ / p?Bg09%.t/NBg09%.t/N\O=@ @o nmz2.09%.Ё @~0@fp?2.09%.Ё @~0 @?A/ / Bg?.09%.t/Nr`X0._@=@ n fhp=@ nUlp?2.09%.Ё @~0@?A/ / Bg?.09%.t/NrRn`0.H @L0@=@0.H @N0@nm~2.09%.Ё @~0@gRn`p?2.09%.Ё @~0@?A/ / Bg?.09%.t/Nr`p?Bg` ngBn nBl~Bn0.ylf0.H"@,0.H @0Qf:2.A09%.Ё @~0@2.H A:`Rn`Rn`|2.09%.Ё @~BPA/ / A/ / p?NN^NuNVBn0.yl`Bn nBlN0.H"@,0.H @0Qf"2.XA09%.Ё @nBP`Rn`Rn`?9NNTO/<^BgN\OHnHnHnHn09%.d/NVA/ / A/ / BgNA/ / p?Bg09%.d/NBg09%.d/N\O=@A/ / A/ / p?N ng\p=@=@0.Y@H @=PHnNXO#BgBgBgBgp ??9N ?9N0TO2.09%.Ё @nBPN^NuNVH8&yxvJyRfB@`6Jn g*yd">9R Gd0@<GgR Fd@ Fd"JFgT`2N.J@gp`T M=P` FfJy`f UgT`T Me`(M0H @R>g"T M0@< @d. Fe6 FfJy`f UgT`0@<e`` GdGg UcTx`d>0@<0@:0H @JPg0H @0FgRRE` Fd< FdJFgT`.N.J@fT M=P` FfJy`f UgT`T`x0@:0H @0Fg0H @JPg:RE`RD` db LU0@2 A1@ dc LU Pe`0 @1T0RC @0n f/<p?N2\O` Uc MTe0L8N^NuNVH0~,<*nJf#`NJgB  fR`zH0@ H@ f -g 'g ,fR ,f0-H0@ H@f-H0@ H@gH?NTTO2RE0A@` +fLv(yz yRAc`xElH6@HAfRDR`Df0H @JfRC`B6PHnN8XO6JCm0@H @p=@Jg$H0@ H@ f /fBnR`Jnġ~`#L0N^NuNVTH8BnzBnv nJg0. 5Z#~#zByB@33ByR nJg nzlBn~ nH0@ H@ f n 'g n -g n ,fj n ,f8 n(H0@ H@f n(H0@ H@g( nH?NTTO N~@Rn~R`` N~B( n +f*yz=yxRd.HH?NTTOCfRI&MJgHH?NTTOCfRR`JfJnvf0.zH @R0.x@0S/ N8XO29HABAHA A0 yd409RyH@B@H@ @%09H@B@H@"@0Ry yep`Jg`RnzBnv nH0@ H@ f n /fSnz0.zH @R Pdj0.zH @RJPg\09H@B@H@ @0.zH"@R00.zH @R09@0Ry yd@p=@v nRJfB`: n ,f0.zH @RBP09H@B@H@ @BP09H @z"5Z0<A?09H @z/N|\O=@tJntlp`V09R@H @z09H"@z0.tБ ByBnzRy09 @gR nRJg09H @z e>`Jnvf09RyH@B@H@ @BP ye2`0.zH @RBP09H@B@H@ @BP09H @z"5Z0<A?09H @z/N|\O=@tJntm09R@H @z09H"@z0.tБ RyBnz-yzp-y~h nphdp=@~0.~yl0.~H @z-Pl0.~R@H @z-Pd nldd8"nl np0Qf$"nl np0(if"nl np0(ig$\l`*np .p\(@hd`]h`XRn~`b\pRnz`D0.z`JnvgpHnN8XO=@|mZ09RyH@B@H@ @0| yd yd"09RyH@B@H@ @%0|`HnN8XO=@|l0.zH @RBP`>0.zH @R0| yd 09RyH@B@H@ @%0|.H?NTO@Jn|l~ n  fR` n /gbBnzpL8N^NuNVH *n~H0@ H@ gH?NTTOpRGR`B6p  f JfB@`$H0@ H@g~H0@ H@gpRG`B6pJf n p`> :f~H0@ H@gpRG`B6pJGgHnNJXO n 1@.H0@ H@g.H?NTO@HnNXO<~ GBl&?Hn0H/N. J@gRG` GBg0H"@ n 0HnNJXO n 1@pL N^NuNVH0 n>Bn0.yl0.H @,0GgRn`0.yfB`z?.N=TO n<( n0(@:0.H @2 X*@ 9U(@0Fg0H@B@H@dJUf`T M0Eg Uec` L0N^NuNVBn/.NXO=@0@ H@g0.Rn0@0.@` NB(HnNJXON^NuNV nJg/. nRH?N\O`N^NuNVH *n|~z0GJg0GHE2I0HA:RG`p0aH@:0@R@80H@B@H@ @0> @gP0H @5V 9zА// NPOJf0@`$D Eae p0aH@:0RF @aop`pL N^NuNV ndn nJPf8T"n n 0T"n n 1QX n0@ n 1@` n PdT` n hd n hcT` 9U-@ n PeU` nU0@ n 1@U n Pc nU Pe`"n n 1Q09S@=@Jnm20.H @2Jg0.H @2 cSn`0.H"@, n 0N^NuNVH0*y 9U(@N n0T M Pd UdeB@` UdT`#pL0N^NuNV/ *yU ed Ud yAeB@`#N n0p*_N^NuNVH BnBnBn*y fB@`$09 HU@3By%p=@>d Gd0@ |"2<`XHXW PN`Jng G gx|: EdF Ec@ E g: EeJy`g EeRDJy`f Eg0RFH@B@H@ @:` Ecj0@@H@B@H@ @5V 9zА/NXO@0RFH@B@H@ @: Ed$ Ec E g EeJy`g EeRD`0y%yc RnBy%Jy`f G f Uf Ry%p=@ G fp`B@=@Ry%`0 |2<`XHXW`RnBy%`Jy`g><[`r ]f U fT`JngBn`R><`L><]`DRnBy%Jng 0.S@`(p=@ Ggp3%`JGg RnBy%T`0@@H@B@H@ @5V 9zА-@/.NXO=@|x: Ed6 Ec0 E g* EeJy`g EeRD0RFH@B@H@ @:`09%Dnyc RnBy%Bn0.y%>Jy`f Gfp=@p=@Ty%`2 Gd Gg Gg Gfp=@Ry%`0.L N^NuNV30.@ H -@p=@ nl$ nRH2.H A0Rn`/9 NBXO09N^NuNV####### p ?NTO3pN^NuNVp?NTOpN^NuNV33 # p ?NTON^NuNV33 p?NTON^NuNV33 3 3333333333 3"#$3(3*p?NTO n,0 n00 n40 n80 n<0 n@009N^NuNV3# p4?NTON^NuNV#p6?NTO n 0 n0 n0 n0 09N^NuNV33 3 333333p3?NTON^NuNV#3 p2?NTON^NuNV## pZ?NTO n009N^NuNVpM?NTO n0 n 0 n0 n0 09N^NuNVpO?NTO n0 n 0 n0 n0 N^NuNV3# pN?NTON^NuNV#3 p?NTON^NuNV#3 3p ?NTON^NuNV#3 3p!?NTON^NuNV#3 3333333p/?NTON^NuNV#3 33333p*?NTON^NuNVH0*n(n 0m?0l?NlXO:0-m?0,l?NlXO8??NPXO>?-?,NPXO<89F0G9@0F9@GoFop`B@L0N^NuNV#pP?NTON^NuNV3pf?NTON^NuNV33 3 33pd?NTON^NuNV3pg?NTON^NuNV33 pj?NTON^NuNV33 ph?NTO n 0 n0 n0 n0 09N^NuNV33 3 33pe?NTON^NuNV33 3 333pi?NTON^NuNV3pk?NTON^NuNV0.n o0.`0. N^NuNV0.n l0.`0. N^NuNVBp ?NA\O-@ 8T-@ n u1f/.BgN\OHp=@`Bn/.p ?NA\O0.N^Nu#NJ/9NuNVpe3%0By%2By%63%`JEf0D@>0L N^NuNVH8..P b d.</NXO*@ Mg`Jf&M #x#t`& yf QP&m`(yQ L&h)M Q@* Ѝ#(@Q LB)KL8N^NuNVH0~ .\S@,dB`ƙ*yt gr .gH g @є .*L(Mc2  d @*`* Ѝ#t yt X`dJg @Ѝ*@`*mtf g#tRy|09| @e Sy|`X/NXO/.N^XO*@Sy| L0N^NuNVp0./N^XON^NuNVH .Y*@Jf4~0G~Jg 0RG0@~H?p?p?NM\O`NRL N^Nu o"H0/JfSBA gfBNu Nu"o o JfSfNu"o ofJfHHNu"o o fNu o"Jf S@Nu"o oB2/ gSAfJgQHHNuNV/>.0G H@g0@ `0.N^NuNV/>.0G H@g0@`0.N^NuNVHn/<NPON^NuNVHn /.NPON^NuNVHn?</.Nf Hn HnNPOHnBg nN\ON^NuNVH0-n n(PXH> @%gJGgf/.? n hN\O`p =@p=@p=@H> G-fp=@H>`Bn G0f p0=@H> G*f& nT=Plp=@0.D@=@H>`*Bn G0m G9n0. G@0=@H>` G.fJH> G*f nT=PH>`*Bn G0m G9n0. G@0=@H>` Glf&H> Gdg Gog Gug Gxf0@> `-@*@p=@0 |H2<`XHXW PN`J nT=PJnl0.D@=@p-p ??./ NPO*@`p ? nT?`p`p` n-PXJl .D-@p-p ?/./ N `p ? n// N *@X`p`p` n "(-@-AP/ ?././.?N"`RBn n-Pf-|@X .-@*@JgJnm noS`(Bn nT0` n//.NPO`X ./0.Hї =@lBnJnfLJng0 n0f( n -f/. nRH? n hN\O0.SnJ@g /.?.` nd /. nRH? n hN\O`Jng0.SnJ@g/.?. n hN\O`L0N^NuNVH >. *NB%0<g"0H@H@B@H@ @>`?Bg _Jg nR` .L N^NuNVH0*n>.IB$p0//. NPO-@g$p0//. N$PO @-n ` n Jg` L0N^NuNV/ *n/ mNXO*_N^NuNV/ *n / ?. mN\O*_N^NuNV/ *|8d2Jg U(H@fp?//. /.N*`X`B*_N^NuNVH0*n(n0. =@,H@g/ lNXOSnJf ,H@f JngL/ lNXO> @g:Sn`?./ ,H?NPO>on`JGf,`,0. n L0N^NuNVH *n>.|BnBnp=@ n R pr@H @rf|pw@ n g,H @bfBnR n gH @bfBnJGlJnf?/.N~\O>JGl@JnfJng4?</.N\O>m Fg?NTO?/.N~\O>JGmJngp?B?NVPO fp?NNTO*@ f ?NTO`|p@Jng- p+@*+@Bm +|+|2G `DH @wfRn`H @af&Rn`H @+g.HHAf|`BL N^NuNV/ *n .*+@+|B-0. D@;@ m l;| +|`+| *_N^NuNV/ *n Sm lBm p` UR0.*_N^NuNV/ *n UR0.*_N^NuNV/ *nRm oBm p` URB@*_N^NuNV/ *nJf0-H@f?<NNTO+@f+|`+|z`n-H@f2-H?N6TOJ@gf+|~+| -`&+|~+|-H?NTOHЭ*+@Bm *_N^NuNV/p?B?.NVPO. fB@`0H@.N^NuNV/ *n/ N XO/ mNXO*_N^NuNVH >.*n / N XO/ ? mN\OL N^NuNV/ *|8Y MeJg/NXO`*_N^NuNVH *n-H@fp`@/ NXO>-H?NTOJg-H@f /-NfXOB-0L N^NuNVH *nBm -H@ff >o?/--H?N\POGf$JGm mAf -*+@`+UB@` 09H fBy`-pL N^NuNVH *nRm o/ NXOJ@f f/<NXO -?/--H?NPOD@;@ @f^09H fBy`-Bm `F0- Rm m+H URB@>-H@ g G gL Gg 0`Jm f-pL N^NuNV/ *n f/<NXOBm p?Hn-H?NPO @g4J@gP .f -H@ f< . f -H@ fB@.`(09H fBy`-`-p*_N^NuNVH >.*n G f$-H@ g/ p ?N\O @fp`0Sm l"/ NXOJ@f -S@;@ UR0L N^NuNVH >.*n G G f -H@ g/ p ?Nz\O @g^Bm -H@fN/ NXOJ@f@p?Hn-H?N\PO @f0` 09H fBy`-pL N^NuNVH >.*n G f$-H@ g/ p ?N\O @fp`?NAXO/N|XO`B@N^NuNV/Bg/.p98HH8*@SnmSGldpQ8B99/<8p ?NA\O>l0H`p ?p?p?NM\Op899H>98HH8*@0Gp H: Ef~` n R RF E fn 8890`$/. 0.H/?.p??NA /N|XOL N^NuNVH..Jl <`0Jf 9`$R @./pH?NA\O,g Ї# LN^NuNV0.H/NXON^NuNV/. 0.H/?.p@?NA /N|XON^NuNVH >.0V@ @bH0@ PN`*pP`&pA`"pC`JGm*ySGmJfp`JgHL N^NuNVH >.JGm*ySGmJfp` Jg0. L N^NuNVH >.0V@ @bHH0@ PN*yHGg Jfp`&R` ?NTO`~C`~A`~P`pL N^NuNVJl .D3p` .N^Nu"o`C"/jD$jDA`|J/j JgRJk`JjDNu"o`C"/$A`JNu"o`C$jD"/A`, g J/j Nu"o`C$"/A` NupJfpN∲cd⒒d҂dFN o"`"/ jD$/jDD$@A`" jDNu o"`"/ _$0"@0HAHBЁH@B@ЉNNV/ *nJg/<H? yN\OR`/<p ? yN\O*_N^NuNV/?.pE?NAXO>l0H/N|XO`"?.NTO=@m?.?NXO0.N^Nu"/0<NBNu#%>Nu#%BNu X &0Xbl444&. :vh  \6*<>[([Z[] i4ijjPoooppJpq nRqqnonRFl{NULL}DODU$XHcdeLfLgLorsuxDD0123456789ABCDEFnjf?SAVEFILE.TXT{9P=P= SpiritWare  ATARI CONCORDANCE PROGRAM Version 2.02 Copyright 1988-89, Fifteenth Avenue Bible Church. All rights reserved. Portions of this program are copyright 1984, Mark Williams Company. Permission is granted for unlimited non-commercial copying and distribution of this program. For information on upgrades or to order the KJV or NIV text of the Bible write to: SpiritWare Fifteenth Avenue Bible Church 15211 15th Avenue N.E. Seattle, WA 98155 genesisexodusleviticusnumbersdeuteronomyjoshuajudgesruth1Samuel2Samuel1Kings2Kings1Chronicles2Chroniclesezranehemiahestherjobpsalmproverbsecclesiastessongisaiahjeremiahlamentationsezekieldanielhoseajoelamosobadiahjonahmicahnahumhabakkukzephaniahhaggaizechariahmalachimatthewmarklukejohnactsromans1Corinthians2Corinthiansgalatiansephesiansphilippianscolossians1Thessalonians2Thessalonians1Timothy2Timothytitusphilemonhebrewsjames1Peter2Peter1John2John3Johnjuderevelation[3][Sorry...|This program requires either|medium or high resolution!][ OK ]prn:wwords.dctwords.dct\*.CCD\*.*scrap.txtList No versesText Search Commandaw Search command: %s %c%s %d:%d Search command: %s %c%s %d:%d %c%s %d %d %s %s [2][Can't find that verse!][ OK ][2][The verse syntax you entered|is incorrect.][ OK ][1][Out of storage space...|Can't continue search.][ OK ][1][Search Aborted.][ OK ][1][No verses found.][ OK ][0][Overall time: %d.%03d sec.|Net time: %d.%03d sec.][ OK ] to [0][Do you want to have an |order form for the|concordance program and|NIV/KJV texts printed?][ Yes | No ]`,`,@dP< @<@'n< @'<7 `  ( %A % %A n' `(< P>KA%AKA 7Hd   (  U  nr d-P ՜ ի չ# xA A  2  s  sK # (#  K # (#  C \ K  K7  d dK !# %(# 1(2 8 GU2`xAcAj 2p  օ  K ֙# ֝(# K֠# ֤(# b  n֧ n7֭ Kֽ#(#1F  # xsA sA  2  K # Z KK 6# :(#  ZK =# A(#  A k1D2 T cq2|xAA׆ 2׍ n ף  nK ׶# ׺(# K׽# (# b 1F   0  00  `0  @  @ $ F F    (0 80p p)p7pEp`XSX_XkX$#@w؍أ ظ! "(#08%)(&%';(Q)f$ |  ْ0 ٘00 ٞ`0 ٤@ ٬@ $  ٴ ٿ  0@P` p0p@pp p0p`X0XX) X$#5Ka  v0!ڌ@"ڢP#ڸ`p%)P&'( )$0$ :@______________________XXXXXXXXXXXXXXXXXXXXXXOKOKOKOKEnter verse to find: OKCancelEnter verse to find: OKCancelSearching...(Press ESC to cancel search)Searching...(Press ESC to cancel search)List of VersesCurrent VerseAll VersesOKCancelSAVE:Save search command:CR at right margin:YesNoYesNoFILE:Append to file:YesNoSelected VersesList of VersesCurrent VerseAll VersesOKCancelSAVE:Save search command:CR at right margin:YesNoYesNoFILE:Append to file:YesNoSelected VersesList of VersesCurrent VerseAll VersesOKCancelPRINT:Print search command:Start on new page:YesNoYesNoSelected VersesList of VersesCurrent VerseAll VersesOKCancelPRINT:Print search command:Start on new page:YesNoYesNoSelected Verses Desk File Edit Search Locate About... ----------------- Open... ^O Save... ^S Print... ^P Quit ^Q Cut ^X Copy ^C Paste ^V Search Limit Search... ^L ------------------- Previous < Current * Next > ------------------- Show Footnotes ^N Set Bookmark ^B Go To Bookmark ^G ------------------- Find Verse... ^F Display Book... ^D Desk File Edit Search Locate About... ----------------- Open... ^O Save... ^S Print... ^P Quit ^Q Cut ^X Copy ^C Paste ^V Conduct Search Limit Search... ^L ------------------- Previous < Current * Next > ------------------- Show Footnotes ^N Set Bookmark ^B Go To Bookmark ^G ------------------- Find Verse... ^F Display Book... ^D Scripture quoted from: THE HOLY BIBLE: AUTHORIZED KING JAMES VERSION This text is in the public domain. Scripture quoted by permission from: THE HOLY BIBLE: NEW INTERNATIONAL VERSION Copyright 1973, 1978, 1984, by The International Bible Society. All rights reserved. Used by permission of Zondervan Bible Publishers. DCT[3][Can't find the text file!][ OK ][3][Can't open the text file!][ OK ][3][Error reading text file!][ OK ][3][Wrong file type!][ OK ][3][This text file doesn't match|the current dictionary!][ OK ][3][Bad text file format!][ OK ][3][Error reading text file!][ OK ](NIV)[3][Can't find the dictionary file!][ OK ][3][Error reading dictionary file!][ OK ][3][Too many words in dictionary!][ OK ][3][Can't open the dictionary file!][ OK ][3][Error reading text file!][ OK ][3][Not enough memory!][ OK ][1][Edit functions can't be used.|(Clipboard is not installed)][OK][1][Not enough memory for|this operation.][OK][1][Clipboard error.][OK][1][Edit functions can't be used.|(Clipboard is not installed)][OK][1][Too much stuff on clipboard.|Can't paste.][OK][1][Not enough memory to copy verses.][ OK ]%c%s %d:%d %c%s %d:%d %d Verses 1 Verse No Verses %c%s %d:%d %c%s %d:%d[1][Can't select more|than 100 verses!][ OK ] %c%s %d%d'(+-AB'(B  n"A A n P  P  #P  2P  AP  PP  _P dP dP d#P d_P To@' @ ' @' @' @(' @2' @ <' @F' @P' @Z' @d' @!(' @&( ' !@+(' "@0(' #@4((' $@8(2' %@<(<' &@@(F' '@D(P' (@H(Z' )@L(d' *@PP' +@TP ' ,@XP' -@\P' .@`P(' /@dP2' 0@hP<' 1@lPF' 2@pPP' 3@tPZ' 4@xPd' 5@|x' 6@x ' 7@x' 8@x' 9@x(' :@x2' ;@x<' <@xF' =@xP' >@xZ' ?@xd' @@' A@ ' B@' C@' D@(' E@2' F@<' G@F' H@P' I@Z' J@d' K@' L@ ' M@' N@' O@(' P@2' Q@<' R@F' S@P' T@Z' ` d' "  "A A' P - (P 5 FP < dP E P N PV P_d Pcd(PldFPudPT@{'@'@('@<'@P'@d'@x'@'@'@'@'@(' @('!@(('"@(<'#@(P'$@(d'%@(x'&@(''@('(@(')@('*@P'+@P',@P('-@P<'.@PP'/@Pd'0@Px'1@P'2@P'3@P'4@P'5@x'6@ x'7@ x('8@x<'9@xP':@xd';@xx'<@!x'=@%x'>@)x'?@-x'@@1'A@5'B@:('C@?<'D@CP'E@Gd'F@Lx'G@P'H@U'I@Z'J@_'K@d'L@h'M@m('N@q<'O@uP'P@zd'Q@x'R@'S@'T@'`' A Eo'  ' ' ' (' 2' <' F' P' Z' d' (' ( ' (' (' ((' (2' (<' (F' (P' (Z' (d' P'  P ' P' P' P(' P2' ! P<' "$PF' #(PP' $,PZ' %0Pd' &4x' '8x ' (<x' )@x' *Dx(' +Hx2' ,Lx<' -PxF' .TxP' /XxZ' 0\xd' 1`' 2d ' 3i' 4n' 5r(' 6v2' 7{<' 8F' 9P' :Z' ;d' <' = ' >' ?' @(' A2' B<' CF' DP' EZ' %d' "AE''('<' P' d' x' ' '''(' ('(('(<'(P'(d'#(x''('+('/('3('7P';P'?P('CP<'GPP' KPd'!OPx'"SP'#WP'$[P'%_P'&cx''gx'(kx(')ox<'*sxP'+wxd',{xx'-x'.x'/x'0x'1'2'3('4<'5P'6d'7x'8'9':';'<'='>('?<'@P'Ad'Bx'C'D'E'%'BOOK SELECTOR OKCancelMosesHistoryPoetryMajor PrMinor PrGospelsEpistlesAllOld TestNew TestClearGENEXDLEVNUMDEUJSHJDGRTH1SAM2SAM1KNG2KNG1CHR2CHREZRNEHESTJOBPSAPRVECLSNGISAJERLAMEZKDANHOSJOEAMOOBAJNHMICNAHHABZEPHAGZECMALMATMRKLUKJHNACTROM1COR2CORGALEPHPHLPCOL1THE2THE1TIM2TIMTITPHLMHEBJAM1PET2PET1JHN2JHN3JHNJUDREVBOOK SELECTOR OKCancelMosesHistoryPoetryMajor PrMinor PrGospelsEpistlesAllOld TestNew TestClearGENEXDLEVNUMDEUJSHJDGRTH1SAM2SAM1KNG2KNG1CHR2CHREZRNEHESTJOBPSAPRVECLSNGISAJERLAMEZKDANHOSJOEAMOOBAJNHMICNAHHABZEPHAGZECMALMATMRKLUKJHNACTROM1COR2CORGALEPHPHLPCOL1THE2THE1TIM2TIMTITPHLMHEBJAM1PET2PET1JHN2JHN3JHNJUDREVBOOK CHOOSERCancelGENEXDLEVNUMDEUJSHJDGRTH1SAM2SAM1KNG2KNG1CHR2CHREZRNEHESTJOBPSAPRVECLSNGISAJERLAMEZKDANHOSJOEAMOOBAJNHMICNAHHABZEPHAGZECMALMATMRKLUKJHNACTROM1COR2CORGALEPHPHLPCOL1THE2THE1TIM2TIMTITPHLMHEBJAM1PET2PET1JHN2JHN3JHNJUDREVBOOK CHOOSERCancelGENEXDLEVNUMDEUJSHJDGRTH1SAM2SAM1KNG2KNG1CHR2CHREZRNEHESTJOBPSAPRVECLSNGISAJERLAMEZKDANHOSJOEAMOOBAJNHMICNAHHABZEPHAGZECMALMATMRKLUKJHNACTROM1COR2CORGALEPHPHLPCOL1THE2THE1TIM2TIMTITPHLMHEBJAM1PET2PET1JHN2JHN3JHNJUDREV[1][Out of storage space...|Search is incomplete.][ OK ] ORDER FORM Use this form to order the most recent version of the concordance program and Bible texts. The program comes with a complete, printed manual. Send the completed form to: SpiritWare Fifteenth Aveue Bible Church 15211 15th Avenue NE Seattle, WA 98155 QTY DESCRIPTION DONATION* ___ Concordance program plus New International Version Bible**.......$40.00 ___ Concordance program plus NIV New Testament.......................$20.00 ___ Concordance program plus King James Version Bible**..............$30.00 ___ Concordance program plus King James New Testament................$15.00 ___ Concordance program plus NIV and KJV Bibles**....................$60.00 * SpiritWare is user-supported. If possible, please include at least the the requested donation to help cover our costs. The cost of the NIV texts includes a royalty that we must pay for each copy we distribute. ** To access the entire Bible at once, a hard disk must be used. Each version of the Bible requires 2.5M of disk space. Those with only a floppy disk drive can access Scripture in segments. The segments are: Genesis to Deuteronomy, Joshua to Esther, Job to Song of Solomon, Isaiah to Malachi, and Matthew to Revelation. ->PLEASE MAKE CHECKS PAYABLE TO FABC<- Name:_______________________________________________________________________ Organization:_______________________________________________________________ Address:____________________________________________________________________ City:_______________________________________________________________________ State:____ Zip:________ Computer: ___520 ___1040 ___Mega 2 ___Mega 4 Memory: ___512K ___1M ___2M ___2.5M ___4M Monitor: ___Monochrome ___Color Floppy Drive: ___Double-Sided ___Single-Sided Hard Drive: ___Yes ___No Printer: ________________________________________ Word Processing Programs: _______________________  @@@@@@@@@PPPPP@@@@@@@@@@@@@@@@@@    @Bad pointer in free. 2!2!2#You must compile with the -f option to include printf() floating pointCCAP????????????????????????(                                                                                                                                             & &  " n 6." ,  8*  2 2   0           "                                     .         & *8( R   0   0*         (  "    "(                     $6 $   ,8. * "        8                                 8                         (  $ 4L>J  *         $    4     P   "   4                                                        (       "           "                        2   4> 6  0 R        $.$    (         &    $ <   4     (   . (*\&(p 8 "04.0(D4$( (,  6            R,6$"0( 6 4*d Hv\ .(H> 4   B& *$ *.                 ,<         r*(        @J$  $,(FPBLD X(",p$  .6*" .J0.$nBF\ @$@ (  ."846 , 6&,$,&2> 06  , 00000000000000`0000`0000H000H`H0000`H000000000000000P 0B hX2mousex_nand_nmore_nt_free_fevent_sInOut_mousey_intin_hFlag_morewords_doSave_doGoToBookMark_#fputc_objc_change_rlimitD_tcWidth_bState_intout_wl_tNum_tlmalloc_^lSetInfo_YlWindow_menu_ienable_vmulctrl_cn_ message_strcpy_ tSlide_gdoOpen_R1clipOn_T/findD_main_TtNewLine_unVerses_form_do_findVerse_invertRect_t0errno_ʶ_fgetb_~printFlag_readBook_=tTop_wind_close_ʕturboParse_"_fgetc_`graf_mouse_ғlButton_$`doMenu_ _fpinit_2_dtefg_"drawInsertion_bMtimeFlag_doSearch_J&doDisplay_zptInRect_/_stropen_fnword_parseWords_write_\tString_tsWindow_form_alert_2graf_handle_Tobjc_draw_ΔtSetInfo_gtx_cW2_tWindow_kState_nBooks_m1Rect__stksize_atoi_Jty_v_pline_4scrnCoord_vString_form_dial_clp__Tmp_n_capFlag_sLines_ptsin_RdoCopy_F_getfhtype_crys_if_ptsout_Rwords_Randlist_zvq_mouse_rsButton_,Nv_clsvwk_findWords_|lastChap_input_saveName_clipboard_tButton_`bvs_clip_Xglobal_lVerse_LprintD_v_hide_c_sbrk_Dopen_~tChar_htwind_find_>printVerse__stderr_dTime_Nendlist_Rscrp_read_saveD__a_scanp_t_fp_menu_bookMark_VdoUpdate_$!loadSearch_8?checkAbort_._aliasfh__fopen_̥KJVInfo_Pinfile_\lArrow_*Zappl_write_malloc_Njunk_^foot_`lInfo_bgraf_mkstate_NIVInfo_4work_in_ڶfsel_input_ fprintf_ƟlBackInside_TadisplayD_dwork_out_rlRect_v_opnvwk_lDraw_tWexit__setfhtype_lldivcHeight_endtext_selVerses_list_zdoKey_\fclose_llremfindWord_8char_counter_~findPrevious_dflag_map_lastBook_startext_tArrow_hdoCut_FsearchI__fputb_findNext_0allCaps_lastL_screen_lastVPtr_tInfo_appl_init__fputc_z_stdin_control_int_in_invertSelected_usearchBook_sRect_ sDraw_Iv_gtext_environ_̶_stdout_int_out_crystal_Bfread_tRect_clearInsertion_MlrdivtDraw_fgsx1_0vdi_0quit_ضmainMap_wind_open_doBlink_0MclipOff_/lrremgsx2_0min_lscrnRect_wind_delete_"_ctype_ wStart_lHeight_sPivot_lastPrintD_text_cb_wind_create_redraw_0getVerse_rc_intersect_vldivزmax_Pappl_exit_evnt_dclick_0sprintf_ޟllmul\vlrem_dtoa_D_a_first_xstrncmp_.lCopy_`VlastSaveD_bookList_evnt_multi_Ttable_memerr_&Bfflush_dup_fgetc_sDrawLine_PJsLineN_key_words_dct_menu_bar_dsr__iovector_dClick_ sEnd_ rindex_lHilite_Xputs_vrdiv޲ctrl_cnts_ tolower_Tlastindex_clock_rvrrem$iioff_(displaySearchBooz+sIns0_m1InOut_memStart_lrmuldvsf_color__start_sIns1_saveDir_doAbout_,creat_ԮtCopy_fkjvD_toupper_i_ptr2_Xgetnum_sBuf_Zdfdb_8prn_*%sInvertText_>TdoPaste_Ggl_apid_vlmul_seterrno_|addr_in_nivD_a)AE^JPg6 Pg Pf 9Xg#bD3D3D `bJyDf@JygRJyg:,>X>t> >3Da`n: 9DfByDJyg 9&DfJyf?<NNTO#DJyE f(?</ 9bDfpByDA+a':A+a'2aX<am <pb|` <Am<PnA+a'a(<am <pb|` <Am<PnA-a&a<am <pb|` <Am<Pn>A+a&aJ@m|cn3 A+a&aJ@m|cn3 A, a&daH@By<1g<f3A,a&>>*>J>X>t>>> 9X>f>ByDJy gfJyDf\ yE g#>Daf>3DzK8a"k3E K*< a"abHyF?<NN\O?<%NNTOHyF/9DHya HyF/9D?<a Hz#8?<&NN\OBgaTOKEa `#>Daf3DzK8ka""kr3E KDza"KEz a"K*<}a"a". yDf6aKEaA"yD0<""""QHz"?<&NN\OKEaz?<*NATO8K$9|HS@HA8A:<Q0|a` -0f%RM, 190|HH|Pa2 | 0|| n ?<,NATO8|HHJ@f0< BF`| nBF`| g| <<a -0f| :0|Ha:0|Ha JFfI#}`I#y |:< QqBA"a JyDg3Da`anaByDA`pr#"HBQ|#A$QA5CC5fK#9a*#D#>*Daf`29E|gaf a*a`JyEg yEg3DaByD3DA29ESAp yE g6 CfX (OfP (LfH (Of@ (Rf8 ( f03D`( Mf" (Of (Nf (Of ( f`A R@QaDByEaA"a|aJyDfpa $g#D3D`Za ,J@jRJyDk8K* a3DEafA)a3DarByDa`Jyga` a3D3DaHByDByDJyDg@JyDgJyDf yE gz`ByD3Da6ByDJyDfK)SaJyDga|` xJyEg 3D`:09Dk3D3EaA)a3DaByDaA(ya(09E AC3vJg  g`.PREB#>*DzK36aj,A)pa?<NATOJygPJyDfFa` 3E KyBBBB *<?aJ(atB5@A2;"M0<fQ  nJ!  o  nJ!  oJ!,IaXJyrgA1C2f#>*Daf`afafA';a A>*CF*Daf`afafA%Na@A>*CF`J(@*L*9Daa(HyF?<ANA\OBgHyF?<*Da fda 29E|g a fa `JyEg>a AIaaDJyDf ag#D3D` aJ@ka3Da,ByDJyDfK"{aJyDga `JyEgA!a09E AC,Jg  g`.INFB#>*Da ft:<*yDajA"la4?<NATO`R3E *|*9DaaHz-?<ANA\OBgHz- ?<Da g#>Da f3DA)C*dfKa #D#>*Da LfV3Da P29E|g a Lfa :`JyEg(a \Aaa JyDf aFg#D3D` aNJ@ka63Da ByDKaJyDgaD`@JyDfdJyEgA6a(09E AC)vJg  g`.SYSB#>*DaTf^BE*yDa3E *|*9Da~aHz),?<ANA\OBgHz)?<D#D#=Dafa829E|g afa"`JyEfA'aa` yEgaaAaa ag#D3D`aJ@ga`ByDa JyDga`JyDg,JyDg yDgJyDgJyDg`&aTJyEgJA@aHByE#D yDJgI(L`I(Ba RDRyE09EyEfJyDgl za yE^g yE^gA4a`\za`Hz`zaVHz?<&NN\OJB B:.x xNAXaJyDgzXD`#>tD` #>DByDahg 3DNuJyDg A% a`Aa yE g<LfA` A`AaAaJyDgAyaag.JyDg A$aNuA:av yDalA7adNu:<*yDajJyDfAzaB?<NATONu3E *|*9Daa Hz&)?<ANA\OBgHz&?<<E}GCꃠHk GQ`DFRFGQef^Te R fBA "o0><TB@<< 2I2Id2Q`2Q2QAΑVHHLxNuHM8PJo(gXJf:?<NNTO-@ HzNBg?<NNPOo+o,-o.Hzd?<&NN\O`o+o,-o.J.f`8Jg4Hzl?<&NN\O?<2QA`CBA A,!Nu!p`A@C`><0QNuJx>f6@|A.JgI@K M"&zG ><BJg<bNNqNqNqNqNqNqNqNqNqNqNqNq0<NqQNqACE """"""""$$$$$$$$QACE """"""""$$$$$$$$ACEI뵠NqNq """"""""$$$$$$$$M"PQ-nFNuBE8<KE?*CF :f09E$G`G  o  o  gJ!p  oQB  o  n  oJ!Nup 9b 0eH"HЁ¼Ё`NuHTHrH H@0H@QLNuByrCr$IJg8 ;g2  o`BCRyr yrgJg  oJ& ;fJg  nJg  oJ&Nuf !\fJAE0fNuByEAE0Cr09rS@$H&I .g f ` .f *Xf3EpNuCQ .f (Xg3EpNup09E , . |pr &|BxCE m(gRҼ fR(Rм "Ҽ fNuCEI0K@4<QJyDgH "$$C`AC0<#QL`|?/ ?<=NAPOJ@Nu/ /?9E ?<?NA JNu/ /?9E ?<@NA JNu?9E ?<>NAXOJ@Nu/?< NA\ONuJyg Hz?< NN\O*809 Hڀag#D3Dp`bpA<?<B| |Nu*889 yE f`dڄag | f `|bNu?<?<NAXOJNuHz?<&NN\ONuJy f?<NATO#D3DpNuHz?<&NN\ONuJxDf A1D`ABxDa 8мfNu <"<DnNBNu[1][DESK MANAGER 3.2| | 1990 Charles F. Johnson |& Little Green Footballs| ][Proceed|Config|Bail][2][ Do you want to reset | the computer? | ][Cold|Warm| Don't! ]qwEqfY2 p DESK MANAGER 3.2 1990 Charles F. Johnson Y2O| ampmY3!KpY3:Y3!KY3=- Preset Files -Y3!JY3>- DESKTOP.INF -Y3!JY3=- AUTO Programs -Y3!JY3>- ASSIGN.SYS -Y3!JY3=- Accessories -Y4!JY45Arrow keys/Mouse: Move pointerY53Return/Left Button: Select filesY6=Clr Home: Clear all selectionsY75Esc/Right Button: Exit/Rename FilesY8,Backspace: Previous Screen / Help: Info / Undo: AbortY4!JY53Creating monochrome low res medium res DESKTOP.INF file. qwEqfY p Desk Manager 3.2 Initialization qY! JY'2Which drive holds the AUTO folder (pAq - pPq)?Y! JY'2Which drive holds the accessories (pAq - pPq)?Y! JY'-Number of seconds to hold startup pic (p0q - p99q) > Y! JY'6Timeout length (p0q - p99q) > Y! JY'8Pleasant bell sound (pYq / pNq)?Y! JY'*Cursor wrap-around at edges of selection screens? (pYq / pNq)?Y! JY';Default: pRqun or pBqypass?Y! JY'.Which key will you use to bypass/run Desk Manager? >Y! JY'-Exit if timeout expires on the preset screen (pYq / pNq)?Y! JY'2Write DESKTOP.INF to which drive (pAq - pPq)?Y! JY'/Write DESKTOP.INF even when bypassing? (pYq / pNq)?Y! JY',Desk Manager already uses the Help key to reconfigure!Y(:Press a key to continue.Y! JY'-Write the new configuration to DESKMG32.PRG (pYq / pNq)?Y! JY#1 AUTO Folder Drive: XY$1 Desk Accessory Drive: XY%1 Write DESKTOP.INF to: XY&1 Hold Picture for: XX secondsY'1 Timeout Length: XX secondsY(1 Pleasant Bell: XXXY)1 Cursor Wrap-Around: XXXY*1 Run/Bypass Key: Y+1 Default State: XXXXXXY,1 Exit on Preset Timeout: XXXY-1Always Write DESKTOP.INF: XXXY02Are these choices correct (pYq / pNq)?YesNo Run BypassY4!JError - is not present! Y1pdY Y4!JY4 JY5?Renaming...Y4 JY5;Creating ASSIGN.SYS...Y4 JY5;Creating DESKTOP.INF...Y4 JY5;Reading Preset File...Y4 JY5:Renaming AUTO programs...Y4 JY58Renaming desk accessories...YYY YpqefY3 JY5;pCan't find DESKMG32.PRG!qY71(Perhaps you renamed it? Or changed disks?) fY3 JY51p Error while attempting to write DESKTOP.INF! qfY3 JY51Not enough memory to copy Y3 JY51p Error: cannot open preset file! qfY3 JY59Continuing boot process... fY3 JY46You've changed a program that runsY56before Desk Manager. Type pCq for aY66cold boot, pWq for a warm boot, orY76any other key to exit normally.Y3 JY4!p F1 q Y5!p F2 q Y6!p F3 q Y7!p F4 q Y8!p F5 q Y4Ip F6 q Y5Ip F7 q Y6Ip F8 q Y7Ip F9 q Y8Ip F10 q Y3 JY4!p F11 q Y5!p F12 q Y6!p F13 q Y7!p F14 q Y8!p F15 q Y4Ip F16 q Y5Ip F17 q Y6Ip F18 q Y7Ip F19 q Y8Ip F20 q Y3 JY3*DESKMG32.PRG should be placed in the \AUTO folder of yourY4*bootup disk. Create a folder inside \AUTO named \DESKMGRY5*and place your configuration files, DESKTOP.INF files, andY6*ASSIGN.SYS files in it. (Be sure to read the documentationY7*for more details!)fY3 JY3.To display a startup picture in color, place aY4.Spectrum 512 picture in the \DESKMGR folder andY5.rename it to DESKMGR.SPC. In monochrome, place anY6.uncompressed DEGAS picture in \DESKMGR and renameY7.it to DESKMGR.PI3.Y3 JY30Type 'W' to toggle disk write verify on/off.Y40You can define the key which is used to bypassY50or run Desk Manager; type Help pbeforeq DeskY60Manager loads to reconfigure. Do pnotq renameY70(or "pack" or "squish") DESKMG32.PRG!Y3 JY34If you use and enjoy Desk Manager,Y44please send $15 (or more) to:Y68Charles F. JohnsonY78P.O. Box 1250Y88Pacific Palisades, CA 90272Y3 JY5=Write Verify: pONqY3 JY5=Write Verify: pOFFq p Desk Manager 3.2 q p by Charles F. Johnson q Writing  Unable to create DESKTOP.INF! \AUTO\DESKMG32.PRG*.SYS*.INF*.PRE; Desk Manager:Y49JNo accessories on drive X...X:\*.AC?X:\AUTO\*.PR?X:\AUTO\X:\ X:\AUTO\GDOS*.PRGX:\AUTO\G+PLUS*.PRGX:\AUTO\DESKMGR\X:\ASSIGN.SYSX:\AUTO\DESKMGR\LOWDESK.INFX:\AUTO\DESKMGR\MEDDESK.INFX:\AUTO\DESKMGR\HIGHDESK.INFX:\AUTO\DESKMGR\DESKMGR.SPCX:\AUTO\DESKMGR\DESKMGR.PI3X:\DESKTOP.INF.ACX.ACC.PRX.PRGJan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 55566?6o6667/7e7778%8U88895k556616a6667!7Q77788G8w889AAAAAAAAAAAAAAAAAABBBBB B B BBBBBBBBBB!B#B%B'B)B+B-B/B1B3B5B7B9B;BEBIBSBZBaBeBjBqBzBBBBBBBBCCC*C0CCCVCiC|CCCCCCCCCCCDDDD D DDD(D1D:DCDLDUD^Dh0. !"#$%&21/-, )+'(3459SaRGHPMKcdefJNqrpmnojklghi;<=>?@ABCDTUVWXYZ[\]ABCDEFGHIJKLMNOPQRSTUVWXYZ1234567890-=`\[];',./Space BarEscBackspaceDeleteReturnTabUndoInsertClr HomeUp ArrowDown ArrowRight ArrowLeft Arrow( [numeric keypad]) [numeric keypad]/ [numeric keypad]* [numeric keypad]- [numeric keypad]+ [numeric keypad]. [numeric keypad]Enter0 [numeric keypad]1 [numeric keypad]2 [numeric keypad]3 [numeric keypad]4 [numeric keypad]5 [numeric keypad]6 [numeric keypad]7 [numeric keypad]8 [numeric keypad]9 [numeric keypad]F1F2F3F4F5F6F7F8F9F10Shift F1Shift F2Shift F3Shift F4Shift F5Shift F6Shift F7Shift F8Shift F9Shift F10What?DE~E>E^EE4y  &$    2  800" (" 6T` &  ". 4  6>        ," ^& ,    &  ,  H 6  ,, .       , ,."   B>* .\b &  *$&",*    & T  Bn    (&  b8FHNd""CUAC0<!QL`|?/ ?<=NAPOJ@Nu/ /?9:?< DESK MANAGER 3.2 Copyright 1988, 1989, 1990 Charles F. Johnson and Little Green Footballs Software Revision: Tuesday, January 23, 1990 Desk Manager is a program that goes in the AUTO folder of your boot disk. It will automatically select the correct DESKTOP.INF file for your desired resolution, and allow you to choose which AUTO programs and desk accessories will load. In addition, if one of your AUTO programs is named GDOS*.PRG (the asterisk means "any characters"), Desk Manager will also let you choose the ASSIGN.SYS file which will be used with GDOS. And one of the nicest things about it - even though Desk Manager runs from the AUTO folder it still lets you use the mouse to select files! The original version of Desk Manager was published in ST-Log and only allowed the choice of desk accessories. The latest versions of Desk Manager have many significant improvements over the original. Up to 128 DESKTOP.INF files, AUTO programs, ASSIGN.SYS files, and desk accessories can be displayed and selected from. A "timeout" feature has been added, so that if you don't press a key for a configurable amount of time on any selection screen, Desk Manager continues to the next screen. You can abort the program without changing anything at any time, or back up to previous screens after exiting them. Desk Manager can display a startup picture during bootup before entering the selection screens, in either Spectrum 512 compressed (color) or DEGAS uncompressed (monochrome) format. A "Help" function is also added, to clear up any confusion about how to use Desk Manager. Desk Manager works on color, monochrome and extended resolution monitors, takes up very little disk space, and was written entirely in 68000 assembly language. *** NOTE: If you're already familiar with the basic operation of *** Desk Manager, you may want to skip ahead to the section at the *** end of this document titled "NEW STUFF." Copyright Information --------------------- Desk Manager (DESKMG32.PRG) and the documentation (DESKMG32.TXT) are: Copyright 1988, 1989, 1990 Charles F. Johnson and Little Green Footballs Software. All rights reserved. Desk Manager is distributed as SHAREWARE. This means that you are free (under the conditions explained below) to give copies of the program to friends, upload it to bulletin boards, etc. If you end up using the program, you are expected to become a registered user by sending a shareware payment of at least $15.00 to: Charles F. Johnson P.O. Box 1250 Pacific Palisades, CA 90272 Shareware can be a feasible alternative to the normal means of distribution; but it will only work if you do send in your registration fee. So if you'd like to see further updates to Desk Manager and other useful shareware programs, your support will make a difference! If you have suggestions for improving Desk Manager, your opinions will carry more weight if you're registered; I'll work to include any suggestions that seem useful. If you have an account on Delphi, GEnie, or Compuserve, please include your user name or ID number when registering - this is the easiest way for me to get in touch with you if I need to. If you'd like an acknowledgement that I've received your registration fee, please include a self-addressed stamped envelope along with your payment. If you also include a disk (and enough postage) I'll fill it up with the latest versions of all Little Green Footballs shareware products and mail it back to you. Desk Manager may be freely distributed as long as both of the above-mentioned files are included, and as long as neither file is altered in any way whatsoever. The program may NOT be sold or included with a commercial product without the express written consent of the author. Also, this documentation may not be reprinted without the express written consent of the author. Preparing to use Desk Manager ----------------------------- First, if there is no pre-existing AUTO folder on your boot disk, you must create one. You can do this from the desktop by opening a window on the drive containing your boot disk, and choosing "New Folder" from the "File" menu. Enter AUTO in the dialog box that appears, and press Return. The AUTO folder will be created. Now, copy DESKMG32.PRG into the AUTO folder. Do this by double-clicking on the folder name (or icon); this will open the folder. Then click and drag DESKMG32.PRG to the open AUTO window. For best results, DESKMG32.PRG should be as close to the first program in your AUTO folder as possible. Remember that AUTO programs run in the order in which they are written to the folder. If you already have programs in your AUTO folder, you may have to copy them all to another disk, delete them, and copy them back in the order you wish them to run, to ensure that DESKMG32.PRG runs first. NOTE: If your hard disk driver needs to run from the AUTO folder (it shouldn't if you are autobooting from the hard disk), the driver should be copied into the AUTO folder _before_ DESKMG32.PRG. IMPORTANT: Do NOT rename DESKMG32.PRG! The program writes configuration data to itself to avoid the need for a separate data file, and looks specifically for the filename DESKMG32.PRG. If you've given it a new name, the configuration option will not work (although the program itself will still run). Now, with the AUTO folder still open, create another new folder inside AUTO called DESKMGR. This folder-inside-a-folder will hold your DESKTOP.INF files and your ASSIGN.SYS files. Arrange your desktop the way you like it for each resolution and save it with the "Save Desktop" function in the "Options" menu. After saving your desktop, rename DESKTOP.INF to LOWDESK.INF, MEDDESK.INF, or HIGHDESK.INF, depending on the resolution. Then copy these .INF files to the DESKMGR folder inside AUTO. Now, whenever Desk Manager starts up, it will read the correct DESKTOP.INF file for the current resolution and copy it to the boot drive so GEM will find it when the desktop runs. To use the startup picture option, copy any Spectrum 512 compressed picture (*.SPC) to the DESKMGR folder and rename it to DESKMGR.SPC. Monochrome users should copy a DEGAS uncompressed picture (*.PI3) to the DESKMGR folder and rename it to DESKMGR.PI3. People with both monitors may have both DESKMGR.SPC and DESKMGR.PI3 in the DESKMGR folder. If you have any ASSIGN.SYS files (used by GDOS), rename them to something more descriptive (e.g. WORDUP.SYS, EASYDRAW.SYS, etc...as long as you keep the .SYS extension) and copy these files into the DESKMGR folder as well. (If you are using CodeHead Software's G+PLUS instead of GDOS, this option will still work.) You're now ready to go. Running Desk Manager -------------------- The first time you run Desk Manager, it will ask you "Which drive holds the AUTO programs?" and "Which drive holds the accessories?" You can type any letter from A to P for the AUTO programs, since some current hard disk drivers will let you boot from any drive; but you can only type 'A' or 'C' at the "accessories" prompt. (Floppy disk users will most likely type 'A', hard disk users will probably use 'C'.) After the "AUTO program" and "accessory" prompts Desk Manager will ask you, "Write DESKTOP.INF to which drive?" Type the letter (A through P) of the drive to which you wish to write the DESKTOP.INF file. This will usually (but not always) be the same as the drive from which your desk accessories run. Next, Desk Manager asks how many seconds to hold the startup picture. Type a number from 0 to 9 (0 means 'don't show the picture'). The next prompt asks you for a 'timeout length'. This is the number of seconds that Desk Manager will wait for input before proceeding automatically. After you answer this prompt, Desk Manager asks you whether you'd like to it to ring a bell when it's awaiting input (in case you have a habit of dozing off at the computer as you boot up). The next question you have to answer is "Default: Run or Bypass?" This is asking you whether you would like Desk Manager to go through its selection screens each time you boot up (unless you type the "Run/Bypass" key [see below] before Desk Manager runs), or to be bypassed (unless you type the "Run/Bypass" key). Desk Manager next asks you "Which key will you use to Run/Bypass Desk Manager?" At this prompt, you should type the key you wish to use to "invert" the normal operation of Desk Manager. In other words, if your copy of Desk Manager is set to "Run" and you do not want to see the selection screens at bootup, type the "Run/Bypass" key before Desk Manager runs (at bootup). If Desk Manager is set to "Bypass," you will not see the selection screens unless you type the "Run/Bypass" screen before Desk Manager runs. The last question you'll need to answer is, "Write DESKTOP.INF even when bypassing?" This lets you write the DESKTOP.INF file even if Desk Manager is set to bypass automatically unless Undo is pressed. This way, when you change monitors (if you're lucky enough to own both color and monochrome monitors), the desktop will still be set up correctly even if you don't actually run Desk Manager. At this point Desk Manager will show you a list of all the configuration choices you've made, and ask you "Are these choices correct?" Type Y to continue, or N to start the configuration process over if you've made a mistake. After you've answered all these questions and confirmed your choices, Desk Manager asks if you want to save this configuration. Type 'Y' to save, and all the choices you've just made will be written directly into the DESKMG32.PRG file itself, so you won't have to answer these questions again. Any other key continues without saving the configuration. REMEMBER: you can always reset your configuration data at any time by typing the Help key before Desk Manager runs. IMPORTANT NOTE: Do not rename the DESKMG32.PRG file or you will be unable to save your configuration! You will also be unable to save your configuration if you use a program like PACK or DC SQUISH on Desk Manager. (DESKMG32.PRG must be un-packed or un-squished before the configuration save feature will work again. Desk Manager is so small anyway that it doesn't really make sense to Pack it.) Desk Manager will now attempt to read LOWDESK.INF, MEDDESK.INF, or HIGHDESK.INF (depending on the current res) from the \AUTO\DESKMGR folder and write it to the main directory of the boot drive as DESKTOP.INF. If Desk Manager is unable to find one of these three default .INF files when it runs, the first selection screen will be for the DESKTOP.INF file. All files in \AUTO\DESKMGR with an extension of .INF will be displayed and you may choose one in the manner described in the next paragraph. When you select an .INF file, it will be immediately read into memory and re-written to the main directory of your boot disk as DESKTOP.INF. Desk Manager will then proceed to the AUTO Program selection screen. In the AUTO selection screen, Desk Manager reads the names of all files with an extension of .PR? ('?' means 'any character') in your AUTO folder and displays them in the upper half of the screen. These are all your AUTO programs, which will be automatically executed when you boot your computer if their extensions are '.PRG'. When Desk Manager is ready to accept input, you'll hear a bell tone and see an arrow pointer resting on the first name in the upper left; you can move this pointer around with the arrow keys or the mouse. Type Return or press the left mouse button to select and de-select files, and type Esc or press the right mouse button to continue to the next screen. If you don't type anything for about 2.5 seconds following the bell, Desk Manager will continue to the next screen. (This "timeout" feature is active in all the Desk Manager selection screens.) Typing any key will cause the timeout feature to be deactivated for the current screen. If Desk Manager finds a file named GDOS*.PRG in your AUTO folder after processing the AUTO programs, you will then see a list of all the ASSIGN.SYS files which you've copied into the \AUTO\DESKMGR folder. Move the pointer among the names and select one by typing Return or pressing the left mouse button. The chosen file will then be read into memory and immediately written out to the main directory of your boot disk as ASSIGN.SYS. If Desk Manager does not find a GDOS*.PRG file in the AUTO folder the ASSIGN.SYS selection screen will be bypassed. The last selection screen displays the desk accessories in the main directory of your boot disk. All files with an extension of .AC? will be shown sorted alphabetically, to a maximum of 128. The selection procedure works just as with the other screens, with the keyboard or mouse. Since the desktop allows a maximum of six desk accessories, you may only select six filenames on this screen. If you try to select more than six, you'll hear a bell to alert you that you've reached the limit. While in the ASSIGN.SYS or Desk Accessory selection screens, you may return to any previous screen by typing the Backspace key. If you type Backspace while on the AUTO Programs screen, you will enter the DESKTOP.INF selection screen, even if one of the default .INF files has already been installed. On any screen the Help key will display a brief explanation of how to set up and use Desk Manager, and the Undo key will immediately quit the program, without changing any filenames on the current screen. Also on any screen, you may type the 'W' key to turn disk write verify on and off. In the AUTO and Desk Accessory selection screens, any programs or accessories that are already active will be shown in inverse. Therefore, to go to the next screen without changing the current setup all you have to do is hit the Esc key (or wait for the timeout). In either of these screens, typing Clr Home will de-select all files and let you start with a clean slate. When you use a color monitor, Desk Manager will default to using the medium resolution DESKTOP.INF file, MEDDESK.INF. If you wish to boot into low resolution (using LOWDESK.INF), type 'L' any time before Desk Manager runs. If you wish to bypass Desk Manager entirely, type Undo any time before the program runs. To reconfigure Desk Manager to use different drives for AUTO programs and accessories (like you do the first time it runs) type Help before the program runs. You may notice that the desk accessory filenames are alphabetized, while the AUTO programs are not. There's a reason behind this seeming inconsistency. The order in which desk accessories load is rarely very important; in fact, the GEM desktop seems to have its own way of ordering the accessories, regardless of the order in which they actually load. Therefore, Desk Manager sorts the accessory names alphabetically to make it a bit easier to find a particular accessory in a screen full of names. However, the order of the AUTO program names on the Desk Manager screen is the same as the order in which they will run. Many times, the order of the AUTO programs is important; for example, if you use a reset-proof RAMdisk, you'll probably want it to run before anything else (even Desk Manager) because most such RAMdisks employ a "double-boot" procedure. As a consequence, any programs copied into the AUTO folder before the RAMdisk will run twice. Also, many AUTO programs are picky about the order in which they run, especially if they do any fooling around with system vectors or other tricky stuff. The problem is, there's really no way to tell from the desktop in what order the AUTO programs will run. None of the "View" options will show you which programs were copied into \AUTO first. Desk Manager shows the true arrangement of the AUTO folder programs, and can also help you to diagnose incompatibilities between various programs. Running Desk Manager from the GEM Desktop ----------------------------------------- When you double-click Desk Manager from the GEM desktop to run it, an alert box will appear, asking if you want to reinitialize the AUTO folder programs. If you answer 'Yes', then after running, Desk Manager will perform a warm start (equivalent to pressing the reset button) so that the programs in your AUTO folder can reload. If you answer 'No' to this prompt, Desk Manager will give you the option of reinitializing your desk accessories without actually rebooting your system, through the use of a poorly- documented GEM call (shel_write). But there's a drawback to using this feature -- sometimes it will work, other times it will crash. Unfortunately, this is due to problems in the shel_write call itself and there's nothing Desk Manager can do to fix it...so use this feature at your own risk! Caveats ------- My lawyer (if I had one) would probably want me to say that I cannot be responsible for any damages caused by the use or misuse of Desk Manager. The responsibility for operation of the program is assumed entirely by the user, and no guarantees of any kind are made as to its usefulness for a particular purpose. With that out of the way, let me just say that in three years of use Desk Manager has never caused damage to any disk to my knowledge. *** NOTE: One thing to keep in mind is that Desk Manager works by *** renaming AUTO programs and accessories. (It does NOT leave *** behind any resident code when it runs...after it's finished, *** it's gone from your memory.) Be CAREFUL not to hit the reset *** button while the "Renaming..." or "Creating..." messages are *** on the screen; you could destroy a disk's directory if you do *** it at the wrong second. (This is not a problem with Desk *** Manager; the same is true of hitting reset while writing *** anything to a disk at any time!) If you already have more than six accessories on your boot disk with extensions of .ACC, it may be a good idea to rename the ones you aren't using with an extension of .ACX before you run Desk Manager for the first time. If you have a suggestion for Desk Manager, you may write to the address listed above. If you have a question about its use, the fastest way to reach me is to leave Email on Delphi, Compuserve, or GEnie to: GEnie - C.F.JOHNSON Compuserve - 76004,2232 Delphi - CFJ ************************** NEW STUFF ****************************** DESK MANAGER 3.0! ----------------- Desk Manager 3.0 contains a major new feature: you can create "preset files" which will set up your entire system with one keypress or mouse click! These preset files contain all the information that Desk Manager needs to select your DESKTOP.INF file, AUTO programs, ASSIGN.SYS file, desk accessories, and ANY other "custom" files you designate. The "custom" files can be copied from one place to another or simply renamed in place, letting you use Desk Manager to select configuration files for any type of AUTO program or desk accessory (as one example) if you wish. When Desk Manager runs, it looks in the \AUTO\DESKMGR folder for files with an extension of .PRE. This is the extension used by Desk Manager to denote its preset files; any .PRE files in the \AUTO\DESKMGR folder will be sorted alphabetically and displayed in a selection screen. If preset files are found, they will be the first thing Desk Manager displays, before any other file types. Preset files can have an optional 32-character title that will appear at the bottom of the Desk Manager selection screen as you move the cursor through the list. NOTE: Make sure you've read and understood the instructions in "Preparing to Use Desk Manager" before attempting to set up and use preset files! The Desk Manager Preset File Creator ------------------------------------ A separate utility program is included to help you create preset files for Desk Manager -- DMPRESET.PRG. The Preset File Creator contains on-screen documentation explaining how to use it; just run the program and follow the prompts. Preset File Format ------------------ Preset files are ordinary plain-vanilla ASCII text files, with each line terminated by a carriage return/line feed combination. You can create and edit these files with any word processor or text editor, as long as it has the ability to "Save as ASCII" or print to disk. (The included Preset File Creator does not edit existing preset files; it only creates new ones.) An example preset file might look like this: ------------------------------------------------------------------ ; Desk Manager: My Basic Setup ; DESKTOP.INF File HIGHDESK.INF ; AUTO Programs G+PLUS.PRG HOTWIRE.PRG LGSELECT.PRG MACUTLT2.PRG PINHED14.PRG SPOOLER.PRG TEMPL112.PRG ; ASSIGN.SYS File PSCAPT.SYS ; Desk Accessories MULTDESK.ACC ; Custom Files C C:\AUTO\DESKMGR\RAMDISK.CCP C:\CODE_RAM.CCP C C:\AUTO\DESKMGR\BIGMONTR.MLT C:\MULTDESK.MLT R C:\AUTO\DESKMGR\DESKMGR.PI3 C:\AUTO\DESKMGR\DESKMGR.PIX ------------------------------------------------------------------ Each line in the preset file must start flush with the left margin. The first line in the preset file must start with the text "; Desk Manager:" (excluding the quotes of course). Desk Manager checks this first line to make sure the file you select is a real Desk Manager preset file. Anything following the colon at the end of "Desk Manager:" is taken as the title for that preset file, and will be displayed when Desk Manager shows the preset file selection screen. You should use the title for a descriptive comment about the purpose of the preset file. (An eight-character filename just isn't enough for this, most of the time.) In our example, the first line is followed by a blank line. The blank line is optional. Each group of filenames in the preset file must be preceded by a line which starts with a semicolon. The text following the semicolon does not matter, but I'd suggest you use the comments in the example preset file (or something like them), just so you know the purpose of each group of files. If the line following the comment line is blank, NO files in that group will be selected. The next two lines designate the name of the file which will be copied to the name DESKTOP.INF when Desk Manager executes the preset file. This file should be located in the \AUTO\DESKMGR folder (see "Preparing to Use Desk Manager" above.) The next section of the preset file contains the names of the AUTO programs you wish to have renamed to .PRG when this preset file is executed. All AUTO programs that are not listed in this section will be renamed to .PRX, which causes the system to ignore them during bootup. There may be up to 128 filenames in this list. Following the list of AUTO programs is the name of the file which will be copied to ASSIGN.SYS. This file, like the .INF file, should be located in the \AUTO\DESKMGR folder. Next is the list of desk accessories that Desk Manager will rename to .ACC when the preset file is executed. Any files not listed here will be renamed to .ACX, so the system will ignore them during bootup. The last section of the preset file contains the list of "custom files". Custom files can be either copied from one location to another, or renamed where they are. The first character of each custom file line denotes which action will take place when Desk Manager executes the preset file; if the first character is "C" the file will be copied from the first name to the second. If the first character is "R" the file will be renamed from the first name to the second. (NOTE: If you choose to rename a file, the two filenames must be located on the same drive. They may however, be in different directories on that drive; GEMDOS performs a 'Move' operation if a file is renamed from one directory to another on the same drive.) Option to Reboot If Files Before DESKMG30 are Changed ----------------------------------------------------- Desk Manager 3.0 now detects if you've changed the status of an AUTO program that runs before it, and gives you the option of doing a warm or cold boot if you have. Running Desk Manager from the Desktop or a Shell ------------------------------------------------ In Desk Manager 3.0, I've removed the option which allowed you to reinitialize the desk accessories without actually rebooting the system, because it was just too unreliable and because I don't think anyone was actually using it. Now, when you run Desk Manager after bootup either from the GEM desktop or from a shell program such as CodeHead Software's "HotWire", you'll see an alert box which gives you the option to either run Desk Manager as is, or reconfigure Desk Manager by answering the series of questions again. (See "Running Desk Manager" above.) When Desk Manager is finished, it will put up another alert box asking if you wish to reboot the system, and giving you the option of doing either a warm or cold boot. (NOTE: a "warm" boot is the equivalent of pressing the reset button on the back of your ST, while a "cold" boot is the equivalent of turning your computer off and on again. A cold boot will wipe out any reset-proof ramdisks etc. that you may have installed.) ******************************************************************* DESK MANAGER 3.1 ---------------- Version 3.1 of Desk Manager follows quickly on the heels of version 3.0, to fix a bug which caused preset files to work incorrectly if there were no accessories listed. You can now leave any of the fields in a preset file blank, and Desk Manager will either not copy any files (in the case of the DESKTOP.INF and ASSIGN.SYS files) or rename all the files to .??X (in the case of AUTO programs and desk accessories). Desk Manager 3.1 also includes a slightly revised version of the DMPRESET Preset File Creator, that allows you to leave the DESKTOP.INF entry blank. (The version supplied with Desk Manager 3.0 would not proceed unless you selected a DESKTOP.INF file.) ******************************************************************* DESK MANAGER 3.2 ---------------- Timeout Values Up to 99 Seconds ------------------------------- When configuring Desk Manager 3.2, you will be allowed to enter a timeout value up to 99 seconds in length, for either the picture display time or the selection screen timeout. Previous versions of Desk Manager limited you to a maximum of 9 seconds. Cursor Wrap-Around Option ------------------------- Desk Manager 3.2 allows you to specify whether you wish the cursor to "wrap around" when it reaches the edges of the selection screens. This is one of the questions you'll be asked during the Desk Manager configuration process (see "Running Desk Manager" above.) Exit From Preset Selection Screen --------------------------------- When configuring Desk Manager 3.2, you will be given the choice of exiting from the preset selection screen when the timeout expires, without having to go through the individual screens for INF files, AUTO programs, SYS files, and desk accessories. If you don't type a key or move the mouse before the timeout expires, Desk Manager will install the default preset file for the current resolution (if one exists - see below) and exit. Default Preset Files -------------------- Desk Manager 3.2 lets you install separate default preset files for either color or monochrome systems. (If you have both color and mono monitors, this lets you switch between them very easily.) When Desk Manager 3.2 runs, it searches the \AUTO\DESKMGR folder for files called either MONO.PRE or COLOR.PRE, and will automatically install the correct one for the current monitor. Even if you don't have both monitors, you can still use this feature to set up a default preset configuration. If you "Bypass" Desk Manager, the default preset file will not be installed. (I figure if you say "bypass" you mean "bypass".) Assign Preset Files to Function Keys ------------------------------------ Desk Manager 3.2 now lets you call up any preset file directly, simply by typing a function key of your choice. 20 function key combinations are supported; F1 through F10 and Shift-F1 through Shift-F10. The new Preset File Editor (see below) lets you insert and change function key assignments in your existing preset files. Display Function Key Assignments -------------------------------- If you type the Help key while Desk Manager is displaying the preset selection screen, the function key assignments for all preset files will be shown at the bottom of the screen. While the function key help menu is shown, you may type any of the assigned function keys to immediately select that preset file. Any other key will return to the main Desk Manager selection screen. NEW PRESET FILE EDITOR! ----------------------- The Desk Manager Preset File Creator has been greatly revised and (hopefully) improved, and as a result is now called the Desk Manager Preset File EDITOR. The Preset Editor not only lets you create new preset files; you can also edit your existing preset files, using a series of selection screens and commands very similar to those in Desk Manager itself, and even insert or delete entries in more than one preset file at a time. The operation of the Desk Manager Preset File Editor is self-explanatory; there are on-screen prompts and help messages at every step, and the program is menu-driven. If there's a big hue-and-cry for it, I'll write documentation for the Preset Editor -- but it really shouldn't be necessary. Try it and let me know your opinion, on Genie or Compuserve. A couple of things about the Preset Editor do need to be documented, however. First and foremost: before using the Desk Manager Preset File Editor, be sure to set things up according to the instructions in "Preparing to Use Desk Manager" (above). Any DESKTOP.INF and ASSIGN.SYS files you want to choose from should already have been copied into the \AUTO\DESKMGR folder, any AUTO programs should be in the \AUTO folder, and any desk accessories should be in the root directory of the drive you're using. Note that one of the selections in the Preset Editor's main menu is titled "Prompt For New Name". If you click on this entry it toggles between "YES" and "NO". If this entry says "YES", then when you choose to insert or deletre entries in one or more preset files, the Preset Editor will prompt you (with the file selector) for the name for each file as it modifies them. This allows you to save the preset file under a new name, for example, if you've changed just a few entries and wish to keep the original preset file. If "Prompt For New Name" says "NO", then you will not be warned after selecting the preset file(s) to modify; the Preset Editor will just go ahead and modify the files where they are. ******************************************************************* .0, I've removed the option which allowed you to reinitialize the desk accessories without actuall`y |y"|h0<2<5# QQ3 N` Efv*oM" m !HPHUBg?<JNA(m)m - :gS)@ #OK1PC#HN߾HxHNA@)@l/h&@XЬld/`ARCpr Ѝ"QHNFALNHz2& NA\pdAxr0XQ)K\NN .$4JrBjNu~~&NN\N^CAp$L xp NJ9lrBlJpNNpM@Hr 0 0tr 9lNupealp`aJ BWNANC2 @p2rҌ0<NB0,rNurA9A `v C9Crtd 9A9BrrҌpsNu9@`rDNuC2 @ e}bvvr,vNu   +Uw!pa4|a@:>< |a6RGk0Gg`a(VfA1G<ap?^NM& u??< NMXVHn 2$4BBNuAd RdQRB BbABJk 0NuJBjBBXNu 0+2$NuE`B<gJEgEjCDEDF Fe( dF8BCHC`0bHC8v` HD8HDkDуb NuDdDA@kgAр[SBk0ZlJBk&Nu0g H@rB Jk`0 pʠ2HPAJgPpr$< _8 Nu&8*"JBgJjEB:HC҅H@|ۆ҄ۆ<HC>H@4 HA@B@H@хk H8SÀbNpNuú&EBQ*HE?<>0rHGG GGdSW°i\N SW2 H@D?<,>CEdH@``0VBTD &AdRfB|=|  g+g -f.g20 b0e9b . da`RF`fajSEgefX0e9oSH0| &Hz1 E Do`HJjDDDS4</NJFkSFk&aQ `Ha"FFL8Nn6.JgtBnС<r,k4< pAC v r Jjv-|v k>aaNRFBd?<2SFegdRB`ApdR e <rRF&0žxfEv+0JFjDFjHƌd0BFHF HFA]`2:HQ A dG  GbFG 0dFGHANu~6C 0 C/jC@j jr0H@{0DH@Nur Nu{0NutRj(:,af AfBfNu&<|,A,` FJ@kƁ%2(g"P@g2RADAH""l`r2oZe 1@#)I`NukNup V6dpAtrdJhk\Qpa H ld$"Hg0 k&@ S`#&@0+S@H3 0&fLNu JgJgN$H@B pTA Nu.N$L $BS@kH22Cd"X0Pg" $D#NujJ@gpNu _0Hp p"_0HqE eHHQ0)8$_$ZR`n$Y0gHR@@"D%$b2g# %>$ $dP.gRG,D% Y2.!p4Ae4v`VfAWHVUSRTg \ 1 Id*dE$RRb"8*$R`"2 A IJAfr4 Ae*RBBc0*SA?` p`(* 0iZ 4R$DDa " IHPg"B  g &gN߁4t BNu4Rptr ae OgTXgjHgSRBFb$0k c_ b退`tSkNb  fрd`2p <0ƣP 0g< @g4:8g* `b.&PSD` 0$C$RQCpp NT,* & (6"Sj|AcJ@fCAHPBHQ?NA\ _JjP Nu?r`??,J$F Z268SDĒDcCc2F0`(Hpx$ ld$l`"Hg8" &Ak eѐ S` "" k#&A 2+SAI3 Q: &f)I`LHRp` JQfpZNq Y QfdЀЀ 0N Ѐ$_&փփ!8NN( if"QHRN>~Nq8DRzXEEg"7PR$HBJBgp@JgJr gp`eetЂ`"ЀeЁdp` e$W.H@@/\NN N6L"2`+qR YEjrd0` SjN YQf "_Nq*e*<bІSGfN~$_N ЈN" KCP`e 6d rlj rd 3## # # # # # # # B`2# # # # # # # # # # # # # # # # # # # # # # # # # \Nu2"""z""z""""z0""""""""""""""""""""""""z?k?<M"UAf f H@NuDW'NMXNuPj0,lf$J,nk l*fp?Np 9|nNvA2jk 0"fZRAR@g  f`g,f9@lTll`B A"H""A4`Q"AA 0! NuS@gfRlfQ6`<,*?Hj\F FfN`Hz`<:a@Cg* gjf,f ,8f ("fCg< H9_(NuJjHP??”X _Jk"NuHPHx?NAP SfNN p2,rR@RASA,+p9ArNu9@pN4, 6fprta0,2,NuA9@9Ap rt`bf`pp9| f|9Fd@hD^`b~`$aJf,H@KgMgPHfBSGj>RGFc8>`4 g6¾0g`gTelhgFf2pRGRF`a,` `?~p p ' 0NuCpE`bf`FgRGJGgRSGSFYNua@6 gH@lfa(@ fzaL b @ Ee0.* Nur9A(HLNuB^B`^zEfpaRppaN Eg0Pa a4RE`p a2a*(|deS@f lbfSlpTapqr`p`"p`tdbDA0kg<<R@f|0HN*JFk*HQ/XfbENkp`p`\F( &I.` 8:[j E&Dk p kfpfdffoH?BBNA.,¤ *kBg?/~NuNV` )H9@Jp4JP'J&f H LNu &NuQ` J,'f&g A#ȇeC! B-W)K20, 8k8gJl* g"P 8 @/ Nf  8fQg B <``L@ H)l26)z @WJf`CfSHj-D@Hd0H `\@a" pNNN4HP~ NA\ H@aa/a a h!9c^Nu| PC>$Error # ][Abort]ä&\f.B &lX)K\)l8` lp ,BQ|(VYp-KNu"l`Yd&N6ep&#k"C"Cփk 2##`1"`2`& $Y8gHRDD*D%H8#$c2g# %H`pQz &&| >tepZtC ҳfHP0(J $W$RR@H`2 "H _$0dd" $X&0BP6Y Hg R@@zEeHQ0)$_$Nu$Y 0P1@,NVeT p HPp "_NC큀pqwHPA8 P Desk Manager Preset File Edit b>Hmt Copyright P®8D @ 1990 Charles F. Johnson & LittSGreen Footballs SoftwareT`pYes?< NNX+@bNNT -JgN'*Hx`Theҷ| ɵdoesn't| work in low ! Bail r"_ N~6N4Nv렬( prN\"0% Which drive holds your AUTO fer? kANfDCrᢣpJ"* Accessories? ~n~ r ,D:Dr0y4Ђ4h H <r$4 L8NN",L,LXMaMenubB@ 1. Create New8 N$<2.R Existing  3. Displays 4.int 5. Insert an Ent 6(ele7(omptrLNamp Z8hange+s\ 9. Qu $"-"pފz  +| A"NfDp1 pJBgp/9$fN-V,pDCt:> NHL8N +@ -THPHxr (N&<+x*<&tp5&JB0J2¸rºFpJjR/"pwhich type of e?? qp7d.d(H<,2x2Pp Select the .INF file to i.Ɂ>r` :\AUTO\DESKMGR\*ឃHPA( CX6Jg0<~JBRZSXBPd >V pAV  Nr$NC V|:`NqNq,Z1ƅ 26jBrZLrNlbhvRzpPHPH; Desk Manager:48;HPp _h+@Rr,T T/p""h(>NqJľDp2p6 f program(s)  *.PR?34,̠(6ᦿ$Xڢ$6:4/-XN$RHȁ\<4f6f(nnn6֟nn6̛n~PPpާVZZP T/p""j$&Tj<3:  .SYS file   DESKMGR\*t( C<67,҃~+|JBRZ8.2V AVC R|:`t2Z8 "$6j怼rbh0rVVNbhJnzp6PHPP; Desk Manager:4T̂+@RzBr<@2V:(ÖhNqĂDp4p? prN\dN"P) Select the d>acc(s) to insert. ᢂ`f>`\n :\*.AC?z(d:6J0; ރ~JBRZ<2̀6ᦟXڂ6 &T>(.dNqDp5CHx )' Select the custom | file(s) to insert.  OK  Nr8?CC*C CŐBԧJ; C$F&sߔp t⟌`N d,,,,,BpJ,pr\j!"P Select the preset f' whose function key you wish to change.f݀lf`\j:\AUTO\DESKMGR\*.PRE( C.f -6D.0~+| JBRjᲿdΡJC S|E  4|ဠ~88 0 Reading: BpIԢ\8p/p"Rdzd4RpJPHP; Desk Manager:⸨rd FKEYErN. 2JFX "Currentc: F :p _hR+@⺀Noneᾢ|K Typenew(F1rough Shift-F10) forisnow.u7 (Ps any oreimoulbutt{abort.)hẤ&̅zlpDDU&V (AV C NM|:`NqNq,ZMD$膔ҁ bTrVVNbh~p"PHPP; sk Manager:4@phN`>:.`drHPH@4pVpZ4(Oz6࢜$NqDp2VT&pr\:"P Select the AUTO program(s) to dte.ᢂ|f`\ :\\*.PR?(6JP☀~ԃ~nJBRZP̀6ᦟXڂ6C Q8/-N$RHNqNq<QVF$@6(JrJJrJrldbhppPHP~; Desk Manager:4"Hn` pJBgp/*HPp;&RŸnSx0HPp.^dŨH–˂S*TޥSn$gVdp4(T DNqR*Dp3HVXpr\v;"P Select the .SYS file to insert.f݀x`\ :\AUTO\DESKMGR\*(,RC `6ŐU6,̃ ~VJBRZ"Uj2>V AVlCV |:`NqNq2DV* "ƅPX6jhrbh0hrVVrbhvWnpP; Desk Manager:48W֢̏hHr,:W\ҟ dhacc(s)dten:'AC?&&Y&&YD̠6ᦿXڢ64Y/-RN$RLȁV<ʙ`\ғ`,```\``\`V4nR pJBgp/*HPp;[JpnB`d߰İHPp.^dŔH‚n&Tޥ\` WHƚV$gRm@@p4(b\ hlNqDp5$2hСpr\R9"P Select the preset file from which you wish to dte custs.f݀ģT`\ :\AUTO\DESKMGR\*.PREDz(Ʋ.C(6l],Lj~2JBRj>@ᲿdΤ@C NS|^ $|+@‡j~Nq 8pId8rС/p"Rzᄣzp8; Desk Manager:⸨Ƅ6p6RP:;r: _bh4NqNqJB+m6 < <Ѝ  _ѐ+mpH R""6/fh $VHg XzaTP\Pdd/-lfN$~rLp d߾V/""ǒT@ JnbJ SaV,x.DT`Hxڀ3S Left-click the custom| files to remove. Right- | o proceed, Undo|abort.4 OK| Cancel 4J X6 SgA`fZ6b\DPZR8dHHj:..dt@nlp\&`x*`dƀxxl|JJpp.Rrn\*0JfU,&~C>aZ$gZ6eLjzr$PCzdBt6tt"e|ǦHPɢ–0TRT88f"4Ҡ&p228p"-b\b,fVR/"&&Dp"N,x T`vNqHm :\AUTO\DESKMGR\*.PRErk Save PresetO( File As:Nrfp0,&x* RpJBgp/pr$øh<rN`Z0 Writing: 4ÔbhfhpOH8rp숥4p@  Hx2 This p does not | contain any custom| fs!HPÐ Cancel h +@|Dp6mfpr<\``"P Select theYx! whose function key you wish to dte.‚TT\^ CᲀJ68i,Lj~JBRjV>BᲡRH Nr$NLd΁2 C NS|j  4$|+@:~88Read:^pI/p"R\>zpBP\; Desk Manager:⸨|RrFKEYlrN.. "Currentl: F -뚄fW AreOsuwa| D |assignmfrntC?  YV|]4\6n6lH:Àp _hR/r""Pr/-rLN$&(l‚LR7 T7 no eda !? Oh! \~ttp7No >pxr p\p,ppn<pr\pށpJĢ'T9l Dovreallyo nquit?4 nN4(HHZ3Z pJBgp/4$6r622p벂P Choosisplay/print... <r`Hm :\AUTO\DESKMGR\*.PREHPA(A C -6Jp,~ +|JBRZrll 6NH < r$<LV >C ^6p4|ဂN :`~Nq886$bhpI8pp®N\z>뾭tq~p pxZgqpQ4T+mf06rjJft0U4N4P&:x*:>\H`€T2^ edit  s^tv 0 Opening: :ጃ`bhpIrЁxܤrp,PHP; Desk Manager:⾨XBBr FKEYvrN."Current Function Key: -֥v\None~"dF\"途p:^pHx o you wishchange | thisq's| f8key?e  Yes |NoX Nԡ`wP@<0l z*ʘ r \p6pJNew̚X^@wϐǜp ~뾃$&R:š~: _hJf(RHmp"ԥp JgR0Title: 4xZ 4t?znnB $. %Enter a  for~ > 430E -------- 32!racs-|`&âPLłä  o&ndmaximum!Please try again...tĴ OK ζn$g: Reading: Z8p"``pp/*n;n${,ʦ{2Ԡ \RrpAr4 DzDVHg X/-8$d:`NqNq^߰߰Ͱ|Vİ2߰|İư|Rm~ ߠߠӠ}TĠĠz\ˆzNqXx~N}ռg`*lpP""Prz zdNH <r$<LFVV""ĀĘNqpN4B+mͦ(` :\AUTO\DESKMGR\*.INFHP(jjX,LBf,Cp.ņHmL6J,*J~+|JHR+|mRZS쀒P(H~@sTfɈJHx-„ Programs r &pr6\J$2 2*.PR?:ˬǬ`ɬšBV6SSIGN.SYS Fileऺ. @ F.. @ FDTPAINT ACCAF DTPAINT ASCWF GF`#N< _b ШNYNNuNuNVH|".$. &(*HDHEHABBمCمHABBBCHBHCԃԄ-A -BL>N^NuNVHx". $.bBCh8BAHA62HC6BAHA`B6HCBAHA8<㑲eRCQ-C -ALN^NuNVH(. ,. dF<gBEVBBGVB0G|b.f ؆dRE`kgb|HDkSEjؼdREBJfBEJEnB`|mpN(-D LN^Nu |oNNVH(. ,..HD:|glM||HF>|gXO||G|~mF H@HFB@H@2Ё"HAHFЁHD؀kSEؼdREJEk|m pN(B` -D LN^NuNVH(. ,..BGg^<BEgV<✚G|HF⌈0BDHD8 H@∀HDkSEؼdREJEk|m pN(B` -D LN^NuNVH .$ļfBJLN^NuNVH .g*2<bH@|bQAU-@LN^NuNVH .j g` BA<☒|lB`|DAlpN(⨰b-@LN^NuNqNqNqI* .E OBBB!<B*H$C! .HNACCXModula-2/ST (c) Copyright Modula 2 Software Ltd. 1985,1986,1987. (c) Copyright TDI Software Inc. 1985,1986,1987. NVps"9(NBN^NuNV333 3 3N^NuNNVI* #I* #I* # I* #$I* #,#0#4# 8#$r/./rNX-_/.NXfB:.EE=E-n N^Nu/./.NX-_-n=nn=n/e> n?@e/./33 3 33=|=|=|N :.RE=ENUY?.N>T/T/(n(N^Nu[0][ Not enough memory to | for that operation | ][ oh well... ]No Font HereNV?.?.?.N\U?<?<?<BgBgN$O =_(nHT(nHT(n HT(nHTN6O=nN^NuNV3Ă(n* #ĴU?<#?<?<?<BgN$O =_N^NuNV?.NA*-E N^NuNV?.?. NA*-E N^NuNV/./. ?.?.NA*-EN^NuNV/.?. NA*-EN^NuNV?./. ?.NA*-EN^NuNV?.?. /. ?.NA*-EN^NuNVY?<aTT*(n8N^NuNVY?</.a\-_N^NuNVY?</aT(n(N^NuNVY?<<(n* /?. aZP*(n8N^NuNVY?<=(n* /?. a2P*(n8N^NuNVY?<>?.aXJWDE N^NuNVY?<??.(n //.aO (n (N^NuNVY?<@?.(n //.aO (n (N^NuNVY?<A(n* /a\JWDEN^NuNVY?<B/.?.z. ?aO (n(N^NuNVJ. f(Y?<C(n* /?<(n?aRO -_N(Y?<C(n* /Bg(n?a,O *(n8N^NuNVY?<G(n * /?.aP-_N^NuNVY?<H/. a\(n(N^NuNVY?<I/.a\JWDE N^NuNVY?<N(n* /?. aP*(n8N^NuNVY?<VBg(n* /(n* /aO -_N^NuNVBy̸3̺/9̸?.<< B'?. (nHTarON^NuNVBy̸:.JElDE3̺/9̸?.<< Jn]D?. (nHTa&ON^NuNV(n Bn:.(n4P ae zb_DRn . f`(nBT .0e .9b`NBn(n: x.D0D(n8:.(n4P ae zb_DRn:.(nTc(n B(nBTB.N (n=T .0e .9b` . f&:.(n4P ae zb_DRn`J.g (n B(nBTN^NuNVBnz. N Rz-ERn:.IBPN2z-ERn:.IHPNz -EN N D(Rn/./.Nx.-_z cz0ڮ8.I@Nz7ڮ8.I@/./.NxX-_Jg`J.gRn:.I-P:.ndBnN:.n=EBn:.nd:.(nPN:.I8.&nP@SnRnJng`:.n b :.(nB4PN^NuNV*#̼* #* #N^NuNV(y̼&l 6 &l 7nHL`*=E N^Nu~BBBB~@@@@@@@@@@@@*Mt @.]p2L @"THp~@ /^ErA@!0:| xtjeBAX@}~C yq18Ֆզնշo7 0 ( , *i*Y*I*H@ >AA`>Xj2>cAAAc>@P8 @ .LdLd. @3~3 'XX' h`  `8DU@JUPZ]TZ[jTHDP8`8dRE*5@*%P"%D$(L08 @@@@@@@@@@@@0H x $(80`P Px 0 H  @ $0`p p@x>#03H# >x $(8 0`P PxpN*NV:.Mn b?<*<8`/N \NF:.Mn b?<*<8/N \N":.Mn b?<*<7/N \N^NupN*NV?<z/N \(nBTBgz/N \BN^NupN(pN*NV(m(l ?(mHl(mI* /N/(n:Hx8.6. HØ//N,X-_/.HxNxX*(n8/Hy:N,P/9z/??O N=n=n:9Jg`N^Nup N*NV?9\?<HnHnHnHnN OB.:9̔HŋJg|=|=|=yH:9HE=E=yJ:9JE=EBy0By2:92E=E:90E=E:92EE=E:90EE=E?9V?<HnI"* /I6* /NlORy2 y2fRy0 y0fvN:9Jg:9nf :9ng`N:9QE8.nSDEo4:9QE8.nSDEo:9^Eno:9^Eno`N8BnBn=|=|BnBn=|=|?9V?<HnIr* /IJ* /NlO:9PEHŋHE=E:9PEHŋHE=E:.E=E:.E=E?9V?<HnI6* /IJ* /NlOBn:9QE=EBn:9QE=E=|:9^E=E=|:9^E=E:9QEnl:.PEy=E=n:9QEnl:.PEy=E=n:9^E8.nSDEl":.ny^E=E:.nSE=E:9^E8.nSDEl":.ny^E=E:.nSE=ENJ.f,?9V?<HnIr* /I* /NlO?9V?<HnIJ* /I* /NlON=y=y:9Jg`:N^Nup>N*NV:.E?RE=EUY?.N>TY?.N>TNX/<@NXY/XNXY:.ME?N>TNX/TNX=_YNHxNx.*=EUY?.N>TYYY?.N>T/TYYY?.N>T/=y̐@IGz W?9\?<I* x?I* ?BgBgN jO B.o:.EM=EB.p:.HŋJg|p:.UE=EU?9V?<N(X=_U?9V:.EK2I?4PNHX=_U?9V?<NX=_U?9V:.EK2I8.D?LIDIP?4@HnHnHnHnN O=_U?9V?.NX=_U?9V:.MM?NX=_U?9V?<N bX=_Bn:.KIrB4PN=n>$=n@&?9V?.$?.&?<HnrN]HO UHnN!:X3?9V?.$?.&?<HnrN]HO :9Jg`N:.FHŋ Eg`N:.FHŋ Ef$Jno:.SE=E:.KIrB4PNP:.FHŋ EHfZJ.ofT|oIGz W?9\?<I* x?I* ?BgBgN jO N:.FHŋ EPfXJ.ogRB.oIGz W?9\?<I* x?I* ?BgBgN jO N~:.FHŋHE=E n g4J.og nl :.E=EJ.of no :.E=E:.H8.IIr@:.RE=E:.KIrB4P:.BHŋJf:.FHŋ Eg n}l`U?9V?<N bX=_:9RyNHxڄ89TyPH//N,X*څ-EJIɖ/ Y/.J/9|/9ƬHyưN0O*(_(:9RSE9E:9TSE9E:,EM9EBl 9| BlBlzɖg`NHnHnN,P/9z/??.@?<HnrN]HO N[?9V?<Hn^I* /Iɖ* /NlO?9V?<HnNI* /I* /NlO:.MMJg:.MMJg`N6J.pgdN\N[?9V?<Hn^I* /Iɖ* /NlO?9V?<HnNI* /I* /NlO?9V?.>?.@?<HnrN]HO ?9V?< HnNI* /I* /NlON[F/.z/?O N^Nup N*NV/-+N=y̎=y̐=y̎=y̐?9V:.EMM?:.E?MM?N x\U?9V:.E?N X=_U?9V?<N X=_?9V?9N XU?9V:.MM?N @X=_U?9V?<N bX=_NNlNN:9nf :9ng`NNNl=y=y:.MMJfN:9Jg@U?9V:.EMRE?N bX=_NlU?9V?<N bX=_NlN:9HŋJf&:9Jg:9HŋJf`:9Jg*U?<?<BgHnHnHnHnN-6O=_NNlU?9V:.EMRE?N bX=_NlN+_N^Nup N*NV=y̎=y̐BnBnU?9V?<N bX=_U?9VBgNX=_U?9V?<N(X=_?9VBgBgN x\U?9V?<N`X=_U?9V?<N @X=_U?9V?<N X=_U?9V:.E?N X=_NU?.NLTJg?9V?.?.?.NH^PN"?9V?.?.?.?.NIjO NNU?.NLTJg`N:9nJElDE89nJDlDDEo`Np:9nJElDEngTN?9V?.?.?.NH^P:9nJElDE=E?9V?.?.?.NH^PNNl:9nJElDEngTN?9V?.?.?.NH^P:9nJElDE=E?9V?.?.?.NH^PNN:9nJElDEng:9nJElDEng`NvN?9V?.?.?.?.NIjO :9nJElDE=E:9nJElDE=E?9V?.?.?.?.NIjO N:9HŋJf&:9Jg:9HŋJf`:9Jg*U?<?<BgHnHnHnHnN-6O=_NU?.NLTJg?9V?.?.?.NH^PN"?9V?.?.?.?.NIjO U?9VBgN`X=_U?9V:.MM?N @X=_U?9V?<N X=_?9V?9N XU?9V:.E?N X=_:.MMJgNLU?9V?<NX=_U?9V:.EMRE?N bX=_?.NJ4TU?.NLTJg`:.MMJg?9V?.?.?.NH^P:.MMJg"?9V?.?.?.Bg?<NGzO Nh:.MMJg ?9V?.?.?.?.NIjO :.MMJg&?9V?.?.?.?.Bg?<NHO?.NKTNN^NupN*NVNU(m?,NLTJg`N^?9V(m?,(m?,(m?,(m?,(m?,NGzO UY(m?,N>TYYY(m?,N>T/TYYY(m?,N>T/O UY(m?,N>TYYY(m?,N>T/TYYY(m?,N>T/O Nb?9V(m?,(m?,(m?,(m?,(m?,(m?,NHOUY(m?,N>TYYY(m?,N>T/TYYY(m?,N>T/O UY(m?,N>TYYY(m?,N>T/TYYY(m?,N>T/O NN^NupN*NVN(m l f`N(m&m7l(m&m7lU(m?,NLTJgP(m:,MMJg8?9V(m?,(m?,(m?,(m?,(m?,NGO NV(m:,MMJg@?9V(m?,(m?,(m?,(m?,(m?,(m?,NION(m l f`NU(m?,NLTJgTY(m:9lJElDE?N>TNJXN>XNX/TNX-_0nlSn`T:. n=EpnoN,/.Y?.N>TNJX-_Snpnf-n N^NupN(pN*NVY?. ?.NX-_=npnoN"/./.NX-_Snpnf:. n=EpnoN0/./T/.NXNX(n((n/Y:.K?E(n?4PN>T/.NXNX(n(SnpnfbN^NupN*NV-|?:.RE=E:. ?0.WoN./.Y?.N>TNX-_0.WlRn`T=|:. n?0.WoN./.Y?.N>TNJX-_0.WlRn`T-n N^NupN(pN*NVY?. ?.NX-_=|:.?0.WoN$/./.NX-_0.WlRn`T=|:. n?0.WoN2/./T/.NXNX(n((n/Y:.K?E(n?4PN>T/.NXNX(n(0.WlRn``TN^NupN*NV(n T@lnU?<?<BgHnHnHnHnN-6O=_(n :K?E(n9P(n :K?E(n9P(n :RE(n 8|N^NuB.N^NupN(pN*NV(n T@l`NU?<?<BgHnHnHnHnN-6O=_Bn:.K?E(n8.tPJDlDD Dn":.K?E(n8.tPJDlDD Do:.(n TlRn`:.(n Tf :.SE=EU?<?<?<HnHnHnHnN-6O=_U?<?<BgHnHnHnHnN-6O=_(n :SE=E:.?0noNX:.K?E(n8.RDI?D&n7P@:.K?E(n8.RDI?D&n7P@0nlSn`T:.K?E(n9P:.K?E(n9P(n :RE(n 8|N^NuB.N^NupN(pN*NV(m(l Tf*(m&m7l(m&m7l(m9|N(mJlfn(m&m7l(m&m7l(m&m:+REK?E(l&m7tP(m&m:+REK?E(l&m7tP(m9|N:(m&m&k :SElf`Np(m&m:+SEK?E(l&m7tP(m&m:+SEK?E(l&m7tP(m&m7l(m&m7l(m9|N(m&m:+SEK?E(l&m7tP(m&m:+SEK?E(l&m7tP(m&m7l(m&m7l(m&m:+REK?E(l&m7tP(m&m:+REK?E(l&m7tP(m9|N^NupN*NV/-+N(n JTo`NU?9V?<N bX=_Bn:.K?E(n8.tPJDlDD Dn":.K?E(n8.tPJDlDD Do:.(n TlRn`:.(n Tl`N:.K?E(n=tP:.K?E(n=tPNHnHn(mHl(mHlN O:.nf :.ngbN?9V?.?<HnNF>O N=n=nNN?9V?.?<HnNF>O N(m:,Jg`V:.K?E(n9P:.K?E(n9P|+_N^NuB.+_N^NuB.+_N^NupN(pN*NV(n JTo`N>U?<?<BgHnHnHnHnN-6O=_Bn:.K?E(n8.tPJDlDD Dn":.K?E(n8.tPJDlDD Do:.(n TlRn`(n :SEno`Nv=n(n :UE?0.WoNX:.REK?E(n8.I?D&n7P@:.REK?E(n8.I?D&n7P@0.WlRn`T:.(n Tl(n :SE(n 8|N^NuN B.N^NupN(p N*NV/-+NBnU(n?(n?(n HT(nHTNJO _I Gz W?9\?<I* x?I* ?BgBgN jO (nHT(nHTHnHnN O:.HŋJf:.Jg:.HŋJg`N U?<?.BgHnHnHnHnN-6O=_ nfBnN :.RE=E:.H N IGzWNpI*GzWNXITNX-_/.Y:.K?E(n8.RDI?D&n64Ps@JClDC?N>TNX-_0.WlRn`bTUYY/./<@NLPY/./<@NLPNXNXNX=_N^NupN(pN*NVUYYYzK (nzK &n:,SJElDE?N>T/<@NLPYYzK (nzK &n:,kJElDE?N>T/<@NLPNXNXNX=_:.nm`N?9V?.?<N x\?9V?<?. (nHTNF>O zK (nzK &n6zK (nzK &n7l?9V?<?<N x\=|N^NuN =nN^NupN(pN*NV(mJlflU(m/,NX(m9_U(m/,NX(m9_U(m/,NX(m9_U(m/,NX(m9_N(m&m:,kf`NNU(m/,NX(m9_U(m/,NX(m9_U(m/,NX(m9_U(m/,NX(m9_?9V?<(m?<HlNF>O ?9V?<(m?<HlNF>O NNNU(m/,NX(m9_U(m/,NX(m9_U(m/,NX(m9_U(m/,NX(m9_(m lf0U?<(m?,(m?<HlNO (m9_Nv(mJlf.UBg(m?,(m?<HlNO (m9_N>?9V?<(m?<HlNF>O (m&m7l(m&m7l(m lf0U?<(m?,(m?<HlNO (m9_Nv(mJlf.UBg(m?,(m?<HlNO (m9_N>?9V?<(m?<HlNF>O (m&m7l(m&m7lNN^Nup8N*NV/-+N n o`N:.EMM=E:.E?MM=E?9V?<?<N x\U?9V?<N X=_U?9V:.E?N X=_=| no :.=E=nU?9V:.MM?N @X=_U?9V?<N bX=_U?. (nHTN\:Hŋ =E:.ESE=EBn:.?0.WoNY?.N>TY?.N>TNJX-_Y:.n?N>TY?.N>TNJX-_HnHn/.:. SE?(nHTNtOHnHn/.:. SE?(nHTN.ON 0.WlRn`NT:.MMJg`NU?9V?<N X=_U?9V?<N X=_U?9V?<N @X=_?9VBgBgN x\(n=T(n=l=|:. SE?0.WoNl:.K?E(n=tP:.K?E(n=tPN?9V?<?<HnNF>O N=n=n0.WlRn`T+_N^NupN*NVBy4Hy̎Hy̐Hy4Hy:NO?9t?9v?9x?9zN'PU?9V:.EMRE?N bX=_?.NJ4T?.?94Hy:N4P?.NKTN^NupN*NVN(m l f`N?9V(mHlNG:\(m:,MMJg(m:,E Ee`N(m&m7l(m&m7l(m&m7l(m&m7l(m&m7l(m&m7l(m&m7l(m&m7l(m&m7l(m&m7l?9V?<(m?< HlNF>O NV(m:,MMJg?9V(mHlNI\(m:,MMJg?9V(mHlNI\NN^Nup"N*NV/-+N=y̎=y̐=y̎=y̐=y̎=y̐U?. ?.HnNP=_U?9V?<N X=_?9V?9N XU?9V:.E?N X=_U?9V:.MM?N @X=_U?9VBgN`X=_:.MMJgNLU?9V?<NX=_U?9V:.EMRE?N bX=_N?.NJ4TN?.NKTN+_N^Nu <N*NV?9\?<HnHnHnHnN O=y̎=y̐=y̎=y̐=y̎=y̐=|=|U?9V?<N X=_U?9V?<N X=_U?9V?<N @X=_U?9VBgNX=_?9VBgBgN x\U?9V?<N bX=_N?9V?.?<HnNF>O NN:9Jfp:9nf :9ngTN?9V?.?<HnNF>O =y=y?9V?.?<HnNF>O NNU?<?<BgHnHnHnHnN-6O=_ n?l`:9nf :9ngD:.EKEI9P:.EREKEI9P:.RE=E=n=nN* n?f :9nf :9ng3:9HŋJf&:9Jg:9HŋJf`:9Jg*U?<?<BgHnHnHnHnN-6O=_N?.?.?.?.N'P:.EKEI9P:.EREKEI9P:.RE=EU?9V?<N X=_?9V?9N XU?9V:.E?N X=_U?9V:.MM?N @X=_U?9VBgNX=_U?9VBgN`X=_:.MMJgNLU?9V?<NX=_U?9V:.EMRE?N bX=_?.NJ4T?9V?.?<HnNF|O :.MMJg*:.E Ee?9V?.?<HnNF>O ?.NKTNN^NupN*NV(m&m7l(m&m7l(m&m7l(m&m7lN^NupN*NV(mBl(mBl:9ɚSE(m9E:9ɜSE(m9EN^NupN*NV(m&m7l(m&m7l(m&m7l(m&m7lN^NupN*NV(mBl(mBl:9ɚSE(m9E:9ɜSE(m9EN^NupN*NVU?<?<5Hy̆NP=_N^Nup2N*NVI89|9|9|9|9n 9n 9|9|UHnN!:X=_:.HŋJg`N=n =n(m:.ll (m=l(m&m:,k SEnl(m&m:,k SE=E(m:.l l (m=l (m&m:, kSEnl(m&m:, kSE=E(m&m7l(m&m7l(m9n(m9n(m:,RE(m9E(m(l8(m*,T(m)E(m(l8(m*,T(m)E(m:.lo (m9n(m:.ll (m9n(m:.lo (m9n(m:.ll (m9nN?9V(m?,(m?<HlNF>O N=n =n:.HŋJf(m l>gl`N^NupJN*NV/-+N(m lg (m lf`N =|=|-yư-n-nU?9V?<N @X=_U?9V?<N X=_U?9V?<N X=_?9VBgBgN x\U?9V?<N bX=_=y̎=n=y̐=n(n8*.T-E(n8*.T-E=n=n=n=n?.?.NZX=n=n(n=T(n=l(n&n6*.T-E(n&n6*.T-EN?9V?.?<HnNF>O ?.?. ?. ?.N'P:.nEHŋE8.nRDH(9ưƬ&9|e`N(mBl(mBl:9SE(m9E:9SE(m9E(mBl(mBl(m&m7l(m&m7l?9V?<(mHlI* /I* /NlOHnHnN,PN/9z/?O 090WlRy0`T:.nEHŋE8.nRDHŋH-EIɖ/ Y/./9|/9ƬHyưN0O*(_(:.nRE9E:.nRE9E:,EM9EBl 9| BlBlNNf?9V?<(mHlI* /Iɖ* /NlON?9V?<(mHlI* /I* /NlO(m lf`NU?9V?<NX=_U?9V?<N(X=_U?9V?<N bX=_?9VBgHyNN:9n=E:9SE=E:9n=E:9SE=EBgNÂTJno`N:9SEn=EpncN:9EHEBEHEx8.//N,X*9ڟ-E:9EHEBEHE8.JDlDDnHDBDHD//N,X*9ڟ-EBn:9SE?0.WcN.(n&n6*.T-E*.T-E0.WdRn`TSnpnfFBn:.SE=EBn:.SE=EBgNÂTJno>:9n=E:9SE=E:9n=E:9SE=EBgNÂTBn:9SE=EBn:9SE=EJnl::.JElDE=E:9SE=EBn:9SEn=E?<NÂTJno`N :9SE=EpncN:9EHEBEHE8.RDHDBDHD//N,X*9ڟU-E:9EnMEHEBEHE8.RDHDBDHD//N,X*9ڟU-E:9nEMSE=EpncN,(n&n6*.U-E*.U-ESnpnfSnpnf6:9n3:9EM3N(Jnl`NBn:9SE?0.WcN:9EHEBEHEx8.//N,X*9ڟ-E:9E8.JDlDDDMEHEBEHEx8.//N,X*9ڟ-EBn:.JElDE89EDLSD?0.WcN.(n&n6*.T-E*.T-E0.WdRn`T0.WdRn`.T:.JElDE89E3:9EM3JnoXBn:9SEn=E=n:9SE=E?<NÂTBn:.SE=EBn:.SE=EBgNÂTJno>:9n=E:9SE=E:9n=E:9SE=EBgNÂT+_N^NupN*NV:.H N x(yʖ?, NMTNNNNv(yʖ?,&NX(TN`(yʖ?, NXTNJ(yʖ?,"NlTN4(yʖ?,NoFTN?.(yʖ?,N>XN(yʖ?,NTN?.(yʖ?,N>XN?.(yʖ?,N|XN?.(yʖ?,N|XN(yʖ?,$N TN?.NTNz?.NTNj?.NTNZ(yʖ?,N^,TND(yʖ?,NRTN.N* "t,BXnt(8tH^N^Nu Text -128 Text +128 Text Add Points Add A Point Insert A Point Move A Point Delete A Point Press Left Button to Exit Bezier [0][ Not Enough Memory | For That Operation ][Sorry]P @(P P ?@(8UVP p`t P ?G)D?P `4 P) =Db*RU?PJ@>@`t&PF 5y@`*E?WJ@"$`LQ 5y@`**?TRJ`S uY@`)5@ 7UJ8?$B`0VY@`(*@;TRJ8?`w‚qWJY@`(%P WJ8?H@ `0bV*@`(" ;PJ@D` "V@J@@`(#T 7PJ@$ ` "%V 9@`($?PJ@> H`?-R 9@`((J ?PJ `?!R A@(u0"?Pp`5bP @(% xP `P @(UVP P @(P TP @(wS0P ?A( RJx? BP F(%  RJ@" P H( %@ RJ@"P P@%@} RJ`?TpP P%@)JRJ(88ԀP P%@0I*RJ<>>Ep P P% RJ<(@P PEI*RJT@"P P)JRJ`?@"P H(A @ RJ BP F(" RJP ?A(RJx?qP @(ऀwS01P @(P ????? H H H H ;"!*"I/K(J&66J"!( URUUJ*H !$I&`dccI Ȉ*Kwu/H !""$H,ldH  URUUJ*H !!ADH-HPQ "!*"I/K H !J"!* URUUJ*J!(PPH(H Ȉ*Kwu/J" H !(J  URUUJ*J$ H 4||H "!*"I/K(J&66J"!( URUUJ*H !$I&`dccI Ȉ*Kwu/H !""$H,ldH  URUUJ*H !!ADH-HPQ "!*"I/K H !J"!* URUUJ*J!(PPH(H ;Ȉ*Kwu/J" H !(J  URUUJ*J$ H 4||H  H H H H ?????ꪪUUW????? H H H H (`RH !/@RJ(H(4RK/ba(Hpq!I (H tH($ H""$ H(H H(#I$DDH`a(H! ĄH( K/00H`a(HA H(&% @RI(``H(H H(>=!AD H$DDI (H H(>=.>4 Hpq""$ J(H `H((`RH !/@RJ(H 8`H/ba(Hpq!I (H pH($ H""$ H(H H(#I$DDH`a(H !H( K/00H`a(H@#H(&% @RI(``H(H'H(>=!AD H$DDI (I.H(>=.>4 Hpq""$ J(J,RH( H H H H ?????80|0  0p? 0H0@!0@DP0$ 0 "0p? 0 $0|0800@<@~?DHAp0P*8 x?`?b8`?F@p x?P*?0HAD@~?@@p<@@8 @@@G@@@UUUUUUU@GGG@wwwwwwwp?|8ap83q8grfǎx<<O?s88OÎx88p`Css88pw8G8πp|88px88px@8??}?a<Àg~=?yxpq90ppqÜppq9Ýpqq9ßp;q9Þ>qyq>>À?|8888|=8a1LJcp8ǜscp8Ã#8p8ボspp8spppǽpp|??χ>??pp<x`>|?{8?|}?ypp@x`> ?8q<ps|8q|pspw8qvpspwa8q pp>0xp<x>8p???Ϗ?pp<?x|q8q8p8p8|;xs8a1:0q8ǜ8q8Ã8q8ボ8q8s8qp<qǽqOq||?pp8x`9>3|v1>=yðqð7qÐqÀqÀqÀqÀ>qÀ?Ӝ֖ܓؑ0”0Ɩ0Ɩ0”00ؑܓ֖ӜӜ֖ܓؑ0”0Ɩ0Ɩ0”00ؑܓ֖ӜӜ֖ܓؑ0”0Ɩ0Ɩ0”00ؑܓ֖ӜӜ֖ܓؑ0”0Ɩ0Ɩ0”00ؑܓ֖ӜӜ֖ܓؑ0”0Ɩ0Ɩ0”00ؑܓ֖ӜӜ֖ܓؑ0”0Ɩ0Ɩ0”00ؑܓ֖ӜӜ֖ܓؑ0”0Ɩ0Ɩ0”00ؑܓ֖ӜӜ֖ܓؑ0”0Ɩ0Ɩ0”00ؑܓ֖ӜӜ֖ܓؑ0”0Ɩ0Ɩ0”00ؑܓ֖ӜӜ֖ܓؑ0”0Ɩ0Ɩ0”00ؑܓ֖ӜӜ֗``````ܓ<3c<3c<3ؕ 0 0 ŸƠ 0 0 c<3c<3c<3````````````c<3c<3c<30 0 0 0 0 0 c<3c<3c<3```````k@+9````kc<3c<3c<;0 0 0CccC0 0 0[c<3c<3c<;`````{{???388Ø{ǎ<cs8c8Às88888??}?`?q??s? ?DEFMNO_`adefklmtu$%&23 4TU Vuvw   '():;<>?@DEqFHIJQRqSUVWcdq eghivwq x}~           0 1 2 7 8 9 O P Q f g h q r  s | }  ~         q                 & ' ( - . / 5 6 7 > ? ` @  ee( ,e|eP-00,0:0H 0V* 0d $ )  = M  0r   0*  e 0P 0 0  0   l/   0 L%h &E   q      , H   # d  %                (    D     ` |        $ @  \-+  x ! ! %                <   X   t           ! !  !8-+  !T  !p %!  .2!   !!!" "4 "P "l ""   " " " # #0 #L #h #  # #  # # # $ $, ' &# "!!  $H #$d $$ %$ &$ $ -(, *))($ +%  , ' .%( /0 0%D .%%`  %"%|   % % %      %  &  &$ &@   &\ &x &  &    & & ' '  '<  'X 't '  % # !'"-#+ $$ #' &'  '' %%(    ( (8 (T  (p      (  (  ( (   (  %)  )4 )P     )l %)  !v ) ) ) )  0*    *0 *L *h  *   * ** *  +  +,  +H-+  +d   + - +   +  +-+  +  +-+  ,    ,( %,D  ,` ,|,,, , -   -$ -@-\ %-x 1 - /   - @-@- @. @.  @.<@.X  .t.. .EE./EE   / %/8  E   /T  /p    q / / /%/02h358;@CEXFHGGH(JLxOxpN*NV*<#*<#*<#*<&#*<.#*<6#*<>#*<F#*<N#*<V#*<P##κBy(yκ:9KE(<شP(yκ:9KE)PXRy yf*<P##By(y:9KIP*<ڔ(*<ڬ)E*<ڬ)ERy yf*<0##ξBy(yξ:9K (<شP(yξ:9K )PRy y f*</##By(y:9K"IP*<ڔ(*<ڬ)E*<ڬ)ERy yf*<0##By(y:9KUIP lg& lg lg lg*<ڬ )E / /9?9N\(_Ry yVfN^NupN*NV(yκ:.KE-tP N^NupN(pN*NV(n:, Jg(n:, SE(n9E N^NupN*NV(n:, Jf(n:, RE(n9E N^Nup N*NVBg?<HnHnHnHnN O-n(n:,REHŋ8.E(n 8(n:,REHŋ8.Enl (n 8N8(n:,HŋnRE8.nEl:.n(nl(n 8(n:,REHŋ8.E(n8(n:,REHŋ8.Enl (n8N8(n:,HŋnRE8.nEl:.n(nl(n8N^Nup N*NVBg?<HnHnHnHnN O no no`N-nHnHnHnHnN O(n:, HŋJg$(n:,\E(n9E(n:,\E(n9E/.?.?.(nHl(nHlNZ|O(n&n6(n&n6(n&n 6(n&n6(n:, HŋJgH(n:,VE(n9E(n:,VE(n9E(n:,]E(n9E(n:,]E(n9EN(/.(nHT(nHT(n HT(nHTNDON^NuNV?.?.?.?. NP3 Ċ3Č#ĴU?<*?<?<?<BgN$O 3N^NuNV?.?. ?. ?.NP#ĴU?<+?<?<?<BgN$O =_N^NuNV?.?.?.?. NP#ĴU?<.?<?<?<BgN$O 3(n8ĦN^NuNV?.?.?.?.?.?. ?. ?.NO#ĴU?</?<?<?<BgN$O 3N^NupN*NVzK (nB=|zK(nJg`NU?.(nHTN\:SE=E:.K(n 4\Pg JnmSn`JnmDBn:.?0.WoN.:.K(n8.I &nP@0.WlRn`T:.RE=E:.K (nB4P?. (nHT?.(nHT?. (nHTN-nB*.S/ .気cN(nR .気dR`XN,-n/.(n?B'HnN/O /.aBX+_N^NuTEMP[0][ Not Enough Room on Disk ][ Sorry ]LassoKnifeBlockKnifeLassoBlockpBN*NV=|=|=|=|(yκ#(y9n (y9n(y=l(y=l(y=l(y=lBgBgBgBgBg?.?.?.?.NO(yκ/,Bg?<?.?.?.?.N]$O?<N T=|Bn(y=l(y=l(y=l(y=lHnHnHnHnN OU(yκ/,Bg?<?.?.N]O =_ nf=|:.ng`N:Jno8 ng0(yκ/,?.Bg?.?.?.?.Bg?<N^ OJnnHBn(y:,RE=E(y:,RE=E(y:,UE=E(y:,UE=ENh=|(y:.KU=tP(y:.KU=tP(y:.KU=tP(y:.KU=tPJno: ng2(yκ/,?.Bg?.?.?.?.?<?<N^ O=nUHnN!:X3:9HŋJf`XU?<?<BgHyHyHnHnN-6O=_?<N T?<BgBgBgBg?.?.?.?.NOJno6 ng.(yκ/,?.Bg?.?.?.?.BgBgN^ O=n N^NupN(pN*NV(yκ#(y-l(n-TJ.g,(n|S(n|h(n|o(n|wN*(n|H(n|i(n|d(n|eN^NupN*NV(yκ#(yκ/HnHnHnHnNDOBgBgBgBgBg?.?.?.?.NO(yκ/Bg?<?.?.?.?.N]$OU(yκ/?aN^NupN*NV(yκ/,?.Bg(m?,(m?,(m?,(m?,(y:.KU84P RD??<N^ O(m-l(m-l nfJBy(n:9REKE&n89ID7P@Ry yf(n&n7T nfJBy(n:9KE&n89RDID7P@Ry yf(n&n6 nf`NBy(n:9KEIP( (m)DBy:9RE(n89ID64@ Ecz` g(m(l:9Kp TN(m(l:9Kp T(n:9KE84Pg(m(lN(m(lRy yf\Ry yf& nf`NBy(n:9KEIP( (m)DBy(n:9KE84P:9 Ecz` g(m(l:9REKp TN(m(l:9REKp T(n:9KE84Pg(m(lN(m(lRy yfVRy yf By(n:9KE&n89ID7P@Ry yfaaP(yκ/,?.Bg(m?,(m?,(m?,(m?,(y:.KU84P SD??<N^ ON^NupN*NV(yκ/,?.Bg(m?,(m?,(m?,(m?,(y:.KU84P RD??<N^ O nf`NBy(m:9EHEBEHEڬ-EBy(m:9EHEBEHEڬ-Ezy(n8 Ecz` g(n:9Kp TN(n:9Kp TRy yfRy yf^ n f`NBy(m:9EHEBEHEڬ-EBy(mzyEHEBEHEڬ-Ezy(n8 Ecz` g(nzyKp TN(nzyKp TRy yfRy yfXBy(m:9EHEBEHEڬ-E(m:9EHEBEHEڬ-E(n&n6Ry yfaba(yκ/,?.Bg(m?,(m?,(m?,(m?,(y:.KU84P SD??<N^ ON^NupN*NVU?9V?<NX=_U?9V?<N bX=_NBy(m:9EHEBEHEڬ(m)EBy:9EZE(yl((ml3V:9VZE3Z:9EZE(yl*(ml3X:9XZE3\zy(m(l8 Ecz` gU?9V?<N(X=_NU?9VBgN(X=_?9VHyVNF\Ry yf*Ry yfNN^NupN*NV(mBl(mBl(m9|(m9|(y&m:,kZE(m9E(y&m:,kZE(m9E(y&m:,kE(m9E(y&m:,kE(m9EN?9V?<(mHl(mI* /I* /NlONN^NupHN*NV?<BgBgBgBg(m?,(m?,(m?,(m?,NON nf ?9V?<I* /NPN?9V?<I* /NPNz -E n fB9bU?< Hyb?<@Hy?<@HnN_OJg`N nfT?<@HnBg(mHlN.O (m?,Hn*<h/N/fO U(m?,N/TJNqNp?<@HnBgHnN0O JnmP?<@HnBg(mHlN.O (m?,Hn*<h/N/L<JXft:9Jg`N :.HŋH N 43(yκ/,?9Bg?.?.?.?.(y:9KU84P RD??<N^ ON?<aTN?<aTN?<a|TN~?<anTNpNl dr yg yg`?<BgBgBgBg?.?.?.?.NO(yκ/,?9Bg?.?.?.?.(y:9KU84P SD?BgN^ O?<N T yfLBnBn=|=|BnBn=|=|?9V?<HnI* //.NlOU?9V?<N(X33+_N^NupN*NV(m&m:,֚kHŋ(m9E?9V(m&m:,kRE?(m:,RE?HyHyNOU?9V?<N bX(m9_U?9V?<NX(m9_Jyf =|NBnU?9V?.N(X=_(m&m:,kRE3V:9VE 3Z(m:,RE3X:9XE 3\N?9VHyVNF\N(mI* (m)E nf((m(l&m:+HŋxEIp TN&(m(l&m:+HŋxEIp T(mHl(mHl(mHl(mHlN O(m:,Jg`N(m&m:,ֺkm@(m&m:+Eߺlm*(m&m:,غkm(m&m:+E lm`N8(m&m$m:+֚jHŋlg`N(m&m:,֚kHŋ(m9E(m&m:,kRE3V:9VE 3Z?9V(m&m:,kRE?(m:,RE?HyHyNO:9ng`NvN?9VHyVNF\N nf((m(l&m:+HŋxEIp TN&(m(l&m:+HŋxEIp T:9Jg`$N^NupN*NV(yκ/,(y:.EKUHtPNZX(y:.EKU9P Rn nf(m:,K2I&m8+IDIPJt@n(m:,SE(m9E`(y&m:+EKUHtPNZJXN^NupN*NVBn(y:.ZEKU&m'tP :.K2IIP( (m(l(U:.K2I?<HtPN\(m(l9_:.K2IJtPn:(y:.ZEKUHtPNZX(y:.ZEKU9P Rn nf2(m:,K2IJtPn(m:,SE(m9E`(y&m:+ZEKUHtPNZJXa(y&m'l(m(l&m'T(m:,MM(m9E(m?,?<(m(l?<HTN0O U(m(l?<HTN\(m(l9_N^NupN*NV(m:,EM=EBn:.Jg(y:.E"KU9P :.Hŋ=ERn nfBn(y:.EKUHtPNZXRn nf(m:,E?MM=E(y:.EKUHtPNZJXN^NupN*NV(y&m'l n,f0(m l f (mBlN(m:,E(m9EN6 n+f,(mJlf(m9| N(m:,E(m9E(m(l&m'T(m?,?<(m(l?<HTN0O U(m(l?<HTN\(m(l9_(yκ/,?.Bg(m?,(m?,(m?,(m?,(y:.KU84P SD??<N^ O(yκ/,?<'?<(m?,(m?,(m?,(m?,N]$ON^Nup N*NV/-+N:.E=E:.E?M=E(yκ#aaar(yκ/,HnHnHnHnN[OBgBgBgBgBg?.?.?.?.NO(yκ/,Bg?< ?.?.?.?.N]$O?<N TU(yκ/,?:.[E=Ea(yκ/,?< ?< ?.?.?.?.N]$ON nm nn :.E=E n/g n0g` (yκ/,?.Bg?.?.?.?.(y:.KU84P SD??<N^ O?<BgBgBgBg?.?.?.?.NO?<N T n/f`Nz:.pe=E(y:,Jg:.E=ENF(y:,Jg:.E =EN$(y:,Jg:.E0=ENBy(y:9ZEKU84P Jg:.y=ERy yfBy(y:9EKU84P Jg:9En=ERy yf(y:,:Jg :.E@=E(y:,RJg :.E=E(y:,jJg :.E=E(y:,Jg :.E=E(y:,Jg :.E=E=n +_N^NupN(pN*NV(yκ/, (m?,Bg(m?,(m?,(m?,(m?,(y&m:+KU84P RD??<N^ O(m lf(m9|2N(m:,SE(m9E(m?,?<(m?<HlN0O U(m?<HlN\(m(l9_(yκ/, ?<?<(m?,(m?,(m?,(m?,N]$O(yκ/, (m?,Bg(m?,(m?,(m?,(m?,(y&m:+KU84P SD??<N^ ON^NupN*NV(yκ/, (m?,Bg(m?,(m?,(m?,(m?,(y&m:+KU84P RD??<N^ O(m l2f(m9|N(m:,RE(m9E(m?,?<(m?<HlN0O U(m?<HlN\(m(l9_(yκ/, ?<?<(m?,(m?,(m?,(m?,N]$O(yκ/, (m?,Bg(m?,(m?,(m?,(m?,(y&m:+KU84P SD??<N^ ON^NupFN*NV/-+N=|=|=|=|(yκ# (y-l:.E?RE=E?.?<?<HnN0O I* (n(U?<HnN\(n9_(yκ/, HnHnHnHnN[OBgBgBgBgBg?.?.?.?.NO(yκ/, Bg?< ?.?.?.?.N]$O?<N TUHnN!:X3:9HŋJg`N U(yκ/, Bg?< ?.?.N]O =_ ng`N:.H N avNaN(yκ/, ?.Bg?.?.?.?.(y:.KU84P RD??<N^ ON`(yκ/, ?.Bg?.?.?.?.(y:.KU84P RD??<N^ ONN h:9Jg`N:.Hŋ EfR=|(yκ/, ?.Bg?.?.?.?.(y:.KU84P RD??<N^ ONrU(yκ/, Bg?< ?.?.N]O =_ nm@ nn8:.Hŋ EKf=|aN:.Hŋ EMf =|aV ng n g`?<BgBgBgBg?.?.?.?.NO(yκ/, ?.Bg?.?.?.?.(y:.KU84P SD?BgN^ O?<N T nf :.SE=E=n +_N^NupN(pN*NV(y&m'lT~(m(l~&m'T3(m(l:9K PRy yf 'ƌe`N/9ƌHxNxX*=E(m(l|K?.?<(m?<HlN0O U(m?<HlN\=_By:.SE?09ܰWcNF(m:.ySEKI&m&kxyIP@09ܰWdRy`TN/9ƌHx'Nx.*=E(m(l| ?.?<(m?<HlN0O U(m?<HlN\=_By:.SE?09ܰWcNF(m:.ySEKI&m&kxyIP@09ܰWdRy`T(y&m'll~(m(l~&m'T3(m(l:9K PRy yf 'Ɛe`N/9ƐHxNxX*=E(m(l|K?.?<(m?<HlN0O U(m?<HlN\=_By:.SE?09ܰWcNF(m:.ySEKI&m&kxyIP@09ܰWdRy`TN/9ƐHx'Nx.*=E(m(l| U(m?<HlN\=_By:.SE?09ܰWcNF(m:.ySEKI&m&kxyIP@09ܰWdRy`T(y&m'l~(m(l~&m'T3(m(l:9K PRy yf 'Ɣe`N/9ƔHxNxX*=E(m(l|K?.?<(m?<HlN0O U(m?<HlN\=_By:.SE?09ܰWcNF(m:.ySEKI&m&kxyIP@09ܰWdRy`TN/9ƔHx'Nx.*=E(m(l| ?.?<(m?<HlN0O U(m?<HlN\=_By:.SE?09ܰWcNF(m:.ySEKI&m&kxyIP@09ܰWdRy`TN^NupN*NV(m| B,(m?<Hl(m(l?<HT(m?<HlN(m lg(m9|a"N (m lf(m9|N (m9|aNaNaN(m lf(m9|N (m9|aNaTNN HfaaHN^NupN*NV yf`NxU(yκ/,$Bg?< (m?,(m?,N]O (m9_(m lm&(m ln(m&m:,ҺkgazN(m lfa yf`N(m:,H N Ra@NaN(m lf(m9|N(m:,RE(m9EaNN(m lg(m9|aN0(m lf(m9|N(m:,SE(m9EaNadNaN(m lf(m9|N(m:,RE(m9EabNaNN PnaaN^Nu <N*NV~/-+N=|=|=|=|Jnf =| N=| (yκ:.KE-tP n f(yκ#,a\(yκ#$-n (y-l<(y-lT(y-ll(y-l(n-T(n?, ?<(n?<HTN0O U(n?<HTN\:RE(n9E(n-T(n?,?<(n?<HTN0O U(n?<HTN\:RE(n9E(n-T(n?,?<(n?<HTN0O U(n?<HTN\:RE(n9E(n-T(n?, ?<(n?<HTN0O U(n?<HTN\:RE(n9E(yκ/,$HnHnHnHnN[OBgBgBgBgBg?.?.?.?.NO(yκ/,$Bg?<?.?.?.?.N]$O(y&y:,kRE(n9E(y&y:,kRE(n9E(yκ:.KE/4PBg?<(n?,(n?,(n?,(n?,N]$O?<N TBnBn nf6=|(yκ/,$?.?.Bg?<HnN]O=nND n f6=|(yκ/,$?.?.Bg?<HnN]O=nNBnUHnN!:X3:.Hŋ=E:.HŋHE=EJnfaPN" n faN nfaN ng`Jnc((yκ/,$?.?.?.?<HnN]O?<BgBgBgBg?.?.?.?.NO?<N T(yκ/,$?.Bg?.?.?.?.(y:.KU84P SD?BgN^ O n g nf((n-THnaX(n-THnaXNBn nf((n-THnaX(n-THnaXN n f(n=l (n=l|By:9KEIJtPfB.Ry yfJ.g((n9n(n9n (n9n (n9n+_N^Nup|N*NV=|#=|=|=|=|Bn(yκ#4=|(y:.KUHtPNZX(y:.KU84P HĉJg (y:.KUIP:, QE9E (y:.KU8.[DIDG'P @:.[EKE(n/4P/<= Nx.HxNxX*=E:.[EKEI(tP-T?.?<?<HnN0O Bn:.KI&n8.I P@Rn nfU(n?< HTN\:.[EKEI(tP9_/./<= Nx.HxNxX*nc (y:.KUIP:, PE9E Rn n fd(y&n:ZEKUHtPNZJX(y-lD(n-T(n //<= Nx.HxNxX*=E?.?<(n?<HTN0O U(n?<HTN\:RE(n9E(y-l\IGzWI* (n(U?<HnN\(n9_(yκ/,4HnHnHnHnN[OBgBgBgBgBg?.?.?.?.NO(yκ/,4Bg?< ?.?.?.?.N]$OUHnN!:X3U(yκ/,4Bg?< ?.?.N]O =_ y f4?<BgBgBgBg?.?.?.?.NO=|N^NuN:9HŋJg ng nfH?<BgBgBgBg?.?.?.?.NO nf=|N^NuN BnN^NuNv:9JgF:.HŋHE E f4?<BgBgBgBg?.?.?.?.NO=|N^NuN"U(yκ/,4?< Np\=_ ng ng`?<BgBgBgBg?.?.?.?.NO(y:.KUIP:, SE9E nfBnN^Nu=|(y:.KU84P Jg,:.[E(n8(y:.KUIP:, SE9E Rn nf(n?<HTHnHnN1~Oz:./HxN,X(n (=|N^NupN(pbN*NV=|=|=|=|(yκ#4=|(y:.KUHtPNZX(y:.KU84P HĉJf (y:.KUIP:, PE9E Rn n f(y-lD(n-T/./<= Nx.HxNxX*=E?.?<?<HnN0O Bn:.KI&n8.IP@Rn nfU(n?<HTN\(n9_(y-l\IGzWI* (n(U?<HnN\(n9_(yκ/,4HnHnHnHnN[OBgBgBgBgBg?.?.?.?.NO(yκ/,4Bg?< ?.?.?.?.N]$OUHnN!:X3:9HŋJg`NU(yκ/,4Bg?< ?.?.N]O =_ ng nfH(yκ/,4?.Bg?.?.?.?.(y:.KU84P RD??<N^ O ng ng`@?<BgBgBgBg?.?.?.?.NO(yκ/,4?.Bg?.?.?.?.(y:.KU84P SD?BgN^ O=|(y:.KUIP:, QE9E Rn n f nfBn N^Nu=| N^NupN(pN*NV(m:.KEI?4P?<?.(n HTN12O (n * (n(U?.(n HTN\(n9_:.XE=EN^NupN(pN*NV(yκ/,0(n?Bg(m?,(m?,(m?,(m?,(y&m:+KU84P SD??<N^ O(n:H N  (m:,SE(m9EUBg(m?<Hl(m(lHTaO (n8N(m:,RE(m9EUBg(m?<Hl(m(lHTaO (n8N(m:,SE(m9EU?<(m?<Hl(m(lHTaRO (n8Nn(m:,RE(m9EU?<(m?<Hl(m(lHTaO (n8N.(m:,SE(m9EU?<(m?<Hl(m(lHTaO (n8N(m:,RE(m9EU?<(m?<Hl(m(lHTaO (n8N(m:,SE(m9EU?<(m?<Hl(m(lHTaRO (n8Nn(m:,RE(m9EU?<(m?<Hl(m(lHTaO (n8N.N* JHN^NupN*NVU(yκ/,0Bg?< (m?,(m?,N]O (m9_(m lg$(m l g(m lg (m lf`N(m:,n(m9E(yκ/,0(m?,Bg(m?,(m?,(m?,(m?,(y&m:+KU84P RD??<N^ O(mHlaZX(yκ/,0(m?,?< (m?,(m?,(m?,(m?,N]$ON (m9|N^NupN*NVUBg(m?<Hl(m(lHTa`O (m9_U?<(m?<Hl(m(lHTa4O (m9_U?<(m?<Hl(m(lHTaO (m9_U?<(m?<Hl(m(lHTaO (m9_N^NuptN*NV/-+N=|=|=|=|zK (n=TzK (n=lzK (n=lzK (n=l(yκ#0(y-ll(y-l(y-l(y-la(yκ/,0HnHnHnHnNDOBgBgBgBgBg?.?.?.?.NO(yκ/,0Bg?< ?.?.?.?.N]$O?<N TUHnN!:X3:9HŋJg`NU(yκ/,0Bg?< ?.?.N]O =_(y:.KU84PJg`N(yκ/,0?.Bg?.?.?.?.(y:.KU84P RD??<N^ O ng> ng6HnaDX(yκ/,0?.?< ?.?.?.?.N]$O:9Jg`N :.HŋHEH N BnBnBnBna(yκ/,0Bg?< ?.?.?.?.N]$O=|N=|(yκ/,0?.Bg?.?.?.?.(y:.KU84P RD??<N^ ONd?<aTNV?<aTNHNDT ng ng`(yκ/,0?.Bg?.?.?.?.(y:.KU84P SD??<N^ O?<N T nfLzK (n8zK (n9nzK (n9nzK (n9n|+_N^NuB.+_N^NupN(pN*NV=|Bn(m(l:.K&m8.IGHIPG@z6Q(y:.\EKUHtPNZX(y:.\EKUIP:, HŋJg :, QE9E (y:.\EKU&m8.IDG'P @(m:.KIHIP( (m:.KEI(tP((m:.KIH tPf&(y:.\EKUIP:, PE9E NB(m:.KIHJ4Pg&(y:.\EKUHtPNZJX=nRn nf=nN^NupN(pN*NV(m&n:KIHB4P(n8 (m&n:KIHPN^NupN*NV nf:(m&m:+FKIHIP:,RE9E:,l o9|N< nf2(m&m:+FKIHIP:,SE9EJln9l (m&m:+FKIH?4P?<(m(l?<HTN12O (yκ/,8?<?<(m?,D(m?,B(m?,@(m?,>N]$ON^NupN*NV nf:(m&m:+FKIHIP:,RE9E:,lo9|N< nf2(m&m:+FKIHIP:,SE9EJln9l(m&m:+FKIH?4P?<(m(l?<HTN12O (yκ/,8?<?<(m?,D(m?,B(m?,@(m?,>N]$ON^NupN*NV(m(lJTf(m(l8N (m(lBTN^Nu <N*NV/-+N-n(yκ#8Ua=_F(y-l(n-T(y-l| (n -T(yκ/,8HnDHnBHn@Hn>N[OBgBgBgBgBg?.D?.B?.@?.>NO(yκ/,8Bg?< ?.D?.B?.@?.>N]$O?<N TU(yκ/,8?NO(y:.ET2Q+?DX7? $pN*NV*<|#ς*<#φ*<#ϊ*<#ώ*<#ϒ*<8#ϖ*<X#Ϛ*<d#Ϟ*<@#Ϣ*<H#Ϧ(yς3ϲ(yφ3ϴ(yς3϶(yφ3ϸ(yϚ3Ϫ(yϞ3Ϭ(yϚ3Ϯ(yϞ3ϰ(yϊ3Ϻ(yώ3ϼ(yϊ3Ͼ(yώ3(yϒ3(yϖ3(yϒ3(yϖ3(yϦ3(yϦ3(yϦ3(yϦ3N^NupN*NV(m(l &m&k :. kTn>(m(l &m&k :. kTm"(m9n (m9n =nN^NuN(m=lN^NupN(pN*NV(m(l &m&k :. kln@(m(l &m&k :. klm"(m9n (m9n =nN^NuN(m=lN^NupN(pN*NV(m(l &m&k $yϦ:+jln&(m(l &m&k $yϦ:+jlm`NN(yϦ&m7T(yϦ&m7l(yϦ&m7l(yϦ&m7l=|N^NuN(m(l &m&k $yϦ:+j ln&(m(l &m&k $yϦ:+jlm`NP(yϦ&m7l(yϦ&m7l (yϦ&m7l (yϦ&m7l=|N^NuN BnN^NupN(pN*NVByU(yςzKE?4P(yςzREKE?4P?9ad\(m9_Ry y fU(yφ?(yφ?,Bga\(m9_U(yφ?,(yφ?,?<a\(m9_(mJlo,(mJlo"(mJlo(mJlo=|N^NuN BnN^NupN(pN*NVByU(yϊzKE?4P(yϊzREKE?4P?9ah\(m9_Ry y fU(yώ?(yώ?,Bga\(m9_U(yώ?,(yώ?,?<a\(m9_(mJlg,(mJlg"(mJlg(mJlg=|N^NuN BnN^NupN(pN*NVByU(yϚzKE?4P(yϚzREKE?4P?9al\(m9_U(yϞzKE?4P(yϞzREKE?4P?9a\(m9_Ry yf`(mJlg,(mJlg"(mJlg(mJlg=|N^NuN BnN^NupN(pN*NVByU(yϒzK#E?4P(yϒzREK#E?4P?9ar\(m9_Ry yfU(yϖ?(yϖ?,Bga\(m9_U(yϖ?,(yϖ?,?<a\(m9_(mJlg,(mJlg"(mJlg(mJlg=|N^NuN BnN^NupN(pN*NV/-+NBnBnBnBn(n &n $yφ:+Rln(n &n $yφ:+jlm`N(n &n $yς:+RTn((n &n $yς:+j.TmUa|=_Nj(n &n $yϊ:+RTnP(n &n $yϊ:+j2Tm6(n l fUa,=_N(n Jl fUa=_NBnN(n &n $yϖ:+Rln\(n &n $yϖ:+jlm@(n &n $yϒ:+RTn((n &n $yϒ:+jFTmUa=_N~(n &n $yϦ:+jln\(n &n $yϦ:+jlm@(n &n $yϦ:+RTn((n &n $yϦ:+j TmUa=_NBnI&n&&(n 9n(n 9n =n+_N^NupN(pN*NV(yϒzK#E&n6P(yϒzREK#E&n7tP(yϖz KE&n7tP(yϖz REKE&n7tP(n&n7T(n&n7l (n&n7l (n&n7lN^NupN*NV(yϢ&n6(yϢ&n6(yϢ&n 6(yϢ&n6N^NupN*NVa &?9V(m?,(m?,HyHyNOJyf =|NBnU?9V?.N(X3U?9V?<NX3U?9V?<N bX3(m3(m3(m9|(m9|:9ng`N(m:9lmB(m&m:,kyo*(m:9lm(m&m:,kyo`NX(m:9lHŋ(mlf (m:9lHŋ(mlg`N(m:9lHŋ(m9E(m:9lHŋ(m9E(m&m:+l3V(m&m:+l3X:9VySE3Z:9XySE3\N?9VHyVNF\N(m&m:,k3V3VZ(m&m:,k3X3X\?9VHyVNF\HyHyHyHyN O?9V?9?9HyHyNO:9Jg`a LN^NupN*NVN(m?,(m?,(m?,(m?,a Paa a NN^NupN*NVU?9V?<N bX3U?9VBgNX3?9\?<(mHl(mHl(mHl(mHlN O(m3(m3(m9y(m9y(m3V(m&m:+HŋlSE3Z(m3X(m&m:+HŋlSE3\(m:9lf(m:9lg`NN?9VHyVNG:\N(m:,yV(m9E(m:,yX(m9E(m:9l3V(m:9l3X(m:9Vll (m3V(m:9Xll (m3X(m:,HŋyV(m&m8,kEl((m&m:,k(m8,HĉԚD3V(m:,HŋyX(m&m8,kEl((m&m:,k(m8,HĉԚD3X(m:,HŋyVSE3Z(m:,HŋyXSE3\N?9VHyVNG:\N(m9y(m9yHyHyHyHyN O:9Jg`(m9yV(m9yXNaataBaNN^NupN*NVa?9\?<(mHl(mHl(mHl(mHlN O(m=l(m&m:,kSE=E(m=l(m&m:,kSE=E(m=l(m:.lSE=E(m=l(m:.lSE=E?9V?<HnI* //9ʆNlOaN^NupN*NV(m:,nc(m:, no | N^NuB. N^NupN(pN*NV/-+NU?<aTJg =| NpU?<aTJg =| NVU?<anTJg =| NO N^NupN*NVU?9VBgNX3U?9V?<N`X3U?9V?<N bX3(m3V(m&m:,kSE3Z(m3X(m&m:,kSE3\?9VHyVNG:\N^NupN*NV?9\?<(mHl(mHl(mHl(mHlN O(m:,n(ml=E(m:,n (ml=E(m:,n(mln SE=E(m:,n (mlnSE=E=n:.n SE=E=n :. nSE=E?9V?<Hn/9ʆI* /NlON^NupN*NV(m=l(m&m:,kSE=E(m=l(m&m:,kSE=EBn(m:,SE=EBn(m:,SE=E?9V?<HnI* /Iɪ* /NlON^NupN*NVN?<N Taa^?9\?<(mHl(mHl(mHl(mHlN O(m?,(m?,(m?,(m?,aPaIɪ&m9k&m9k&m:+EHŋ9EBl 9| BlBlaaBgN TN(m|N^NupN*NV?9\?<(mHl(mHl(mHl(mHlN O(m:,SEno`N:.n SE(m8,SDEo?.?. ?. ?.aPNL?.?. (m?,?.aP(m:,n8. E=D (m?,?. ?. ?.a|PaN&(m:.lm?.?. ?. ?.aPPaN^NupN*NVJy\g (m|N^NupN*NV:9Ťy\f`N(mJ,f`N?9\?< Hy8Hy:HyN OJyo`N38N:98ySE3T?9V?<HyNNaP?9VBgHyNNo`N?9\?< Hy8Hy:HyN O38N:98ySE3T?9V?<HyNNa.P?9VBgHyNN yg ?<a@TN& y g ?< a(TNaیNaۄNN &>VnJ.f`?<N T?9\N T?9\N T=| +_N^NupN( Magnification x Magnification xpN*NVBn(m(l:.KG8,sPfB.N^Nu:.KIJtPf |N^NuRn nfB.N^NupN(pN*NV(m9|(m9y(mBl yl UaNJg`N(m(lz:,p(m(lx8,ڄ-E:9KIIPBn&n:.K8.IEP@Rn n f&m&k8Ry(m9yN (mBl(m(l?,?<(mI* /NPN^NupN*NV=|=yBn*.x=E*.=E(m(l?,?<I* /NPN^NupN*NV-n(m(lz:,p(m(lx8,ڄ-E(n&nz&QN^NupN*NV=|=yBn=yV=y\(m(l?,?<I* /NPN^NupN*NV/9ƤaNX=|=yBn*9Ƥx=E*9Ƥ=E?9?<I* /NPN^NupN*NV/9ƠaX=|=yBn*9Ơx=E*9Ơ=E(m(l=l?9?<I* /NPN^Nup2N*NV=|=yBn=|?9?<I* /NPzK (nz:, pxI (nx8,ڄ-EzK (n lf`NzK (n lnzK (nHl /.N=PNbzK (n lfzK (nHl /.NAPN2zK (n lfzK (nHl /.N?PNNzK (nJlf`N-n=|=|=|=|(nJlg (nJlf=|U=|UN(n=l(n=l(n=l(n=lI* -EzK (n lf |NzK (n lfB.NYzK (nHl ././.N9&O-_*.x=E*.=EBnzK (n=l ?9?<I* /NPN^NupN*NV/-+N-n(n:HŋHEH N FxaNI* /aXNIɖ* /a|XNaNN(n?<HTa0\NNaNa@NNN (<DH\tttttttttttttttttttttttttttttttttttttttttttttttttttttttttt`htttp+_N^NupN*NV=|A=yBn:.KI?4P?<I* /NP=yj30j3̆BÿUHyjN!:X3:9HŋJgF yAŞf8(n 8Ť(n8Ŧ3j:.KI=tPN^NuN(:9Hŋ Jg3j=|N^Nu`hpN(pN*NV=|=yBn=n?. ?<I* /NPN^NupN*NV=|=yBn=n?. ?<I* /NPN^NupN*NV=|=yBn?9?<I* /NPN^NupN*NVB.Bn:.KIIPJTm0/ U?.&mHk&mHkaO :(_8JTm|Rn nfnN^NupN(p N*NV/-+NN)@UafJg`NUI* /HnHnNO =_Jnm`NzJno6:.KI?4P:.KI?4PaXN)?</9N \Bn:.SE=EBn:.SE=E:9ϬXE=E:9ϰYE=EBy:9ϪXE89DD=E:9ϪE89DD=E?9V?<HnI* //9ƴNlORy yf?9^?<(mHl(mHl(mHl(mHlN O(m?,(m?,(m?,(m?,aPN^NupN*NV(mIG&&=y=y=y=y(m l f`NBnBn=|=|?9V?<Hn/9ƴI^* /NlOBgz/N \N)@I^* /NXN)?</9N \=n=n=n=nBnBn=|=|?9V?<HnI^* //9ƴNlO=n=n=n=nByByz=EzE=Ez=EzE=E?9V?<Hn/9ƴI"* /NlORy yfRy yfzBnBn=|=|HnHnHnHnN*O?9V?<HnI"* //9ƴNlO?9^?<(mHl(mHl(mHl(mHlN O(m?,(m?,(m?,(m?,a@PN^NupN*NV(n:RE(m9E(n:,RE(m9E(n:,SE(m9E(n:,SE(m9E?9V?<(mHlIΦ* //9ƴNlON^NupN*NV/-+NBn:9ΪSE=EBn:9άSE=EHyaBX(mHla4XByBy?9?9HnNrP?9V?< Hn/9ƴ/9ƴNlORy yfRy yfBnBn=|=|BnBn=|=|?9V?< HnI"* /I"* /NlOHnHnHnHnN*O?9V?<HnI"* //9ƴNlO?9^?<(mHl(mHl(mHl(mHlN O(m?,(m?,(m?,(m?,aP(mIG&&+_N^Nup N*NV/-+N?<N T?9^?<HnHnHnHnN O=n=n(n=TUHnHnN>P=_:.H N N:.yϲf:.yϴf n lBnN:.yf:.yf n lBnN:.yf:.yfBnN yzf:.yϺf:.yϼf n lBnNb y zb yzd y zb" y ze:.yϪf:.yϬf n lBnNN 8`:.H N :?9^?<Hy(Hy*Hy,Hy.N O?<*<6/N \?9,?9.?9(?9*?9?9?9?9Hy(Hy*NO?</9N \?9^?<?9(?9*?9,?9.N jO ?9^?<HnHnHnHnN O?.?.?.?.aTPN:aN2aN*aN"aNafNN &.?<N T+_N^Nu Pencil Brush Airbrush Fill Eraser Text Magnify Jack Knife Lasso Block Line Ellipse Arc Pie Box Rounded Box Polygon Bezier[0][ Set Pencil To... ][ Opposite | White | Black ][0][ Fill To... ][ White | Black ]pN*NVU?9?< HyN-P332B9ǠB9ǬB9ǮHyxN.xX:9xEAHEBEHE~B9Hy4N.XI* /N.XIGz W?<@HyBgHyN0O Jyf`N:9xEAHEBEHE:B9:9xRE3x?<@Hy?9xN0>P 9\f(?<@Hy?<@Hy?<@HyN3@3B3D3:F3<H(yʆ3J(yʆ3LI>* #"N^NupN*NV:. KREgREH cAЅN*(n-O&OSEQ?. (nHT?<HyZN.O JyZnB.N^NuB(:9H N  z-E/9(?9ZB'HyƄN/O I>* #"?9ZHn/9"N/3@3B3D3UF3UH3J3LI>* /?<NՂ\ y2Je y2LdB.N^NuBy:9XEKEI>JtPfB.N^NuRy yf:9JEMEHEBEHEx89L//N,X*(9ưƬ&9|dB.N^Nu:9JEMEHEBEHEx89L//N,X*#ƈ#Ƭư(yʆ/ Y/9ƈ/9|/9ƬHyưN0O*(_(9yJ9yL:9JEM9EBl 9| 3F:3H* //9ʆN9&O#Ɣ#ưR*9Ƭڹ|R#Ɛ#ƈƌ|N^NupN(pN*NV?9\?<HnHnHnHnN OJ9jg:Jy|o2?9V?<HynI* /I* /NlONN?.?.?.?.N'PJ9jg:Jy|o2?9V?<HynI* /I* /NlONNN^Nu <N*NVV?< HyǠ?<@HyȂ?<@Hy@N^~OI&Gz W?<Hn?< HyǠ?<HnN* #"3>3@3B3D3:F3<H(yʆ3J(yʆ3L?<@HnVBgHyZN.O =yZYHn90I>* //9ʆN9&O#Ɣ:.yZf`NU?9ZN/TJf"U?<?<!Hy0NP3N?<@HnBgHyTN0O JyTm4U?<@HnN/\JfU?<?<!Hy0NP3?<@Hy@?<@HnN0O ?<@HnV?<@Hy@N0O NJU?9ZN/TJgU?<@HnVN/\JNqU?<?<!Hy0NP3?9\?<I* x?I* ?BgBgN jO N^NupN*NVJ9mg2<NkT?9^N T?9^N TB9mNBnBg?.?9?9?9n?9pHy(Hy*Hy,Hy.N O3(3*UBg?9(?9*?9,?9.N O 3^Jy^n U?<?<?HyTNP=_N"NHnHnHnHnN OBg?<HnHnHnHnN O:9,REHŋ8.E3(:9,REHŋ8.Enl 3(N2:9,Hŋn8.nEl:.ny,3(:9.REHŋ8.E3*:9.REHŋ8.Enl 3*N2:9.Hŋn8.nEl:.ny.3*?9^?9(?9*?9,?9.N `O ?9^?<HnHnHnHnN OBnBn:9nSE=E:9pSE=E=n=n:.nSE=E:.nSE=E?9V?<Hn/9ƴI* /NlOB'NkTN?9^?<Hy~HỳHŷHȳN OmByrBy|N^NupN*NVJ9mg?9^N T?9\N T?9\N TU?9̎?9̐N#X=_U?<?9?9?9?9N O 3\?9\?9 ?9"?9$?9&N `O ?9\?<HnHnHnHnN O?.?.?.?.N'PU?9V?<N(X3?.(yʆ?,HyHyNErO ?.(yʆ?,HyHyNErO IGzW?<N*TJ9mg(?9^?9(?9*?9,?9.N `O N*<6Z#IjBlBl/ ?9\?<Hl Hl HlHlN O(_/ ?9^?<HlHlHlHlN O(_Bgz/N \N^NupN*NV(yʖ:, Jg*<4#N*<4T#N^Nup N*NVUN,x=_?9\?<HnHnHnHnN O:9\nf?.?.?.?.N(PNlD:9\ng?9\?< BgBgBgBgN jO ?.?.?.?.N'P:9\ng?.?< BgBgBgBgN jO N^NupN*NV(yʖ:, MMJg(yʖ:, E(yʖ9E N^NupN*NV(yʖ:, MMJf(yʖ:, E(yʖ9E N^NupN*NV yzfH(yʖ:, Jg(yʖ:, SE(yʖ9E N(yʖ:, RE(yʖ9E NrNN^NupN*NV?<N TNlLBgN TN^NupN*NV?<N TNBgN TN^NupN*NV?<N TBnYHn90I>* //9ʆN9&O#ƔI>* /BgNՂ\BgN TN^NupN*NV33By?9?<I* /NPN^NupN*NVJ9jgBJy|o:?9V?<HynI* /I* /NlOBy|NUN,x:9\_f* /?< NՂ\3F:3HNP _f0N^NupN*NV:9̔HŋJg`N:.HŋH N iNs\NbNt:NXNsNNNtfNDNtN:NtN0?<N,6TN NvrNNhN NrNNdNNwNNsNNsNNb l4v*> XHNz:.HŋH N a?9VBgNXNFNwN *4HhxX yrf?</9N \N0 y|f?</9N \NBgz/N \N^NupN*NV?<N TJ9jg =|N=|NN)@?9V?.I* /NPNU?< HyǮ?<@HyǼ?<@HyN_O_NN)NJ.g`NVJ9jgX?<@HyBgHnN.O Hn?9zI* /Iɖ* /Nc2OU?.N/TJNqN?<@Hy?<HnN.O Jno`NU?.Iɖ* /Na\:yzf yɢf Jyɠf`Nz:9ɞx89ɜ//N,X*څ#ƈY/9ƈ/9|/9ƬHyưN0O#ɖHn?9zI* /Iɖ* /NfOU?.N/TJNqjByrBy|?<N TN^Nu <N*NVTNJ9jgB9jBy|#ɖưBɖ?9\?<HnHnHnHnN OUN,x:9\_gL:9̔HŋJf8?9\?< BgBgBgBgN jO ?.?.?.?.N'PNUN,x:9\_f`N?.?.?.?.N(P:9̔HŋJgX?9^?< BgBgBgBgN jO ?9^?<HnHnHnHnN O?.?.?.?.N8@PN?<N TU?<?<?<Hy̎Hy̐Hy̘Hy̔N-6O=_U?9̎?9̐N XJg`N:=|=|=|=|=y:=y<=yɚ=yɜHnN.xX:.EAHEBEHEET|:UB.V?<@Hn:.RE?N0>P .\f"?<@HnT?<@Hn?<@HnTN?9\?< HnHnHnHnN O?.?.?.?.N'P`?9\?<HnHnHnHnN O?.(yʆ?,HyHyNErO ?.(yʆ?,HyHyNErO ?<N*TN:9Ťy^f`N?9^?< HnHnHnHnN OJnnJno?.?.?.?.N8@PJnnJno>?9^?< HnHnHnHnN O?.?.?.?.N8@P`N4N^NupN*NV:9Ťy\f`N$?9\?<HnHnHnHnN O?.?.?.?.N(PJ9qgnB9q30 32"34$36&36r38t33 3 3N?9\?<Hy0Hy2Hy4Hy6N O3 3"3$3&3r63t833 3 3qN?9\?<?9 ?9"?9$?9&N jO N?9\?<HnHnHnHnN O(yʆ:9rnlc(yʆ:,n3r(yʆ:9tnlc(yʆ:,n3t3(yʆ?,Hyr?.HyNCO 3(yʆ?,Hyt?.HyNCO ?.?.?.?.N'P:.yrExE3H:.ytExE3Jl?.(yʆ?,HyHyNErO ?.(yʆ?,HyHyNErO ?<N*T?9\?<HytHyvHyxHyzN ON^NupN*NV:9Ťy\f`NN?9\?<HnHnHnHnN O?.?.?.?.N(PBg?<HnHnHnHnN O:9ŦyŪno:.yŪ3Ŧ:9ŨyŬno:.yŬ3ŨB9q3Ŧ 3Ũ"3Ū$3Ŭ&?9\?<?9 ?9"?9$?9&N jO ?9\?<HnHnHnHnN O:.yrExE3H:.ytExE3J?.?.?.?.N'PlN?9\?<HytHyvHyxHyzN ON^NupN*NV:9Ťy\f`N?9\?<HnHnHnHnN O?.?.?.?.N(P y2Ūl 32$N(:9Ūyo3$N 3Ū$ y2Ŭl 32&N(:9Ŭyo3&N 3Ŭ&3Ŧ 3Ũ"?9\?<?9 ?9"?9$?9&N jO B9q?9\?<HnHnHnHnN O(yʆ:9rnlc(yʆ:,n3r(yʆ:9tnlc(yʆ:,n3t3(yʆ?,Hyr?.HyNCO 3(yʆ?,Hyt?.HyNCO ?.?.?.?.N'P:.yrExE3H:.ytExE3J?.(yʆ?,HyHyNErO ?.(yʆ?,HyHyNErO ?<N*T?9\?<HytHyvHyxHyzN ON^Nup N*NV:9Ťy\f`NUN,x:9\_f`N?9\?<HnHnHnHnN OJ9jg6Jy|o.?9V?<HynI* /I* /NlO?.?.?.?.N(PBn:9ŦH N Pn:.M3vU?9vHytND\:E=EN:.M3vU?.(yʆ?,?9vHytNDO :E=ENU?<HytND\:E=ENz yg,U?.(yʆ?,?<HytNDO :E=EN@:.M3vU?9vHyrND\:E=EN:.M3vU?.(yʆ?,?9vHyrNDO :E=EN ygU?<HyrND\:E=EN yg,U?.(yʆ?,?<HyrNDO :E=ENp ygU?<HytND\:E=ENF yg,U?.(yʆ?,?<HytNDO :E=EN ygU?<HyrND\:E=EN yg,U?.(yʆ?,?<HyrNDO :E=ENN :x>hjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjj0jj nf:U?.?.(yʆ?,Hyt?9HyNEO3JN@ nf6U?.?.(yʆ?,Hyr?9HyNEO3H?.?.?.?.N'P?.N*TJ9jg6Jy|o.?9V?<HynI* /I* /NlOBnN^NupN*NV:9Ťy\f`N4?9\?<HnHnHnHnN O?.?.?.?.N(PJ.gn yg`:9ŦygR3Ŧ(yʆ?,Hyr?.HyNCO ?<N*T:.yrExE3HNl:9Ŧyg\ ygR3Ŧ(yʆ?,Hyt?.HyNCO ?<N*T:.ytExE3J?.?.?.?.N'PN^NupN*NV:9Ťy\f`N?9\?<HytHyvHyxHyzN O?9t?9v?9x?9zN'PJ9jg@Jy|o2?9V?<HynI* /I* /NlONN?<N*TNN[6By|N^NupN*NV:9Ťy\f`N$N?9\?< BgBgBgBgN jO ?9\?<Hy~HỳHŷHȳN O?9\?<HytHyvHyxHyzN O3~ 3̀"3̂$3̄&3|3rJ9jgDJy|o2?9V?<HynI* /I* /NlONNN"J9,f?</9N \NN:9Ťy^f`NNJ9,fN?9\?<HnHnHnHnN O?.?.?.?.N(P?</9N \?9^?< BgBgBgBgN jO ?9^?<Hy~HỳHŷHȳN OByr3|By|NN^NupN*NV:9Ťy\f`NU?<?<:HyNP=_ nfNhI* ʆg@I* #ʆBn:.K IZ8.I GǠP@Rn nfJ9jgB9jBy|#ɖưBɖJ9igUN'zi?9\N T?9\N TBy\J9mgNmN[63j?9VNTN^NupN*NV:9Ŧyf`N UNR _f`NzƬg`NJy\gJ=|:9SE=EU?.?.Nh@X3dJydo?9dN[TNNr3:9K EI9PRy y fBy33UHyHyHyHyN DO33VHyHyVHyNO J9/g`NUBg?9?9?9?9N O 3\?9\?9?9?9?9N `O NH?9\N T?9\N TBy\?9VNTN@UNJf?9VNTN"3?j yzfUN#FiN U?<?<:HyTNP3N^NupN*NVJ9jgJ yrf4?9V?<HynI* /I* /NlONB9jBy|#ɖưBɖ?9\N T?9\N TJ9mg?9^N TBy\UNJg:NJ9mg(?9^?9(?9*?9,?9.N `O N@?9VNTJ9mgB9m?9^N TBy^N[6fN^Nup(N*NVBgz/N \Bg?<HnHnHnHnN O(yʖ-lBnBn:.KEIBPRn nf?<?<HnNfPYN-_*.څn -EU/.?<HnHnHnNO=_:.KEI(.ܸPcJng` nf`Nv*.ܺd-nY?.HnN"\#Ƭ#ƬN#Ƭư#|(yʖ)n# ƈY/9ƈ/9|/9ƬHyưN0O#ɪ:.H8.H//N,X*#ƈ*9ư(<عư#ưI/ Y/9ƈ/9|/9ƬHyưN0O*(_(9n9n:.EHŋ9EBl 9| BlBlBlIGz&QB*9ưƬ(9|#|#ưƬB9/N /N^NupN*NVN)@J9jgNBgz/N \U(yʖ/,NvX=_ nf`NfJ9igUN'ziJ9jgB9jBy|BɖU/9NN0XJNqNH?9\N T?9\N TBy\B9m?9VNTJ9/f43(3By?9?<I* /NPNJ9jgNN)N^NupN*NV:9y̎f:9y̐g`NZUN,x:9\_f`NB?9\?<HnHnHnHnN OJy|o.?9V?<HynI* /I* /NlOBynByp:9ɚSE3r:9ɜSE3t:9ɚREHŋ89̎E3v:9ɜREHŋ89̐E3x:9ɚMy̎SE3z:9ɜMy̐SE3|:9ɚREHŋ89̎Enl&:9ɚREHŋny̎3n3v:9ɜREHŋ89̐Enl&:9ɜREHŋny̐3p3x:9ɚMy̎8.nEl0:.ny̎89ɚLDSE3r:.nSE3z:9ɜMy̐8.nEl0:.ny̐89ɜLDSE3t:.nSE3|?9V?<HynI* /I* /NlO3̎3̐N^NupN*NV y|fUN,x:9^_g`NJyrf`NJ9,gP?9\?<Hy~HỳHŷHȳN O?9\?< BgBgBgBgN jO 3|J9,fUN,x:9\_f$J9jg NN?</9N \3rN`ByrJ9jgBJy|o4?9V?<HynI* /I* /NlOBy|NBgz/N \N^NupN*NVUN,x:9\_f y|f J9mg`N?9\?<HytHyvHyxHyzN OJ9jgBJy|o:?9V?<HynI* /I* /NlOBy|NJ9,gh?9t?9v?9x?9zN(P?9^?< BgBgBgBgN jO ?9^?<Hy~HỳHŷHȳN OBy|N`Jy|f8UN,x:9^_f&3|J9mg?</9N \N y|fBy|Bgz/N \N^NuN(NVI* .EUN3Jyl"U?<?<,HyNP3N8NVH3(3By?9?<I* /NPUHyjN!:X3J9jg$ yrf:9HŋJfN:9HŋJg`N ?<N T yŞb`N:9ŞH N NNNLNN$NNNNHNNNxNNnNNdNNZ<NTNJB'NTN4H N":9ŞM EfIŞ* /N2XN:9ŞM Ef`N:9ŞE3Ş:9ŞH N NNN|NN6bNNrNN?<HyŞN\N|?<HyŞNH\NfN~N\NNRNZNHNrN>NN4NN*NN N  *4J`jt~NByŞBgN T:9HŋJgN:9HŋJgNt:9Jg?9̖NyT:9HŋJg:9HŋJfN`NHN^Nu DTPaint DTPAINT?.AC?\:\*.IMG:\*.CL?TEMP Pencil*.IMG*.MAC*.P?3UNTITLED.IMG Saving [0][ File was not found ][ Sorry ][0][ Too many windows open | Close one before continuing ][ Ok ] Magnify[0][ Set Active Windows ][ Inactive | Cancel ][0][ Set Active Windows ][ Active | Cancel ][0][ Picture Save Algorithm ][ Fast | Cancel ][0][ Picture Save Algorithm ][ Short | Cancel ]\DUMP.IMG[0][ | Flip Image | ][Horiz|Cancel|Vert]EXTERNAL.IMG[0][ Do want to continue | to edit the previous picture? | ][ Yes | No ][0][ Do you want to save | your work? | ][ Yes | No ][0][ This Accessory only works | in high resolution ][ OK ][1][ | Accessory Not Installed | ][ Too Bad ]~"*  (       6     .  &  " &     "                   $                    (d  ( j0f(: 6.8 ,80* D8D&"V    B8              : 8   J2.fJF">  @ 2                  p& :.`jD(,j.V 0$z "  T@(*6  "  (.V$  4  , Px4.&  " "  " "       D       D 2 "        &    < ,      " "                       (            ,< < D   .   z (    .         6       *    *           $   "F   (  l "       *              *       .@@6@@ > ."6* .6 0" &              .    ,   ,  "       &       n  p  r  p6>$&>$6& ( "8B(,F(:& ( &0\6*"   j4$0 \0 8,,,,$0 ^@.40<",  68L8& @ . <&$ 0   \ ,      "                & \ *B   ( HHH :<   RP*"<           6L        H           $>` : "8   &      $    *8>l    b x p p R B 6  "l " &V   &p   (Z   *h &        ,: ,,,,2 Zl           2  22  6`"   &  .  <..X$ ",d$ $$, :H@&JN>4,4" 4BPJl" &   :&&($$$ t $  " ,66 B:        $ F  "H  "x  " &2""L,66 8(&:      $ F  "H  " &"""H  *:     $ F  "H  "x  " &,""H          $  &(    &   && R* 0&  "  &2   6  0 0       0         . 6   ."6 0h   $    R      F  <"  (  0 ,&      & Z 04 : >0    4 2$          *  ,"  (   $2$26   B 0 0(@*$:2*$ 8  R,:( 0 2,$  ^"> &(""" . 4"N2 4" 4"N2 4"** $ $"   *  * "  0   0  "  0   *  "  0   0  >   6 .. . 6.H&.&.., 6.B.$ 6 .".  4" $4"  D(2 2".  V  V@  *222$ :"b& @, $ B 6D* .  ($ $@,<: 6*>" $, D ($  : H."$ 2"D \4"6h $ $ $" $&   jL4z@(N 2 2:$  $ xR$0N("JF(\(L>X*  tx$.$(   \   \ J   \*"(T(T Z                8 *     44    * : 2*        $4   0 ~   P       * n  *4L *           $    *  * * 64(">4(">*("("`0 $*"B $*"B    * "4"     4 .06 6 "Z       :4      ..  " 2,"$,>D 0>L      n00<*  "" V,* 4^n  4 0RR \X.                 H             @*   , <J ( :h   4 6*0    6   *06   2 ` " $   *6 .   4 "   .   *6P    0    *8(     0   `            ,,      J   ,:  :  ,(                                              $$      (              $ $  4                                  $         (                    * 4( " (            .       .           (    8*4   2  0                                                        &    &                                                                                            > 0V   D                                          >     , DTPaint Desk Accessory w/Active Windows v1.0md Monochrome Version all code and documentation Copyright 1989, 1990 by Michael Bergman Well, It's been a long year since I originally wrote ImageEditor DA and I promised a more friendlier user interface. I said that it would take no longer than a couple of months and I was right. What I didn't bargain for was the time it would take to develop some more sophisticated graphic tools. What you have here is a demo version of that effort. This desk accessory does not save in .IMG format, although it will save blocked images in a propriatary format. You may have noticed that the only other file in the archive is the desk accessory itself. There are no "support files". DTPaint is totally self-sufficient. All code, resources, and images are embedded in the accessory. This way, you are not surprised to find that you have less memory that what you expected. Also, it makes resource handling a tad more stable. Over and over again I get the same questions: "Why a desk accessory?" "Don't you think a desk accessory is less effective than a 'real' program?" The reason for a desk accessory paint program is that regular paint programs are a dime a dozen. You can probably name that many right now, both commercial and shareware. The idea of a desk accessory paint program is to let you, the user, create or edit pictures without having to leave the program you are currently using. This allows greater flexiblity of the environment and interactivity with the current job. In other words, you don't have to quit the current job, start up another graphics creation program, load the picture, edit, save, quit, load in the original program, load the saved files and then load the editted picture. All you have to do is call up the desk accessory, edit a picture, save it and import to your current program. It almost qualifies as a multitasking environment! The differences between this program--DTPaint--and ImageEditor are vast although DTPaint was borne from ImageEditor. DTPaint is a full paint program. In other words, you can not only edit existing pictures but create them from scratch as well. I have maintained some of the keycommands from ImageEditor, but everything can be accessed from "The Menu" (press or select the DTPaint desk accessory menu) and the Toolbox (press t or select "Show Toolbox" from "The Menu"). Both will pop-up under the mouse so you don't have to go hunting for them. Page 1 of 8 What is "Active Windows"? Active Windows is a convenience feature. It allows you to access the Toolbox without actually having to click on it to activate it. The Toolbox, if it is open, will automatically activate as soon as the mouse leaves the picture window and will deactivate when the mouse enters the work area of the picture, except if the mouse is also over the Toolbox itself. You can toggle the Active Windows feature by pressing . By making the Active Windows feature "inactive", the windows will act just like every other GEM windowing system. If you do decide to use Active Windows, it is best to keep the Toolbox up at the menu bar on the right. That way, you won't "lose" the Toolbox under a full window. Just move the move into the menu bar, wait for the Toolbox to activate then bring the mouse over the Toolbox and make a selection or move the Toolbox. How about a tour of DTPaint? Let's start with "The Menu". The easiest way is to press the key and "The Menu" will appear under the mouse. The entres include: About DTPaint Brings up the obligatory "About..." box. New Lets you create a new picture. Load Load in an existing .IMG, MacPaint or Degas Elite picture. Quick Save Saves the picture under the existing file name. Save As... Lets you save the current picture under another name. Show/Hide Tools Shows or hides the Toolbox. Show Information Shows picture's width, height, resolution and compression. Save Preferences Lets you save the Tools' attributes and memory configuration. Memory Allows you to free or allocate memory dynamically. Page 2 of 8 Next, let's look at the Toolbox: First off, the Toolbox, which should have come up under your mouse (unless it is in the menu bar, in which case it will be just under the menu bar), is movable. All you have to do is press the left mouse button anywhere in the Toolbox area and drag it across the screen. It should be noted that, although you can press the mouse button anywhere in the Toolbox, if you presss it while the mouse is above an icon or fill pattern or brush pattern, you will activate that particular tool or pattern. It is always best to drag the Toolbox at the middle of the Toolbox, at the Fill Pattern Display (at the bottom right corner) or on an active icon/tool. Along the bottom of the Toolbox are the standard Atari fill patterns. All fill patterns are auto-locked which means that it doesn't matter where the window is or what section of the picture you are editing, the fill pattern will automaticlly lock onto the left edge of the actual picture. The program will adjust the fill pattern to match the section of the picture you are working on. The patterns are editable and loadable. If you double-click on one of the fill patterns you will get a dialogue box that will let you edit the pattern, save it to file, or load in a new pattern file. When you exit the dialogue box, the new pattern will appear in the box where the old one was and a 32 pixel representation will appear in the Fill Pattern Display. Next to the Fill Pattern Display is a white and a black box. The box that is outlined is the active box. By selecting these boxes, you can reverse the colors of all of the fill patterns in the pallette. At the top right corner are the brush patterns and the line patterns. You may only select or edit brush patterns when the brush tool icon is active. Brushes can be editted, saved and loaded just like fill patterns. In fact, their file formats are identical so they can also be interchanged. In other words, fill patterns can be used as brush patterns and vice versa. Line patterns can only selected when using the line, oval, arc, pie, box, round box and polygon tool icons are active. Line patterns can only be editted. They cannot be saved or loaded. Page 3 of 8 At the top left corner are the tool icons. The are, from left to right and top to bottom: Pencil Just a simple drawing tool used for scribbling and scratching. The Pencil has three modes: black, white and opposite. Double-click on the Pencil icon and an alert box will open up to let you choose which mode you want to use. In the opposite mode, the pencil will draw in the color opposite of the color under the mouse when you press the left mouse button. Release the left mouse button to stop drawing. Brush Use the brush patterns at the top right of the Toolbox plus the fill patterns to brush patterns over the picture. Press the left mouse button and apply the "paint". Release the left mouse button to stop "painting". The fills will be applied opaquely unless you hold the key down when you first press the left mouse button, then it will apply the fills transparently. Airbrush A random pixel changer that will change the pixel to fit the chosen fill pattern. The radius can be adjusted from 1 to 50 by double-clicking on the Airbrush icon. Hold the left mouse button down while you paint and release when you are finished. Floodfill This will fill any area with a chosen fill pattern. You can choose to fill a white area or a black area by double-clicking on the Floodfill icon. Eraser/Sandpaper This tool will erase anything on a white background or a black background. The modes can be selected by double-clicking on the Eraser icon. There is another mode called "Sandpaper". This mode oblitterates anything under it and creates a chaos of black and white pixels. The effect can be much like charcoal. Text A GDOS Text tool. This will allow you to use up to eight GDOS screen fonts. Double-click on the Text icon to select other features such as 90 degree text rotation, transparent, etc. The light text mode will take the current fill pattern and superimpose it upon the output text. This desk accessory is also G+Plus compatible, which means that you can load in different Assign.sys files provided G+Plus is loaded. GDOS does not have to be resident for this tool to work. The Text tool can still use the fonts resident in ROM. This tool also lets you access the extended ascii set. Press the "up" cursor key for the upper 128 characters and the "down" cursor key for the lower 128 characters. The default is "-128". To use the Text tool, click inside the graphic window and type. You can move the text around with the mouse. When you are finished, press or the right mouse button. Page 4 of 8 Magnifier This feature is one of the few things that hasn't changed since ImageEditor. You can select the magnification by pressing 1 - 5 which is x2 through x32. There is a box on the left side of the split view, this is the magnified area. That box can be moved by placing the mouse inside the box and when it turns into an open hand, press the left mouse button and drag. Moving the mouse to the right side of the split view and you can edit the magnified area with the pencil. To exit Magnified mode, press the key or the Close Window box. Jack Knife The Jack Knife allows you to cut an irregular section out of the current picture and paste it elsewhere or save it. Click the left mouse button to start the cut and click again to close the loop. Normally, the Jack Knife has no effect on the underlying picture when you cut, but if you hold the key down, that section will be removed. If you hold the key down when you put the knifed image on the picture it will copy the image to the picture transparently. To release the knifed image and clip buffer, just double-click the mouse inside the window and the regular knife mouse should appear. To save a Jack Knife image, double-click on the Jack Knife icon. Jack Knife images should be saved with a .CLK extender. To load an image, make sure the clip buffer is clear and double-click the Jack Knife icon and a file selector will appear. Lasso This works exactly the same as the Jack Knife but the effect is different. The Lasso will tighten around all black borders. This is meant to be used when you want to make a sloppy cut but don't want any of the white are that you would normally get with a Jack Knife. Lasso images should be saved with the extender .CLL. The Pattern Camera The Pattern Camera will allow you to capture any pattern on the screen and use it as a fill pattern. Clicking on the Camera icon will put you into the capture mode. Click the left mouse button to capture the pattern and the right mouse button to cancel. The pattern edit dialogue box will come up automatically in case you want to edit the fill or save it to file. Reverse Colors This will reverse the colors of the entire image. Block This works like the Lasso and Jack Knife except that it cuts rectangular blocks. Block files should be saved with a .CLB extender. Lines/Rays Double-click the Lines icon to choose the features in Lines/Rays such as drawing modes, end types etc. For Lines, click the left mouse button to start the line and the right mouse button to end the line. For rays, the same is true, but you must press the left mouse button to lay down more rays. Ovals With this tool you can draw circles and ellipses. Click the left mouse button to start and click again to end. To select features double-click on the Oval icon. Page 5 of 8 Arcs All you have to do is click the left mouse button to start the Arc. Click again to anchor the start of the arc and click one more time to finish it off. A dialogue box will come up for the different features of the Arc tool if you double-click on the Arc icon. Pies This tool works the same as the Arc tool. Boxes This tool works the same as the Oval tool. Round Boxes This tool works the same as the Box and Oval tool. Bezier Curves This tool will allow you to construct bezier curves with up to 64 control points. Note: as you use more control points, the redraw will slow down since it needs to calculate all of the points. Four to ten points are recommended. You can change the drawing attributes by double-clicking on the Bezier icon. Pipeline This feature has not been fully tested yet. This will allow DTPaint to talk to other program that uses the DTPaint pipeline, to swap blocks of information and will allow other programs to use DTPaint's image compression algorithms. Full documentation will be forthcoming as soon as all of the features are tested. Flip Picture This will flip an image left to right or top to bottom. Picture Capture/Dump This feature will allow you to dump a section of the screen to file as an .IMG picture. Normally, the Toolbox will disappear when select this feature but that can be overridden by pressing the key. Crop/Pad This will allow you to change the dimensions of the picture you are working on. You can trim off excesses from any side, or pad the picture if it isn't the correct size for what you need. The dialogue box will come up automatically. Page 6 of 8 Some things you should be aware of: For some reason DTPaint and NeoDesk don't get along very well at all. I have used it in conjunction with v2.01 and it seems to work fine, but some of my testers have been having problems with later versions. So far, there are no clues as to the real problem. This version will work with TOS 1.4 and the Moniterm monitor. In fact, all of the dialogue boxes will come up under the mouse when you are using the Moniterm. Otherwise, they will be centered on a regular Atari monitor. There are two compression schemes available on this version. One is very fast but eats up a lot of disk space. The other is slow but very efficient. It is the most efficient scheme possible while still maintaining compatiblity with other DTP programs. You can toggle the compression algorithm by pressing the F4 key. The F1 key will force the mouse to appear, if you happen to lose it. The F2 key will allow you to change the resolution and aspect ratio of the picture. The four example at the bottom of the dialogue box can be selected directly. Just click on one of the examples. and offer one level of undo. You may find that the mouse buttons do not respond well under DTPaint. This is not a fault of the program. The easiest way to rectify this is by loading the Control Panel desk accessory and adjusting it so that it is comfortable to work with, then write out a desktop.inf file with these new settings. Although, this desk accessory allows you to allocate and free memory dynamically there are a few things to note: Due to a bug in TOS if you allocate memory, run a program, exit and free the memory, the memory will become fragmented. This desk accessory tries to overcome this problem by allowing you to allocate memory from a fragmented section. The fragmented section must be at least 80 Kbytes. Also, if you have freed up memory and are running a program that takes all memory for itself (i.e.: some of the Timeworks products and Flash) then you will not be able to allocate any memory and the memory dialogue box will continue to pop up until you press [Exit] on the dialogue box. Well, I beleive that covers just about everything as far as the usage of DTPaint. I am in the process of writing some tools to go along with DTPaint and a color version and that may be finished by the end of the month (but you've heard that before). DTPaint is not quite available for sale. We are in the process of making it available commercially and when that happens, we will make the official announcement. Until that time, I thought you might want to take a look at this and give it a spin. Page 7 of 8 For legal purposes: I make no warranties or guarantees with respect to this product and the operation or use of this product. I cannot be held responsible for lose of data or information as a result of the use or misuse of this program. Atari and related symbols are trademarks of the Atari Corp. Timeworks is a trademark of Timeworks, Inc. Moniterm is a trademark of the Moniterm Corp. NeoDesk is a trademark of Gribnif Software. G+Plus is a trademark of Codehead Software. I own ImageEditor, lock, stock and circuitry. Michael Bergman 3368 Governor Dr. Ste. F-223 San Diego, CA. 92122 Page 8 of 8 2&2j2h<@ޥ>2$,0懌Ԁ$Desk Acc $$n:1AC?͢²z(pj^ḋZR +@p(2 8p"-HPp\ R/&&MDp"2ƶԣxT`vNqPRElprk겠@ Save PresetOB File As: p0,&x*NRpJBgp/prHآúbVhŘ2XN(d&4~tp1JցāP"N.This section of the program lets you create 'p¡ fs' for xManage$0K 3.0 higher. d contain lis TOP.INF, g` SSIGN.SYSandk AccessoriesWhenS runs,itarch]xEwith extensɡZdisplaysGm a seleÑsenbIȘ,Jl@J usoMin_ma8tot upå entire systw one easy p.BeaeveLsingB:>1. Entxa titk(VL 32 characs)‰TE2. Ss|ಥ,bepiedname.4`H3h128tenab^ (ClickV= _Cancel wlc'finish^choo<.)L4 ,ichUll˰7Z(Ypmay c8Nleaveis ry blank.) A5̾6 dahdf.)AI6n'custom'eCVcZeOaX fŕEc"o5o (any paths), rm.rM7&y’Ԃy8Ps hMextens6% 6f .PRE,d shouldrh\\"MGR.)~pNpw>Qp Pssy keymoubutt/conue... 4q ANf& C,r>A2B<8PJ(r N\ Drive: Ar0Apy4n r4J4b( tits  > ,H+ -------- 32 characs-\(PHĶ oN+|Z,maximum!tagainp x -n$g@`0B"zʘͦ`Hm4 :\*.INF"_NHPA(Hm,JBfp6 dNH <r$<@ L8NPHmL f -6Jg.ݠ"~+|JHbRj<R~SRZhӌ΁ɜJHxProgramsvr rrF F*.PR?NdJ<6 SSIGN.SYS F,4ऺ42~2444442r4H.464TFhFFDesk Acc8 FFn:SAC?8.888bvZ(, Do you wish to enter | any 'custom' f's?HP Yes |Nor"_ N+@6 -6V˖C⸂“ߖӖ ¬H Now select a @name( d path undwhich|save the preset|.  OKHpr$&>PREkʦ耶ڡ S|PO As:p0,&$x*$NRpJBgp/X&$dvd8NbnhD^9 That½ already| exists! antn replace it?4SVjtbX 0 Wouldliko cqtorS6UWH`~`\N4tVpZ9@A r @0 - )@B&FJNNNp4lTb\HPL60JV$`rfN~D|r0uzPPp} ,^A "-^ @ :THNv<8B +|$`HH:.:F:vtJ|>^D&<x*<~ۀ.ZJjJBnD0 NNhJBDp1Σ֥HbzCNHPHxBV&<ĺl"-N\H.JWf`߀߀рòᨅSZZZZB^Jrrr`ǜxNPLP樿NRhJB㐫䲈HP pNxC>6Nz0 򰭂_HTTTTAfNN4Hm&A(dƦr$r>pz>~z~ 8p"-HPp.``~ PRE|z:`NqNqfRfdB . Ԫp$ \J Ŋ,JT`N hprR&¸:\*.*tr "p>> Custom File #HP`鼱n,/| | Do you want to COPY | or RENAME this f?4rDx@ Copy|Rename|Cancel N6h6W V8S4/> C CN$HR¤2Source:ށNNp0,"4pB0v+mv$JH:zzVbFdpĄBT`@R醢0C| Now enter e path andwhich| will be copied.~8(a new ೀ. OK Destination:2pr2&"""¢."""""z"$LR&0NNqN*p RM8:`N40 Modifying: 4 -rpIគ2 pN/Rz4 A B"zܡzbnNo 4*pLꢺ꡺⠾깰R/"ⶅDpZPHP*.PRE 䠀ԤJf Save Preset4$¬ File As:6f &x*NRpJBgp/*$Èd bhhHx<; That f\0already| exists! Do you want | to overwrite it?  Yes!| Cancel 4P rUg " Skipp d6F8,^ W\ing New_ y: %㜣 llzpO>ᘉF4F( -VvH r$Lp+@"LBTV 1. DESKTOP.INF |bB¥VN$2. AUTOogram(s) 3 SSIGN.SYSq 4(esk Acct  5. Customt6. Function Key Assignme 7. Return Main Menup* p"-N\p4  ¡"Dp1z pJBgp/7$@xzrn",Press any k+ or mouse butt] continue...lll,` B Are you suwish|modify all the| selected ppet fTs? HP Yes!| Cancel 4r"_ N+@6删t NHL8N -|HPHxr N&*HPp;pN > <Ѝ/T _ѐTTmpr -xR쀬>PNR/*pr$ة4HdphplVVvXX:+|HxB"LhXp\`x*&HNpxHmDpa"_N p  AX0ZNP~NN~fNN4Arrp /-C NpNqNqN B2A Cd`6 j/-HmZg XhpHmJBJ6xVpxHPNHADC$NNqp`Nڠv:FŶnrHPp.LdPŎnQm D/p xSgNNăvVv&</XvhH\.^| 2b"_V`:Pv N&+@..?<NA\?-4 -FNNAP:ONAT:Jĺ+|3vp+z.ЭnJWHjކ8Ȋh`+mZ~́b\PR (N0+@..J"HH6:ᐂtlzNntlvNNNʝp$ pJBgpz$LRJRȅRΠNM\C킠>NXXb㼟xB^0b000NV͒nך߰߰߰߰ϰ+|>tĬbJfgJS+mJR n6A탠nt׼0nΩΦnΦ<ߦۦߦŦ:`NqNT"\0 N~ChFHmhp"_JBVޤB~AUV< Aa<ZGǠHHHHHHNq$g|hh N4 j ANC6 p.TdPpQmȀD/p @jňJĈܠHPF2njpRRSB>prt?"P Select the preset file(s) to modify.:ZrZ`Hmr :\AUTO\DESKMGR\*.PRE( ~JRBΟ܃ҁ΍ʆ/-BB4Fă>h$Rt4NqNqN^Lzr ^f 8If you wishassignnism function keyR:(F1rough Shift-F10), typhat now)Tany o<Torrs eiӠuse buttrdleavJV0 uned.tlDJBfD͞nDZU2<+@ z&<x*NpJBgp/$@bb@҃jЁ"FKEYp:"*-P Title: | { TOP.INF F | KeyJᖠFJHx /" bNonerprN.CpGAR/pFHPxxpr<݀*fņ"_NB2+m2RXpN`6pA6 z/-2ʁgXNpdPŨ 6pC NA@C$L :`JNqp2l -Jn<ѬBr\߸׸rhlѢlRR"+@"b NqHHHHH~HHdH&HߚVHHZH"HHZ,Z+|V XV -PSg8$`|:`NqNqNV6ਠ6d/傁$R2xH|dܠܠrN`0; Desk Manager:Ap "ESKTOP.INF FileHm,x\ఠt AUTO ProgramsV(Jnr΁전xx SSIGN.SYS)x(2(( Accessories&&׾&P&&&JXjh ; CustomlzzzzTb&(dtr>:zj+@~v"~D8p"hHPp.B>~BPRE|zrz RpJBgp/$ . v+mvrp RFD rĄHPDT`pO8p~ Manager:4槶 ESKTOP.INF!>,>,jAUTO Programs!::ۆxń㠄rr SSIGN.SYS22 AccessorieslJPb ; CustomfttttNh4,Hx  No f_ found! | 4HP<  Cancel  Nl6dpr |Left Button: Selectrr "*Esc/Righ3pt Changk& >ceedrClr Home: Clear AllionŒr BackspacPrevious Screenr,Undo: Exit Without SavingƲ2&B"\"6| N Z`\8N | FL4T8>BNXX.0F R0^ a >.J( Y F0 2S HLP#XjXV6(`jj |dXL< *d f0 6 &x >n T(D6v\ XTH(8:P$.\x F,,N6N,*& T $ V: V6 BG *  r nR pn<8RjFx|hXXlb,**P(Rx< 8NBLdN^Z.:Ptt"B(&0b6@4D~&""*HBF N P\2&4TFNRvЮȜDFb<hJLd&oG K` r@HEQ`QpmW KC ,H <z""*H <""(H <Ub"" "KHH@HtJgpӑbCgA,0</|Nr C 5e&!R 0c 9c0`<R"_`VC0 Ef"_Nuaa/ CFr  g 00VJAgB @ nN @mHJ@j0.4DBUBk0QSAg Q.`S@k 0`0BAF "_Nu.WAkQA 0g` @$@JfS a `QNu$Aa`QBNuHPHQ0(ika $I _apIUd4Id4Id$Id `$$$$Q _Jf,a@Id4Id4Id$Id `$$$$Q @NuSaIdIdId`Q @Nup `t/ a $I> _a вG` VNuag`af`ae `ac` acpNuadpNu/ a $I> _a 4Ae4v` VfANuHP0(R@kBa r $I _a ZIUd4Id4Id$Id `$$$$Q @JfNuNup `a SAfNuag`af`ae `ac ******************************************************************** Deze diskette is samengesteld door de Stichting ST, Postbus 11129, 2301 EC Leiden. Onze bibliotheek van public domain programma's omvat op dit moment (herfst 1991) al meer dan zeshonderd disks. Daarop vindt u programma's op elk gebied, van tekstverwerker en database tot de leukste spelletjes, de fraaiste tekenprogramma's en de handigste utilities. Ook bevat onze bibliotheek een speciale afdeling voor public domain disks met Macintosh software, die te gebruiken zijn onder de ALADIN emulator. Deze MAC-PD serie bevat tot nu toe ongeveer vijfendertig disks. ******************************************************************** U vindt in het twee maandelijks tijdschrift "ST" (Onafhankelijk tijd- schrift van en voor gebruikers van Atari ST computers) een overzicht en een bespreking van de inhoud van de nieuwe public-domain diskettes. Dit tijdschrift bevat tevens een bestelkaart zodat U vlot over de software kunt beschikken. De Stichting ST geeft ook een speciale PD catalogus disk uit. Deze public domain disk is geproduceerd en gedistribueerd door: ************** Stichting ST afd. Software Bakkersteeg 9A 2311 RH LEIDEN ************** Ondanks onze controle komt het af en toe voor dat een diskje niet goed is gecopieerd.Mocht U dit overkomen, aarzel dan niet en stuur de defecte disk aan ons terug. U krijgt dan direct een vervangende disk toegestuurd. ************************************************************************ Teneinde het voor ons mogelijk te maken om productiefouten op te sporen en vervolgens in de toekomst te vermijden, zijn alle disks, geproduceerd door de Stichting ST, voorzien van een groen productienummer. ************************************************************************