@L}5 _$% l0$)$$Hȱ$ UhL" `e$$%`$%`  R@W!( L(1   Y I`  d  Ld M * @  $ % CC$$)%1 Udߥ$9%: !0 S$% DD˙`  }J)Lr $$KKK3WDLITTLITLKEYRCONLXLIPWRDDIFNWPLPLMMKLSMLWSMFNPLMAPNMWRDVLCOLOMSEC}CCCSELBDGAPLRMMSCMOGSDDXYTGWWCWCCL@@@@}@@ @ } !"#$%&}'()*+,-./0123456 }789:;<=>?@ABCD }Ǫ¸ǵĠŠ٠Š̠6-@6-@'6-@2;@,9@ },9@,9@,9@,9@,9@,9@,;,;, 6-68,-@5'68,-@<68@ },-AcQ68@,-A1]6-@i6-@u6-@ 6-@6- @ Q6-P:@$H:,,%@ };6-P:@$H:,,%@C1Q@ $  6-- 8 8,"8,,# @,B:,86}-@   $c AF:A,&@$+?6-+F:A,%,$AVK-@U B"c-A`%}F:BsD%, .AV'AV<-@J-@N"`$@%%' 6-%  B#' @P}X-"@)"@5)"A1)"AcI2@@@O6-U6-X$ + 6--&@%"@}+6-"a"8,*"8,*"8, 6-&6-/68,-56-W2@@@a @@$! 6-%  }@!6-&$($ 6-&6-6-!2$$2$-@68,- $6-4[ @h6-6-%6-@B}+6-16-76-=6-C6-I6-O6-U6-[6-6C 6-6-P:@$H:,,%CAA A0A@}8"6-B:,:96-B:,%@-568,-P:@ $H:,,%9 <(68,-@:7,,%"(6-%@d> 6-%}!A`6-@368,-8,%8,%8,!6-%-"@36-B 6-% @`Dk A068,-@$6-%}368,-@5;6-%J68,-A1R6-%a68,-Ack @xF>-&@@E:,+@ &B:,,'%@}> J0-&@8,!8,0,8,@L   $N96-@6-@%+@9AV'AVO}IP:$H:,,6-Aa'6-@336-A)?6-A0I @P'6-@36-Aa!6-'6-Qg-@}'6-P:@$H:,,%K@@@@S0W ]6-g BR#(6-6- 6-@#$T})(6-6-@&6-@)$V)(6-6-@ &6-@)$W)(6-6-@&6-@)$X } @Z(@}$_@ @,,@1,@@=,@@$d@ @,/@}+,@=/@@@$@ @,/@+,@=/@@@$F @,/@}1/@@=/@C/F$@ @,/@1/@@=/@@$@ @,}@/+/@=/@@@$X@ @,/@1/@@=/@@$@ @},@/+/@=,@@@$ @ @,@+/@@7/@=,@$@ @ },/@1/@@=,@@$@ @,/@1/@@=,@@$% (!}8,6-#B% @V% (8,6-#B % @V1(8@,6-@'#B01 @V1(8"}@,6-@'#B@1 @VV A~I 6-6-P:$H:,,%) @)"3 @96-?6-CI,#}$)2A0@@#),  6-% A0 !6-&  6-% AP $}!6-& 1,K "*"26-!',-6-36-?6-@2E"K6-R:,"@%}- $[@w6-256-P:@0$H:,,%A @K @U@c[, "6-&} ")" AP A P<-@ @"8,(,, 26-< A&7 6-6-@!6-@'}-6-@B7 B{-+@ &B:,,'@ +(@9-A= G@2S,@ e/@@ (}q6-@2{ A&2 6-R:,(2@@@224G6-+"@)"@)"@,&+"@ ))}"@)"@,6-+"@)"@ )"@,&+"@)"@)"@, 6-%6-%6-6-` *},&& 1 A)(  , ? 6-%/+"*"*!* @,)+"*!,56-? A " +}$ (T:,B R:,"@A' A PT 9"Aa)"@3!6-&)6-&/6-9 A&^ E",}@c;A A A A A 0E A&h  " AU A&r '  @02' A&-}   6-@ !@6-   6-@ !@6- %"@*"@%6-@.}  (+),6-  (+),6- %"@*"@%6-@  A0$ %!@* @%6-@ /}& %"@)"@%6-@0 $# AP#B#6-@ Z-@"-*(@. 0}8@>,Z2@ @@ (T:, B# @PA70P:@$H:,,P:@$H:,,P:@$H:1},,$A AE0Y AP#,@ @)6-3 @= A1G A Y"*"A (A ] 2}AP,@ ' A1-6-7 @A A1K A ]"*"A : "@Al Y AP3},@)6-@3 @= A1G A Y"*"A  "@A%} 6- AP#,4}@/,@ A,@@S,@ @_6-@ i @s A1} A %"*"A %(5}A%(A &"@AH&` A#,@@/6-@56-? @I A1S 6}A `(A'a 6- A#,@//@A-@@G"Q B[ Ba6-'"7}@ B!'\-@@$(@*. @p46->2H A P\"@A@$'(A8}'l A#,@@5/@@A6-@K @U A1_ A l(B ((B <9}(: A6-@# @- A :(B(A A6-@# @- A A"@B)A:} A6-@# @- A A"@Bh)` A,@)/@56-@ ? @;}I A1S A `(B)"@B*: @6-@# @- A :(B*(B<}*"@B*: A 6-@# @- A :(B +"@B\+A A6=}-@# @- A A"@B +: A6-@# @- A :(B$,: A6->}@# @- A :(B L,"@B.g A,@)/@56-@? @?}I A1S A g"@BD/A A6-@# @- A A"@B  Nl A#,@}@@5/@@A6-@K @U A1_ A l(BN: A 6-@# @-A} A :(BN: A6-@# @- A :(B0u[[255,255,255,255,255,255,255,255,126,195,B}231,153,153,255,165,255,0,0,167,165,253,5,7,05u0,0,24,60,153,219,255,255:uRECOMPENSEDuSCHEDULENuGRATUITOUSXuC}PORRIDGEub-+@ &B:,,'@+(@9-A= AM,@_/@@b$\v"@BD}Bav@EA'Pfva ,68,-68,-'6-%-6-96-@BE6-@Q6-@U[,a6E}-v(T:,BPv A'P$w,-&@68,-%68,-) ,$ {8-&@6-@:7,,86-+@ &B:F},,'%&{1@{/'")%")%A(")%A`"/6-%{-@(@>:, {   6-*{ "G}68,-4{I "6-%0@52@@I @B@>{9 "6-2'0@/6H}-%9 B }> 68,--@002@P@4 >2 }T:,B }#"@ B!# AI} P} @Rd}",@/@"$}i +@-@5(@G-@ @WJ}(@i-@@} (@ STEVE GROLL $,~@ 2+-4(TYPE E FOR AN EASY GAME.@-@K}@~M(TYPE H FOR A HARD GAME."(&)(14H76-C6-@0M B#0E~6-@6-@pJ~F7(.WOULD YOU L}LIKE TO ENTER NEW WORDS IN THE GAME;C4NF$O~BBPT~E(E(:TYPE ONE WORD AFTER DATA AND PRESS RETM}URN ON EACH LINE.^~/(,(!TYPE CON. WHEN READY TO CONTINUE./~$D2:WORDADV.BASN}2TOO MANY DIGITSINVALID HEXA^ ӛ四PA1 (10 ms) - Before BB,DD,GG,and JHPA2 (30 ms) - Before BB,DD,GG,and JHPAP}3 (50 ms) - Before PP,TT,KK,and CH and between wordsPA4 (100 ms) - Between clauses and sentenQ}cesPA5 (200 ms) - Between clauses and sentences (these can be doubled)IH - sitting,strandedR} EH - extent,gentlemen AE - extract,acting UH - cookie,full AO - talking,song AX - lapel,instruct AA - pottery,coS}tton IY - treat,people,pennyEY - great,statement,trayAY - kite,sky,mightyOY - noise,toy,voiceUW2 - inT} monosyllabic words: two,foodOW - zone,close,snowAW - sound,mouse,downEL - little,angle,gentlemen ҭ EU}R1 - letter,furniture,interruptER2 - monosyllables: bird,fern,burnOR - fortune,adorn,storeAR - farm,alarm,garmentYR - V}hear,earring,irresponsibleXR - hair,declare,stare WW - we,warrant,linguistRR1 - initial position:read,write,W}x-rayLL - like,hello,steelYY1 - clusters:cute,beauty,computerYY2 - initial position:yes,yarn,yo-yo X}VV - vest,prove,evenDH1 - word-initial position:this, then,theyDH2 - word-final and between vowels: bathe,bathY}ingZZ - zoo,phaseZH - beige,pleasure FF - *These may be doubled forTH - *initial position and Z}usedSS - *singly in final positionSH - shirt,leash,nationHH1 - before front vowels:YR,IY,IH,EY, EH,XR,AEHH2 - bef[}ore back vowels:UW,UH,OW,OY, AO,OR,ARWH - white,whim,twenty BB1 - final position:rib; between v\}owels:fibber; in clusters: bleed,brownBB2 - initial position before a vowel:beastDD1 - final position:played,en]}dDD2 - initial position:down; clusters:drainGG1 - before high front vowels:YR,IY, IH,EY,EH,XRGG2 - before high^} back vowels:UW,UH, OW,OY,AX; and clusters: green,glue GG3 - before low vowels:AE,AW,AY,AR,_} AA,AO,OR,ER; and medial clusters:anger; and final position:peg PP - pleasure,ample,tri`}pTT1 - final clusters before SS: test,itsTT2 - all other positions:test,streetKK1 - before front vowels:YR,IY,IH,EY,a} EH,XR,AY,AE,ER,AX; initial clusters:cute,clown,screamKK2 - final position:speak; final clusters:taskKK3 b}- before back vowels:UW,UH,OW,OY, OR,AR,AO; initial clusters: crane,quick,clown,scream CH - churcc}h,featureJH - judge,injure웛MM - milk,alarm,ampleNN1 - before front and central vowels:YR,IY,IH,EY,EH,XR,Ad}E,ER, AX,AW,AY,UW; final clusters: earnNN2 - before back vowels:UH,OW,OY,OR, AR,AANG - string,anger;;;e};;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;0(}8%>6-D %, %--"BefNjEEALLO1ALLO2WPHRAPHRASTORLINEPLINABWORDWORD2LINPHONPFLAFLAFLAGCOUNTALKTALKg}@ h} B<<;APi},;AP,;A,;A,;A,##@@K:"9@&,"AR@2 #B@j}!-@@&%".68,-2 6-B K (}-@@)( ,(K( by John Shanak}feltR()( A SPEECH EDITOR FOR THER($ ή̮ϮǮǠР  J#( Š&(l}J( (from Issue 29, April 1985) 11;@,;@,;A,;A, 16-AP B--@Am}1   6.6.6.6. A 6-@(}-@@/(Ԡź| |AAn}SK @)W6-@^6.p-@@z(-@@(p-@@*(o}=SPEAK WORDL(=ADD WORD TO DICTIONARYf(=OPTION SCREENp @)V-@@&( Ԡ5p}B:, @8G-@@L(V @"dB:, @u$-@@:(7@<@7,L-@@Z(q}7@8,d @"s-@@+(7@<@7,=-@@S(7@8<@t,e-@@s(r}7@u,S-@@#( Ԡ2B:, @8D-@@I(S @%dB:, @u$-@@s}:(7@<@7,L-@@Z(7@8,d @%s-@@+(7@<@7,=-@@t}S(7@8<@t,e-@@s(7@u,]-@@ :( ̭ȠҠԠƠL-@u}@"]( Š J-@@##(I:,8I:, AJA@PC-@%@v}9F:B2y,"@*B:,!C B0 F:B2y,"@A  9%F:B2y,"@*B:,!/ A#9 w}@" F:AS,"@($0)@"AU& B0 @F&)"@ A(}) @x}(E"A&*!@!(>:,-67<,.;6-&@E @(*_1+!@H* @X,)+!@d* @,9(>y}:,G67<,.>:,U6-%@_ @(,d B(( BAD INPUT!+6-A016.; BA6.H6.T6-@z}Z(}d @. A067<,.>:,6-%@2 B07 @ #B+ 46.6.{}6.!'+ @ AP " 6-B:,P 4 B$67%@,.:67B:,%@,. A6.M6-@|}P$ A : (} ((%(NO SUCH ALLOPHONE:(PLEASE TRY AGAIN%6-A 6. B%6. 0( (}} (0( TO RETURN TO OPTION MENU$ ' B(} @"@6-$L (} (/( ~}ҠȠ2(L( ( A. CONSTRUCT WORDS( B. CONSTRUCT PHRASES++(# C. }SEARCH FOR WORD IN DICTIONARY&&( D. LIST WORDS IN VOCABULARY""( E. PRINT DATA ON SCREEN##( F. PRINT DATA} ON PRINTER//(& G. SAVE PROGRAM TO DISK OR CASSETTE>>(6 H. SAVE AND/OR REINITIALIZE VOCABULARY}( I. RENAME A WORD ( J. EXIT PROGRAMm($( WHAT IS YOUR CHOICE?'(*(-(L( to hear current word}m( to save current wordAS/%F:B2y,"@*B:,!/ B09%F:B2y,"@}*B:,!/ A#9 A  F:AS,"A A B A $)@. BA"@:F,A}!"@:E,A!P"@:C,A""@:B,B"@:A,(} @"@:G,A `}"@:I,A"@:D,A%)"@:J, AR&(})"@:H,Ap A  }B A  ;(>:A%,()(ASSETTE OR ISK?;AdAU F:Ad,"AUA r%)@}"@:D,% A @:C,A rN (} ((POSITION TAPE,9(PRESS AND N(AND PRESS }  A 3!b (} (@(/PLEASE TURN OFF YOUR PRINTER AND TRY AGAINT-@AX b A x" B}C: A *- (} (-(INSERT DISK AND PRESS RETURN+AdAU A%,N A 9@@}D:WORDMAKE.BASC BN@-b( (3(%WORDMAKE.BAS is already on this disk!N(Okay to write over it}?Q(b( to proceed.(Any other key to abort/$ A )@$ B0@:Y,A 2G B}@+D:WORDMAKE.BAS=AdAUG A 4 A!R##@@P:W@Y (}} (( ( Ǡf"(}(((gTB:,"((ϠĠΠ46-A`:6.D BJ6}.T A h( Bi?-@B:,&@26-@:7<,,&@d;(,? j#6-@:7B:,:A%,"A }AH R( DATA ,4-@B:,&@B6-@:7<,,N(>:,R  % 6-B:,6-@:7<,,%(>:,} ( ((CONT 3"368&@d,-8&@d,%@ - AB@& "(>:A}%,"A AH F( 14000 DATA )-@@5(8,,9 F(8@, ( ((CONT -} AB@& 4AB@"(>:A%,4A AH F( 14010 DATA )-@@%}5(8,,9 F(8@&, ( ((CONT - AB@& @AB@"(>:A%,}4A A@6- $ h @e)!@<(ĠԠΠȠB6.N6-AX B}^6.h A# 06-$A08&@d,"A# B#$-%8&@d,&@*"04<6-@B}6-   " A# F($( IS ALREADY IN MY FILE.F(DO YOU WANT TO REPLACE ?" 0)@}"@:N,'6--(}0$$ @:Y, A#8&  6- A#. g (} (O(+SORRY, NO MORE ROOM FOR WORDS STARTI}NGWITH 7@<@,c-@Ag 2 $ S (} (,( ٠/(2(S( cre}en or rinter? $ A%)@$ B ."@:P,6-@$ A%P. A% @:S,A% 1(} (1(#Input first letter ( for all) $ A%)@$ B ++ @:A,)+!@:Z,*AU,A% 3}"@!A8Af3A9A8 AU A%0 "6-@""(} "  4}* A%` ?(6-%@+"*"@"5 A%? A% A% #$A6- "6-@}""(} C ""8&@d,C($------------------------------------ %%@:7@<@,,A%`} #(6-%@#6-%@ -"*"@"# A%- A%1 A%2 E A%U-@@}P:7 BB@E$ U B(3(ˠҭԠ?6-ApE6.O BU6.} '@'6-' A  :"7(#-----------------------------------:( " A% ?}"@6--A8Ac?A9AF A  %(%(Ӡ٠٠Ϡ AdA}U 44:LINE=9011:STOR$=PHON$:GOSUB 11000:PHON$=STOR$" F:Ad,"AUA%# AdAU$X (}b}(((( A. RE-INITIALIZE VOCABULARYl$$( B. CANCEL REINITIALIZATIONv;;(3 C. SAVE VOCABULARY TO DISK OR C}ASSETTE ( ( (=OPTION MENUAS"F:B2y,"@" A  F:AS,"ApR}. B ApV$)@. B""@:A, Aq" Ap""@:B, Ar" Ap""@:}C, At" Ap ApRi (} (((i(HONCE DATA HAS BEEN REINITIALIZED, NEW WORDS WILL BE WRI}TTEN OVER THE OLD( VOCABULARY2(( TO PROCEED2(ANY OTHER KEY TO ABORT7 Aq)@$ B7}@:Y,ApV(V(KWOULD YOU LIKE TO LIST CURRENT VOCABULARY TO DISK BEFORE PROCEEDING?( es OR o$ }Aq)@$ B"@:N, Aq@:Y,Aq At*-@@&&68,-}* -"(>:A%,"A AHF( 19496 DATA )-@@5(8,,9 F(8@},( ((CONT-AB@& 4AB@"(>:A%,4A AHF}( 19497 DATA )-@@%5(8,,9 F(8@&,( ((CONT-AB@}&7AB@"(>:A%,4A A7$ ( ((!=-@@&%6-%@d1#$A}=6-"; "#@:7@<@,,"16-%@; Ar$ 68,- *->"(>:A%},"A AHHF( 19496 DATA )-@@5(8,,9 F(8@,R( ((CONT\-}fAB@&p4AB@"(>:A%,4A AHzF( 19497 DATA )-@@%5(}8,,9 F(8@&,|( ((CONT~-AB@&7AB@"(>:A%,4}A A7$ AtP4 (} ("(ASSETTE OR ISK?4AdAU F:Ad,"AUAt%)@}"@:D,% At0@:C,AtN (} ((POSITION TAPE,9(PRESS AND N(AND PRESS } At 3b (} (@(/PLEASE TURN OFF YOUR PRINTER AND TRY AGAINT-@AX b At1 (}} ((((1(Please wait...C:B@Bs((<(!(Data is listed on tape5-@}A9 <$L (} ((((1(Please wait...@6.D:VOCAB.L6-@67@ ,.=:,* AtF}*@@ 0 B@&6-%@0 At16 B AtP"@6B@}Bs((@(%(Data is listed as VOCAB.9-@A= @$Q B(6(ERROR F:A,} ENCOUNTEREDJ-@AN Q$@ AJ5 (}5@@D:WORDMAKE.HLPT@}(^ 4  A(}h A 7(ŠҠ TO CONTINUE7(Π TO CANCELLAdAU }F:Ad,"AUAEF:Ad,"@'-AdAU8@B BE$-F:Ad,"@3*A}dAU-$AdAU A% B@" A%$ < (} (($(What word do you8(w}ant to rename< 4A  6-@:7@<@,, 06-$A08&@d,"A B#$-}%8&@d,&@*"04<6-@B6-   " A  6- #" 9( (+(What i}s the new name for this5(word9 4A t@:7@<@,, (#(T(,ĠĠנӠԠԠ}Ƞ`6-Aj Bt A   6.6.  A#6. A b >( ($(SORRY, I CAN'T FIND }>(PLEASE CHECK SPELLINGg %-@A % A (#((THAT.WORD.IS.NOT.IN.MY.DICTIONARY.)#00RZMBntAU@BLL@k@}BxXMBLL@K@BPFBaLiAeO@KGoASB2# PRESS.ANY.KEY.TO.CONTINUE.3# IgGGwBG@KSBjSBM_BjOKMLKqVB<#,,NO.SUCH.ALLOPHONE.,,,PLEASE.}TRY.AGAIN.=#++xOuBwOOrBZZmuhuKBDDDI@mSkBMgFBOOdLLKBF#BAD.INPUT.G#ZZAU@BLKI^MBP#NO.PHRASES.STORED.Q#xOuBhgT}kGkBwMz@U@BZ#WELCOME.TO.WORD.MAKER.[#nGmjOPBM_BntAU@BPTjsBd#NO.WORD.IN.MEMORY.e#xOuBntAU@BLL@K@BPGGPtSBn#&&}CHECK.PRINTER.,,NOT.OPERATIONAL.o#""rGGBiBINLKMsBDDxXMBXIsTeOK~Bx#$$WORD.MUST.BEGIN.WITH.A.LETTER.y#&&ntAU@BPOwMBSdLKB}nL]BTBmGGMsBDDD' PA1,64' PA2,65' PA3,66' PA4,67' PA5,68' OY,69' AY,70' EH,71' KK3,72' }PP,73' JH,74' NN1,75' IH,76' TT2,77' RR1,78' AX,79 ' MM,80!' TT1,81"' DH1,82#' IY,83$' } EY,84%' DD1,85&' UW1,86'' AO,87(' AA,88)' YY2,89*' AE,90+' HH1,91,' BB1,92-' TH,93.' UH,94/'} UW2,950' AW,961' DD2,972' GG3,983' VV,994' GG1,1005' SH,1016' ZH,1027' RR2,1038' FF,1049' KK}2,105:' KK1,106;' ZZ,107<' NG,108=' LL,109>' WW,110?' XR,111@' WH,112A' YY1,113B' CH,114C' ER1,}115D' ER2,116E' OW,117F' DH2,118G' SS,119H' NN2,120I' HH2,121J' OR,122K' AR,123L' YR,124M' GG2,}125N' EL,126O' BB2,127P' END,0)- (} (-( ŠҠ)"("( A. ADD WORD TO PHRASE)(} B. BEGIN A NEW PHRASE")))(! C. SPEAK CURRENT STORED PHRASES,),,($ D. WRITE PHRASE SUBROUTINE TO DISK6)$($( }WHAT IS YOUR CHOICE?@)#( ( (#(=OPTION MENUJ)ASK) F:B2y,"@A L).F:B2y,"}@$6-@. BBN) F:AS,"BqT). B B$)@. BU)"@:A,B}V)&"@:B,6.6.& BW)"@:C,BX)"@:D,B Y)"@:E,6. A Z) B}g) B Bh)J (} (#(ԠŠ2B:,"J(NO PHRASE IN MEMORYi)(l)D-@@} %( Š2(I:,D-@@m)*I:, A*A@Pn)bB:,!@)B:,!@}"(J(#ǠԠƠ͠ҠӠb(ŠŠp)PB:,!@)B:,!@7(ŠϠJ(}ҠM(P(r)L(-("WHAT WORD DO YOU WANT ME TO ADD TO9(PHRASE=L4B`t)H 4.!67B:,%@},..>67B:,%@,.>:@f,H Bv)H 4,!67B:,%@,.,>67B:,%@,.>:@h,H Bx)6-}@ A"z) 4 B|)-67B:,%@,.-67B:,%@,..)467B:,%@,.467B:,%@,.>}:@f,)( )-@B:,)6-@:7<,,&@d)F:,!A'BD)%@d} )/6-@#@#@d/)"@6-$) B)B:, @ B})+(+( Do you want to save this phrase?)$ Bb)@$ B)"@:N,B)"@:Y,B) } Bb)i"B (}'-@@=(ϠӠI6-A@O6.Y B_6.i B)< (}}-@@<( ǠӠ) 6.)G"B 6-B % B9-@@ = G B}%)!!-B &@@)% B!-@@ % ) ) 6.) B0*"(>:A%,"A} AH:*( REM <*( ((CONT>*-@*AB@&B*"AB@"(>:A}%,D*H(%@ DATA 6-@B:,&@D(7<,H E*(7B:, H B*X B(6(ERROR F:A, ENCOUNTEREDJ-@A}N X B* # "+-@B:, +6-@:7<,,&@d*+F:,!A'BP4+%@d }9+/6-@#@#@d/H+$,6-B@6-B@,H 6-F:,&@&A',}86-@E;A,H$D:WORDMAKE.BAS}'. A0 6-66-66-'6-$&$6-$&$6-$&$'[\`(q(WTTXYDLKEHLHLNRRMITIMHSXYXYENCLHNINVSBAMMxx A }A A& Ah A @1 AU  } ! }"#$%&'(A) *+,-./01 } A @ %%6-@6-% @0%6-@6-@% @0%6-6 }-@% @0&6-6@6-@& @0&6-6@6-& @0'6-6@6-6@ }' @0&6-6-6@& @0&6-@6-6@& @0$( 6-6-6-2 }-@B:,<. )!) )!!6-@$'. A F8<,"@K/@:7<,,8<,"6-@%' }/ A P 6-%6-% d'-@B:,'68<,-@:7<,,n 6-%6-% x$I -6-A }-;2@@I6-&@9 -8<,/ @>:8<,,9 A`// @>:P:H }:,$@&,%@e,   (%2($(-@@"6.=:,( A(- }@@#6.=:,( A(-@@#6.=:,( AT-@B:,5 @>:@:7<,,%@, }9 E"@T @ $( 6-8,6-8,6-8,( @ -@8,8<,!AAU }48<,!@*"A(*6-@4 AH&&8<,!@*"@2AU 6-68<,-8<,% } "*"6-% AU - @>:8<,, 6-%6-% &6-@$&@&67<,.* }6-&@ A"$,)-@@ ) @ź6JJ8,AAAAAA }AA76.נϠ A 86.נϠ A 96.ΠϠ A :6.ŠϠ A };6.ŠϠ A <6.ŠϠ A =6.ӠϠ A >6.נϠ A @ @ }J*68,-@ 6-'@* ATT-@@4-A!@6@P2@@T } Y]-@A!32@@7 ; ]2^1-@@ 1 @ } h$r~ #A0!-@@'"5-@Q2@@U Y {2 }~$|Q6-@W6-@E!6-5-@Q2@@}-@A }  ~ 6-6-6- (%2($b-@@092@)@ }@= _2b$\-@`A!32@@7 Y2 }\$SSJXHHVAPLMMOK,CwordKIOBPCR,FLTYPDsWTRZM,NYNNXPOeKNWI,GIRULPADaHLS,NWIUYSCZQrPUSSBHXSRCHRHFcL,BDybZMYXJ }HTh,MZKMDFGRWTLP,DHDUskeetBXE,PMOHVOnevilA,NIWOPAJNUCDDCCTREE*,HOUSE*,BOAT*,BOY*,GIRL*,BIG*,STORE*,PRETTY*,HELP*,FOOD* }CCBROWN*,HIDE*,WATER*,CAT*,APPLE*,GRASS*,SKY*,BOOK*,DISH*,FAST*BBPLAY*,CUP*,EAT*,RADIO*,GLAD*,STONE*,BIKE*,TOY*,SWING*,R }IVER*HHBALL*,FORK*,SPOON*,SAID*,FLOWER*,BEE*,LEAVE*,SORRY*,PLEASE*,THANK*IIBIRTHDAY*,HOME*,CAR*,WAGON*,MILK*,COOKIE*, }DESERT*,SAND*,MAYBE*,YES*[[ATARI*,COMPUTER*,BYTE*,DEBUG*,FLOWCHART*,BASIC*,PROGRAM*,SUBROUTINE*,ADDRESS*,MEMORY*XXBIN }ARY*,HEXADECIMAL*,LOGIC*,COBOL*,FORTRAN*,DATA*,ASSEMBLER*,COMPILE*,ERROR*,JUMP*SSGOTO*,CURSOR*,DISPLAY*,DISK*,TAPE*,ARITH }METIC*,FILE*,FUNCTION*,LIBRARY*,PEEK*SSPOKE*,GOSUB*,RETURN*,GRAPHICS*,INPUT*,OUTPUT*,KEYBOARD*,LOOP*,MATRIX*,STRING*\\ }VARIABLE*,RANDOM*,PIXEL*,COORDINATE*,STACK*,PRINTER*,RESTORE*,MODE*,POSITION*,EXECUTE***121,15,96,15,81,15,60,40,81,15,6 }0,40ee;A ,;@,9@<@,9@,9@,9@,9@,9@,[ +@'0 }@A0@@[0@@8-@@"'-@4 @8 } } A'0A0@U-@AY c A}0@@@ }Y-@@"Y @ instructions >:@,y>:@,n>:@ ,&AdAU0 F:Ad },"AUA`:26-F:Ad,"@5( A2 AD@CAPI AN` +6 $ } Words will be randomly placed on` %the screen. They may be spelled fore-X`* "ward, backwards, up, down, or on a8  di }agonal.; `  Use the joystick to find thebV, $first letter of a word and press theV %trigger. You will be allowed }only twol;(  misses. The game will end on the8  third miss.; vP) ! Use the Š to list theP "hidden words }. Press '' for a clueQ$ or '' to give up on a word.' Q % Words are worth 20 points for theV- %first minute a }nd decrease in value byV $2 points for each additional minute.T- %After 9 minutes, words will remain atT "2 points ea }ch. A clue will cut theV, $point value in half for that word. AV %word that was given up is worth zero.+ +  }Press any key to continue.AdAU F:Ad,"AUA AA +@'0@ }@A0@@`-@5 @1: FIVE EASY WORDSG-@@` @ 100 LET !}TERS_-@2 @2: TEN COMPUTERD-@@_ @ RELATED WORDSa-@@.  "}@ 400 LETTERS@-@ a @3: SAME AS 1 EXCEPTg-@@4 @INVISIBLE LETTERSF #}-@g @4: SAME AS 2 EXCEPT_-@@4 @INVISIBLE LETTERSF-@@_ @ $} LEVEL (1-4)AdAUV6-F:Ad,("@1)"@&46-@@6-@L6-@V A %}G"@0)"@$%6-@16-=6-@G A  A`9 A#"@1)"@0/6- &}9 A0 6-@ A0>u +@'0@@A0@@@[0@ '}@u0@@@C7-@7 @ONE MOMENT PLEASE...H, --$68<,- (}( , R-@\G%6-P:H:,$@,%@G6-P:H:,$@,%@a%"@#%A % )} Af#%Ap-@" z67@$&@,."@A 0V-@&@ *}I7@$&@<@$%B:,&@,4L'V A`  6. 6-@06-@$&@%07< +},4*A `+67<,.7<,!6-%@+ A @G%6-P:H:,$+&%@,,%G6-P:H:,$+&%@,, ,}%`%6-P:H:,$@,%@.68,-768,-@68,-L68,-B:,V @ ` @@"@A` -}68,- 7 A-@@ 7 @ THANK YOU.-@A a-@7  .}@ I-@@ a @ 0 A0K"@ /}#-@A' 1 AK0@t2-@!2 @word>:@&,~7- 0}@"7 @ remaining>:@&,c-@#3 @value>:@&,E-@@#c @ 1}score>:@&,c 6-6-@ !6-'6--6-96-@ ?6-K@W@c@ ) 1 2}-) @>:%A`,! A A! A" A"A*8," 3}@ 6-$@* A#6-%@!#6-@.6-@$&@.7<,4*AA-@ 4}@!/ @ A-@@!7<,4*AU<$ @>:@:7<,,%A`,26-%@ 5}< A@8,"@ AAdAU??+8,"@*"@,)+8,"*"@,A 6}33AV$F:@,%F:@ , A6A 1 A@1@ *8,"@ 6-&@ 7}* A6-&@ A6-F:Ad,(u"@3#-@@0E2A!@ 8}@I k2u A29"@a6-@2% A/ A09 A7:"@ 9}!AdAU08,@: A< T:,A`F8,"*8,"A@ZP6-%@#- :}@@ P @ ӠҠ>:@:=:,,%A(,d; A-@@ ; @ n% ;}!@6-@2% Ax1-@@ 1 @  T:,"A Ap <}5 Ap6-A(# A0+6-%5 A A&6-R:,&"@Ap3 @6-@ =})6-&@3 A4 @6-6@*6-&@4 A6-6-&@"6@ >}6-@%%% )%!)% )%!Ap - @>:, 6-%6-%1' @6-% ?}A`' Ap' A#6-%A(' Ap6-%@2 Ap" - @>:,, Ap6 @}-@@.6-@$&@.7<,4*A J A A0T YE-@@ 3 @ A}٠Π٭ΩEAdAU^% - @>:,%6-h1"@6-'6-1 AUr6 B}-@6-@w A0|-@A56-F:Ad,"@C!'+ A5 A C}@5  A@' AA +@'0@@A0@@7-@ D}7 @THANKS FOR THE GAME.7-@A -AdAU7 A D:WRDSRCH`XԥYՠ pLtQ @  `` , @x V L 0A@B @ , @ f H 88FF} Hz J Xt0Vvԍҍԍ e"$##HԩЩҩЩU Щ G}~Т ʕbcde?bK膱PԩeL5 dЭjYT  ) )H} )d) dʆd   L^ d)IJްd d ԍԍeI}e e `d !B K" !L&eLe e6e !eV L&șK0-i ҩ J} 686A0 ʎҩS &LwҢe C" !eV L&( e 3 K" |I| eV e氥K},ɴe  j !ee0|Le| !ee d e)d d݁dL}e/ ҅)e ) e )dҭe ҭeЮLO AR ) dҠdaM}ᑰjiLF j8L )+)F  ejН)`N}  LO68#` `d ! ! Ԡt`d ԭhdР`dЈeVЬ`dO} e`Ж`e`ЍЍЍЍЍЍЍЍ`66666AAV6ѰLv!8P}LN!ife`)_L!@Aʊ)6e` e6Ke膱Peʝ6Q}e`e eύԅ̍ТʕeeE0*L+I 6 ͩde `>e e`e79R}dP6bP N e浱 & & &<e "汥  "S}bи浥iЗ`)=6`$-7)@ʱc)e@bb3b`pppTPTQTRTSTTTUTVTWTXTYTZT[TT}\T]T^T_T`a F6A3#ppD@PА000000VAAHeb$P hd ԍh@ddL#>ԭidЭjdЭkdЭldU} ԍЭt,e)etL#t) eЩ4 h@$P>@c ԍнch@d ԍТdh@ ԭdЭd ԍV}h@$d ԍнd) dнd ԍh@?ԭd ԍЦdЭdh@ . eeLU%?ԥjU,ePp" e0?`d)W}e `d) e`dL% et)e t) e`deee`dЈddЩ8 ,e0 e e )Mgd gd#ԩ3X}lc䭰dЭdЭdЩЦ#`#ԩ=©4 ԩ#ԩwԥJ@>ĘIæļdHY}üd@chcƼlc`HdŶ^d>ddŶ7ŶMdd 0717dȱdȱZ}dȱddd{dditd淥udh`m eɪ e`骍 e͹66A L%`HJJJJh)y6 6L&6[}`ejͩ eeeeL)6ҩe -')e -'j)L'L LO(\}8 JJe8(JJJiP沱Ȇ)? (0 &2 %ee1 d10dPd@d2C)$)JJJ(]}eL'8尅(PeL'8帅 ) (?ВȽDYKKL4'H>$ e I6LM(6ș6I6LM(=66^}^e % %h`B6ɻ L[ɲLr( ύeeK)?KA 6L^)  ϭ `di)ܭ)_} e )meeҥ)JJJJI )pҭeLAj  Imee0ɹ,8e)0 @`}- ґL^)eL+i eL)eeI ̅09dZccɿ cdL)c)Ja}L)ƱOcL))@ȱϽdccКndļqd8L*iĝL"*ȽDYKKL *L*K)?Kb}i meeLj*8Ωíe8Íeʆະ<K GKǭee8e-L*meeȄnj&Ԑ c}K)?Kj IL*$0 w& 8岰IL*e$0A<e) 0)IL+e8 Id}L>+ei ehҽl҆$0KFjjB>eK)?Ki˪K GKe¥eΥJéǍЩ %L+)e}eL+e?jL+qdĝХiȨDYKK+nde %8廅5(襻((L#,e膾f}Nະ C0K eK)?K+)  )೰KKЎeLw,e"8eSe9'eL,meg}1ee68#ԥǍ e; e e. )?b#@bi+Ų cbL-bq}[BKWRDADV XMOBOWRDHLP XMOBfWRDMAK XMOBQWRDSCH XMOBTEWYSLE XMOB$XECONF XMOBXMM801 XMOBXWING XMOBYOGI XMOBZIGGY XMOB1ZP1020 XMOB18ZPLOTR XMOB iZZTOP XMOd)L- )P%󦱭 ecHcXd`d$ƲPFFƳccd %Тe< d@dr}Pd0de!e@d@dPdPd d d0d0deL-e)ep69ʈOee&ʎe 9j 999Ls}&d`{deޥdGtdud ddL$.dȱzdȱdȱd{ditdudL.d{dzd}dzd=ddއdЌt}ޤdBdddȱ)d)dȱdȱddiddL$.ddd}d)ddL$.;()'(3#/2%3mopu}dbldadavted79:,% "9$!6)$"5%v}(,%202%3334!244/"%').,!343#/2%000000w}000000  <<~~Á B w"Hz_.J (|oZ:XDx}UUUUBBECDXABUUFABEUVEHcVVGee11AahQRQRSaaQQUbbQSQBBUUAAgcibaaVgcibaay} "  "" " "" " z} ABDEFGIJLKMN{}   |}AAAA}}       ~}      @ U}88||Ƃ800 pp 8FIIIDDDDFAFHZZjjjP}jjjZZ~``nf>ff~fff~~f<flxxlf`````~cwkc}cfv~~nf>@@@@2*PQ1''&&&&%%@@@@(}(-((>>}  !"  ! #$$ %&! %' (*++++*+}+ ,,,,"-./01"1#200 " 4} 556 4" 98++++3# "99"553}'"43:;( 1 1" 13>?>?>DD?>?>DD?BCB}C@MLCBCBIEA<=BGFCJLBCBGD?<=@HIAJLKBCBIEA<=BCBLD?BGD?BGD?;}@A@EEA@EEA@EEA;()'(3#/2%3mopdav}dblda79:,% "9$!6)$"5%(,%202%3334!}244/"%').,!343#/2%})#/(:2."(;;;#22.;;}2 4 "<2 ;" ;=    3%&   :  *2' "};1 :;1504MCQC IC kVC FcC`cCcCC0! @C$C}$C$2C$C$C$C$C$#C$C$C D}QW   S0ii  ưcD}L©éLSˆiii¥iکd須 l ````````````````````````````````6ySUPPLIED BYT THE CHAOS BBS(517) 371-1106XE CONSOLE KEY FIX...... that really works.I found that I was not alone when} Istarted having trouble getting myconsole keys to work on the ATARI130XE the CHAOS club used for itsBBS. It seems that }very many ofthe machines develop this problem.I asked around and found severalothers that had done as I did,opened the ke}yboard and cleaned thebutton contacts, only to get goodresults for a week or so beforelosing them again.I then received }a couple reprintsof articles suggesting hardwarefixes. I tried a couple that didnot work, but one that worked thebest ca}me from Alan Haskell(printed in the SBACE GAZETTE,April/May '86). Heres how, with asmall modification to save you thetro}uble I made for myself tryinghis recommended installation.You will need a small phillips headscrewdriver, needle nose pli}ers, asmall soldering iron, and three 3k(3,000 ohm) resistors.Quarter-watt rating is plenty, infact, the smaller the resi}stors arephysically, the better.1. Turn over the XE computer andremove the 4 screwss that hold ittogether. Turn the co}mputer overagain and remove the top half ofthe case.2. Lift out the keyboard andgently pull the ribbon out of itsconn}ector. DO NOT OPEN THE KEYBOARDas cleaning internally will nothelp, and you may damage the carbontracks on the baking shee}t inside.3. Remove the motherboard fromthe lower half of the case byremoving the phillips screwsholding it down.4. } Remove the top and bottommetal sheilds from the board bycarefully straghtening the benttabs that go through the board.5}. Observe the top and undersideof the connector you pulled thekeyboard ribbon out of. As seenfrom the top as you would l}ook atthe computer normally, there are 24connections, with connection #1 atte left and #24 at the right.Connection #3 (fr}om the left) isthe ground connection. The last 4,#21, #22, #23, #24 are the START,SELECT, OPTION, and RESETconnections. }When a connection ismade from these points to theground, the computer will know oneor several of the keys are beingpushed}. Due to a design problem,the console keys have a bit toomuch resistance to always registereven when you really lean on t}hem.So, we will install the threeresitors between the connectionsand ground so as to "leak" a bitmore ground signal to th}e computer.That way, not nearly so good aconnection is required by theactual keys when pressed.6. Identify the proper }pins onthe bottom side of the circuitboard. We will install the resitorsunder the board.7. Solder one end of all three}resitors together. Then connectthis common end to the groundconnection (pin 3). Then solder thefree end of the resiters, }one each,to pins 21, 22, and 23. (The resetsystem never seems affected, norany other keys.)8. Be certain that the wire}s onthe resistors do not touch eachother nor any other circuitry! Useas little solder and as short aheating time as possi}ble. Tape theresitors to prevent shorting ifneeded, and press them close to thecircuitboard.9. Reassemble the shields }to theboard, bending back the tabs tohold it all together. Look insideto be sure the resitors do nottouch the lower shiel}d.10. Complete the re-assembly,taking extra care not to stress orinsert the keyboard ribbon too manytimes. The spring }contacts bendeasily, and the conductive coatingon the ribbon, if scratchedthrough, will cause the keyboard tobe useless. }Don't worry too much,thats hard to do if you arecareful. (The original modsuggested pressing the resistorleads into the c}onnector so as tomake it solder-free and simpler....but that "simplicity" ruined myconnector and made hour more work!Sold}er it!)11. Test the repair. Power up themachine and type in this one linebasic program: 10 PRINT PEEK(53279):GOTO 10}Then type RUN. You will see a rowof 7's down your screen. PushOPTION. They should turn to 3's. SELECT will give you 5's}, andstarts will give you 6's.Combinations will give othernumbers from ) to 7. If each keyresponds, you have finished the}repair.This has permanently fixed theproblem on dozens of XE's. It hasrestored my keys to "feather touch"after a long }siege of having toboot 5 or 6 times mashing theOPTION key trying to get a bootwithout BASIC. It WILL work foryou.John }Nagy, SYSOP of the CHAOS BBS(517) 371-1106EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEi>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>}>>>>>>"@,$@"%+"@,$@$%+"@,$@&5 6-%+2@@@5 A @2@94 0 0 7 7 7 7 37 37 40 40 40 22 22 40 40 46 46 50 55 55 60 60 55 55 50 50 55 55 60 60 55 55 } 50 46 46 40 40 22 22 40 40 40 37 37 24 24 33 33 36 36 0 0 7 7 7 7 37 37 40 40 22 22 40 40 46} 46 50 55 55 60 60 55 55 50 50 55 55 60 60 55 55 50 46 46 40 40 22 22 40 40 37 37 33 33 26 22 } 21 27 26 22 28 32 32 43 44 44 46 46 47 47 43 32 31 32 32 28 28 29 28 20 19 20 20 16 16 17 16 }5 1 1 2 2 4 4 5 16 16 20 23 25 26 22 25 23 26 22 21 27 26 22 28 32 43 44 44 46 46 47 47 43 3}2 31 32 32 28 28 29 28 20 19 20 20 16 16 17 16 5 1 1 2 2 4 4 5 16 20 26 22 11 11 12 12 11 11} 13 13 13 12 12 11 11 12 12 12 12 13 11 12 12 12 12 11 13 13 11 12 12 12 12 11 13 12 12 12 12 } 11 11 12 12 13 13 13 12 12 15 15 13 13 9 9 8 8 9 9 6 6 8 8 9 9 8 8 8 8 6 9 8 8 8 8 9 6 }6 9 8 8 8 8 9 6 8 8 8 8 9 9 8 8 6 6 13 13 161 1 51 2 52 3 53 4 54 5 55 6 56 7 57 8 58 9 } 10 10 59 11 60 12 61 13 62 14 63 15 64 16 65 17 66 18 67 19 68 20 69 21 70 22 71 23 72 24 73 }25 74 26 75 27 76 28 77 29 78 30 79 31 80 32 81 33 82 34 83 35 84 36 85 37 86 38 87 39 88 40 8}9 41 90 42 41 43 91 44 92 10 17 17 18 33 34 34 41 12 13 13 14 14 11 11 12 61 62 62 63 63 60 60} 61 10 15 15 16 16 17 17 10 59 64 64 65 65 66 66 59 38 39 39 40 40 37 37 38 87 88 88 89 89 86 } 86 87 41 34 34 35 35 36 36 41 90 83 83 84 84 85 85 90 46 45 46 47 47 49 49 50 50 48 48 45 45 }94 94 50 46 93 93 49 47 48 47 93 48 94 1 2 2 3 3 4 4 1 51 52 52 53 53 54 54 51 5 6 6 44 44 }26 26 25 25 7 7 5 55 56 56 92 92 75 75 74 74 57 57 55 25 18 18 8 8 7 7 25 74 67 67 58 58 57 }57 74 44 43 43 33 33 26 26 44 92 91 82 75 75 92 18 19 19 20 20 21 21 22 22 23 23 24 24 25 25 1}8 67 68 68 69 69 70 70 71 71 72 72 73 73 74 74 67 26 33 33 32 32 31 31 30 30 29 29 28 28 27 27} 26 75 82 82 81 81 80 80 79 79 78 78 77 77 76 76 75 91 82 }= A"A#-@"#9( UUU !}U ,U ,U )UTQE U (UTA U %U@UTQAE %UQ!}UTPQE #UTAUTQU "UPEUPAEU U@UU UPU!}UTUU@U Q UQTUTU  UEQUU?U@ UATUU!}??UQ UQTU@U ?CPUUQUEUE?STU@UATU!}Uw0UPEUU?OSTUTUQ UT UTPQE\UTAUUGPUAUET UQ UTQAEDSUTUUT!}STETUEP UTUEQEUTNAPTUUT?OSQUAT UTEQAEUTPfa6QUTSO???CTUETUTRF!}&f@TRFB UTAUMTUSO? OSTUQUTQI TQIPUTPAUbdfa6SUT U ? ?SUARF$dbF&f&T!}UTQEUYMTUT UP?  OTUPI AUTPAUbd`fxAUTSO?NPU AT U$!}&fFUiUPSO?>LUT? EQU) Ujfw@S??3<QPXAP!} U`fdaEUY`<G ? < QXQT UUDf@wX#????#!}hd`bEPT U* UTP݈S#???@T U(* UTPfwU!}UT*JT U*JTUTSC݊BU1U@ RT U PTUTPQ`*@!}gw{*R< UUP**R U764t87w*j݃PJ? UUTJBT U!}X ͙]AT<2*UP@ U@7wsqyqscgG*%U?2*U!}T@(E U]͍ UQUUP  * UTR7w7wvwtUT UTwvtxqsp{*UTEU * *!} UPA]݁UTUPD݁у UU UPG7wfdI37gpTD4t8AUPTBJ*j@w*UU !} UTQ ݃5TP ATUTP *j(UPUT@ xyqrbfFJ J j*JR w@UUQ!}UTPHфʁ J*j*JR 7wSTUPB / wt]݄EQTUTRJ/݁wtprBJ JRT UT!}RJ*1w@܂ƒJ JRPT UTB*0*j* J * A'wtv**J*  2!}w@1m݃`1 we / ݅*B.v-*j!} wj T"` w nj*!}0 hu B 7p*U  B wr@5J ܊j!}!-B P.*Y 6j 6* < Q*Sdddddddddddddddddddddddddddd8( the musician򠒎M( H(Gi Z[ULUUUUU"K3QQUUUL̃UHUU"K3UQ%}UUUL̅UXHTUU"K3UUQUU&UT UHHTUU"%3 3QUUQUU%UTD %}̊UXHXUU"$3UAU 3QUQUU$́UUE ̍UXXXTUU"$3UPU13QUU$́U%} {i jJU ̍UTXHXUU"#3 bUjU3QUUU$̂D U UX̍UXHHUU"$3U! " %}U13QUQUU%̂D [jUVUWWW_TUU"%3U "bjZVbU%"RW_U%}QUU&̂L {UUfXXUU"&3Q! "beR"UU"UUUU'̂LT [{UdfUHU%}UGWTUU"'3S% "b"UY"QWGQUU(LyVfXWUU"(3S%!UY"V%}QUU-LDfeWUU"@3UV"%UUU@āDfUXUUAU"SсQUU%}@̄LTYHT́UHUU"9313SQb"!%3UUUU6ZjZĹU_UU"531ZjZ13S%}QS3U_WUU6́U ZFVZUŁWUUU"53 VZ31UUUU6̂T ZQs3663S_UU&}U"53Y}UU6̃EV W3W3WUXUU"531UV YYZUQUU6́U W3&}1UTUUU"53 YUUUU6́T W3W3SHTU:,4 e@+%AAHB(ŠҧӠҡe(Ġ*}Ҡ͠M,($ɠҭҠΠM(렦pQ(IINPUT FORMULA AS... Z=(*}IN TERMS OF X&Y) THAT SYNTAX IS CORRECT.p((eg: PAIRS OF PARENTHESIS)E (}AY%-@/(14*} ;-@E(40 J-@(104 &-@!/(CONT5-GAB@J&UAY@4'A* }B@U()}ҡӠ٠ΠMM(ENOTE: ALL THREE PRIMARY AXIS (X,Y,Z) BE IN SPECIFI*!}ED DOMAINS!_( ( (Y(GAUTOMATIC BOUNDS SELECTION ENSURES FULL PLOTTING BUT TAKES MORE TIME..._6-g(U(JPLEASE C*"}HOOSE |1] AUTOMATIC SCALING Z-AXIS BOUNDS |2] MANUAL SETTINGS.Yg"A @((INPUT LOWER LIMIT#<(I*#}NPUT UPPER LIMIT@&!)!) (WOOPS!& A%(( LOWER LIMIT%6-"( UPPER LIMIT*$}"6-&!)!) (WOOPS!& A N(.("DESIRED RESOLUTION (4=HIGH;10=LOW)2@6-%@N6-$>P *%}@(((Π ADD LABELS & BORDERS@(Ԡ START OVER --(%Ԡ PLOT SURFACE TO 1020 PLOTTER6($(PRESS A*&}NY KEY TO BEGIN...6AdAU F:Ad,"AUA@> " (4(# AUTO SCALING SEQUENCE IN ACTION!> A*'}V6-A@'+&,'6-A@'+&,96-@C'+&,V6-O:$,%O:$$,%O:$$,9 +@$AAV+*(}A /9 @`bb104,201,4,240,9,170,240,5,104,104,202,208,251,96,104,133,215,104,133,214,104,104,168,104,133ji*)}i217,104,133,216,104,104,240,236,133,212,24,165,214,101,88,133,214,165,89,101,215,133,215,152,240,15tff165,214,105,64,133**},214,165,215,105,1,133,215,136,208,241,132,221,160,0,132,220,177,216,160,0,170~XX16,1,136,132,213,138,41,96,208,4,169,64,1*+}6,14,201,32,208,4,169,0,16,6,201,64,208,2__169,32,133,218,138,41,31,5,218,133,218,169,0,162,3,6,218,42,202,208,250,109,24*,}4,2,133,219hh164,221,177,218,69,213,164,220,145,214,200,132,220,196,212,208,182,24,165,214,105,40,133,214,144,255230,*-}215,230,221,169,8,197,221,208,159,96,207,96SHIFT TO DRAW COMMAND67B:,,.*D$@SWITCH TO PLOT COMMANDJ*.}67B:,,.*MT$77PLOTTER SCALING AND DUMP STRING BUILDING SEQUENCE--67B:,%@,.=:P:@$'@,,*/}67B:,%@,.,..67B:,%@,.=:P:6@$'@,,67B:,%@,.;$ PRINT THE DUMP$ .*0}@.@@P: (@ (@I &&(@7@}-%$$ 6-%$6-A&&%6-%AY/% @4  ,6-"   $-$+&,.?}6-&-6$+&,($$ĠǠΩ* !) 6- @`, 6-$. 6-$0 6-&$.@}26-%$$4 6-%$66-A&&8%6-%AY/% @`: ,6-<   Ad 6.A}-6- -6$+&,f-$+&,h$$ĠǠΩi !6-j  6-k   l.B} !6-m  6-n$M2A@@--A1 ;2MAdAU26-F:B2y.C},"@( A2 A#"@ A# A#"@ A# A(F:Ad,"@(.D}(}( A A+*"49 SECOND SCREEN DUMP",(@(@@P:.8((@>:@'.E},A>:@,8-%@90* 6.>:,67A,.*67@,.2C6-?:A6<:@',K>:A.F},>:,@ C$QQ*400-432 IS 'AS IS' SUBROUTINE SUPPLIED BY TO SAVE A GR.24SCREEN%6-@6-.G}%2*@$$-AA.*F:,2 6-F:A,$AV%%6-F:A`,%AV$F:Aa,.H} 6- 6-&%6-@$'6-A2%'%@%@6-P:'AV,6-&$AV%.I}@%@6-P:'AV,6-&AV$%@%@ 6-?:C:hhhLV,<,.J}'@$X 6-6-6. A Yo,AYA'/@ A9/AY@DK/AA]/AY.K}Ao/AYAGZi,@ A'/@ @s9,AY@DE/AYW,AAi/A.L}@s\E/AYAG'/@ @s3/AYE/A@s^u 6-6-@#6.- A 96.M}-@G6.Q A ]6-@k6.u A `X 6-6-@6.=:,( A 16.=:,B6-@.N}9&B:,N6-@X A bw6-@6-@#$6.=:,. A :6-@#C6.=:,M A Y6-@&_6.O}-m6.HIGH Z=w A c86-@36.=:,'B:,!@86.7<@,dr A 6-@&%6-@36..P}LOW Z== A I6-@3R6.=:,aB:,!@r6.7<@,fb A 6-@%6-@26.Y-AXIS< .Q}A H6-@0U6.X-AXIS_ A b$<6-?:C:,<<:,4 h@.T}+%AAHB(ŠҧӠҡe(ĠàҠ͠h(pQ(IINPUT FORMULA AS... Z=(I.U}N TERMS OF X&Y) THAT SYNTAX IS CORRECT.p((eg: PAIRS OF PARENTHESIS)E (}AY%-@/(14 .V};-@E(40 J-@(104 &-@!/(CONT5-GAB@J&UAY@4'A.W}B@U()}ҡӠ٠ΠMM(ENOTE: ALL THREE PRIMARY AXIS (X,Y,Z) BE IN SPECIFIE.X}D DOMAINS!_( ( (Y(GAUTOMATIC BOUNDS SELECTION ENSURES FULL PLOTTING BUT TAKES MORE TIME..._6-g(U(JPLEASE CH.Y}OOSE |1] AUTOMATIC SCALING Z-AXIS BOUNDS |2] MANUAL SETTINGS.Yg"A @((INPUT LOWER LIMIT#<(IN.Z}PUT UPPER LIMIT@&!)!) (WOOPS!& A%(( LOWER LIMIT%6-"( UPPER LIMIT.[}"6-&!)!) (WOOPS!& A N(.("DESIRED RESOLUTION (1=HIGH;10=LOW)2@6-%@N6-$>P.\}c 6.D:(c(OINPUT TITLE OF SAVED SCREEN (IF SAVED) IN FORMAT (8 CHARACTERS MAX) 4 6. D:SCREEN.]}.MP67B:,%,. P(((Π ADD LABELS & BORDERSP(#Ԡ SAVE IN MAGNIPRINT FORMAT! ''(Ԡ 49 SECON.^}D SCREEN DUMP!6($(PRESS ANY KEY TO BEGIN...6AdAU F:Ad,"AUA@> " (4(# AUTO ._}SCALING SEQUENCE IN ACTION!> AV6-A@'+&,'6-A@'+&,96-@C'+&,V6-O:$,%O:$$,%O:$$,.`}9 +@$AAV+A /9 @Lll104,104,141,21,6,104,141,20,6,104,141,27,6,104,141,26,6,160,193,.a}173,255,255,136,240,35,141,255,255,238Vcc26,6,240,21,173,20,6,56,233,40,141,20,6,144,4,24,76,19,6,206,21,6,76,19,6,238,27,.b}6,76,33,6,96`bb104,201,4,240,9,170,240,5,104,104,202,208,251,96,104,133,215,104,133,214,104,104,168,104,133jii217,104,1.c}33,216,104,104,240,236,133,212,24,165,214,101,88,133,214,165,89,101,215,133,215,152,240,15tff165,214,105,64,133,214,165,21.d}5,105,1,133,215,136,208,241,132,221,160,0,132,220,177,216,160,0,170~XX16,1,136,132,213,138,41,96,208,4,169,64,16,14,201,32.e},208,4,169,0,16,6,201,64,208,2__169,32,133,218,138,41,31,5,218,133,218,169,0,162,3,6,218,42,202,208,250,109,244,2,133,219.f}hh164,221,177,218,69,213,164,220,145,214,200,132,220,196,212,208,182,24,165,214,105,40,133,214,144,255230,215,230,221.g},169,8,197,221,208,159,96,207,96D2:ZPLOTTER.BAS+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++.h}++++++++++++++++,(( +UZjP@ZP UUPU2j}UPUVU@UZU@UjUUjUTUUTUVUPUZU@UZU@2k}UjUUTUTUPUPUTUTUPUPUPUPU@UPZUPUPU@U@j2l}U@U@UU@UUUUUUUTUUTUTUTUTZUPUTUPUT2m}jUPUPUPUPUPjU@U@U@U@UPUU@UU@U@U@UUTUU@2n}UTUUTUUZUTUTUPUTUjUPUTUPUTUTU@UPU@UPUTU@2o}U@UPUPUU@U@UPZUTUU@U@jUTUUU@ UPUTUU2p}@ U@UTUTU U@UPUTU ZUU@UPUT jUTU@UPUT UTU2q}U@UP UPUU@UP UPUTZU@jUjUUTUPUPZ2r}U@jUUUT UZUZjUjUjUUVZUVjUZ2s}Uj Uj"U"U"U#U#U#U#U#U$U$U ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,2t},,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,0!