@L}5 _$% l0$)$$Hȱ$ UhL" `e$$%`$%`  R@W!( L(1   Y I`  d  Ld M * @  $ % CC$$)%1 Udߥ$9%: !0 S$% DD˙`  }J)Lr } }  Lll L"! L"! VL"! l Lq!! "!LD:*.*S:P:E:l"!q"H) }h(`ӅԄՠ`ӅԄՠԨ`L)ӑ) `Ӣhh@,lHH!HwHHHHHӍl"H!H}yHl !`GHFHJ*K+\`* `Ӧee褌%ƉƋL"!}Ӡȱȱȱ㦌L"! ` ` `2a$%Ȏ!!xө~!!} ` `@X ` ~  } Ӣ ʎDy` SLD1:AUTORUN.CTBՠԢӱԙӹ }`֝DEIHB V0Z3ڝDa۝E8օܥׅݥܝHݝI V04Ӡڑڑ0 } BLVl `˩`80 ` .JJJJ)iFiFi1FicFi'ȐȦoFiUȐFii }Fi#iFiGi Fii@F iiFiiciՊFigi'iՊօשBL`I))83 }Ԥԥդե֤֥פץؤإ٤LK6"ХLaLaLa }E0:e٥eإeץe֥eՐ؅٥ׅإօץՅ֩L8٥إץ֥հ'I8م٘؅ؘׅט}օ֘ՅLؤm\G0Q@Ն֩م؅2եمֆשم"ե؅֥م׆ةեׅ֥؅ץم؆لԘ)q} ` ? 7i ? %!Ls`ԅՅօׅ؅م`ԍՍ֍}׍؍ٍ`ԍՍ֍׍؍ٍ``, Խսֽ׽ؽ` ,}`+ĕ ԅ)@ޥ)JJJe)e e Je0F g} Lm8`@ԠՈքׄ؄`==W3>Tvb>2b'?h`06?2'A?%C4Vu?f'70P@U??CBH ? & ? QL}m8`0 I@ԥ) oǢҠ 1  ؠ e Q ?P ¥Ii )ԅ +ĕ}Lm`@"wf?IWQpIG?9 Wa9cU? 0d? 9`?BXGB?7?()q?D>DIh8E?hyx? )D?@ (1V?}wD3331??xS48`$)Ԧƅƅƅƅƅƅ mť)8@0$Յ)e)e F} 䰃 e Q F I`U9>`D'RFuCU?b9dYdg@W2@?tS)%)@0)%ԅ}P 1 ;  e°0 Q (Vŕ ԅԥ  ƕ m`8``0?i? Q }ԍՍ֍׍؍ٍ * m N ǥ N 0 -åJeF g`L ) e٥eإe}ץe֥eՊi؊؅٥ׅإօץՅֆե1ԥ'JffffJffffJffffJffffم`ԩ&&&&*&&&&*&}&&&*&&&&*``ۄܱ T **m ȰҠݤܱEۅڦڱ= bܥeƥ}iեL@ ` **)]P` 00`` ( ((((((((8`W)ߥ & &e} &߽aȅŊِ׼Ȅ⹕ȍqȅJJJJ&eXޥeYߥ䥈 9ȅFfЎᰈ Tȍ`Ȅ佘ȅ }M 8*` Ȱi祍La L< ʘ0  L } ȑ  L ʘ# ` |ʠ)ȱ Lt nʤ n |ʠ)ȱ)} `ʠ)ȱ ʆ8ƍ0eސ`Ɗ8ް`)ȱJJJ```= }`]``` H} h`Pi`)JJJeԅԘ)Peԅ`եԆ8@EB)JJJeԅԥ)Pe!}ԅԘ)eԅԽeՅ՘)JJJ}˅ԥ}˅`)JJJeԅԥ)PeԅԹeԅԹeՅդЧ` 0@P`'Nu pX@(#"}d,X L `8` ¥E)))8@8e0 څۅ܅݅ޅ߄ԠF0y ޥy ݥy ܥy ۥy#} ڥy و0ǠF0y ݥy ܥy ۥy ڥy ٥y ؈0ǠF0y ܥy ۥy ڥy ٥y إy$} ׈0ǠF0y ۥy ڥy ٥y إy ץy ֈ0ǠF0y ڥy ٥y إy ץy ֥y Ո%}0L`8`E)))8i@0 ڄԠ ( !   L* &} &О ( !   L* '} &О ( !   L* &О (}( !   L* &О ( !  )} L* &Оd ( !   L**} &ОL6 e e e e e i +} } } } } } } ǭ m m m m m m  } },} } } } } ǥՅօׅ؅مԅՅօׅ؅`hh !LHH`ؠ-}ɀhhHH֥ץ?ȱȱӰ8ְױօօ0LB Fehler - à  in Ze.}ile  ($8H h ) Programmende : os, un oder oad ?@ !D L RL L Filen/}ame D: Jȱɛ):ȱɛ.ȩCȩTȩBȥ SLȹD:LKHJJJJ h) 0:iLp 80}` B 0`L<馒撥ԝޥ՝*ޥ֝Tޥם~ޥ؝ޥٝ` ƒޅԽ*ޅսTޅֽ~ޅ׽ޅؽޅ`ƒޅ*ޅTޅ~ޅ㽨ޅ1}`撝ޘ*` ӥԝإ՝٥֝ڥםۥ؝ܥٝݥ`LT؅Խمսڅֽۅ׽܅ؽ݅`؅مڅۅ܅݅`2}ȱȱȱȱȱ`ȱȱȱȱȱ`٩@ةڝ۝ܝ`թ@ԩօׅ؅`  3}LQȱȱȱȱȱ`ȥȥȥȥȥ` wLH wh LQԄՠԅք` L 4} !ԝD՝E֝HeםI L`Laee 8厅叅eeL!)5}L)`x,Ң⅌Ҙ襉ҥ `8$ L8$ ȍ` JKiLH h)6}I ! SLJUVT`T L) ʥԤհ` L ` !L8, !L8 ` iLJ놈 LJ놈 ,LQ7} HԝDEILꆓBJKԝD՝E CL8醈 B LJ놈& LM J릓N8}LJL)NLM%L L j L `L=! Sp D o 89} LpL ,#,$,!pLL ,HBDEhHIL oL8馓HIBL !L8ɅĈeɐ ň:}`֥ԅԅՅ,`$8n!?! D i\ iU?! iD iE=D iH ih8DHEI;}HI C ,!L `L= JhhlԄե֥נȱհ  ȱօȱօ` L=Ԅ՘0)<}ȱհ ȱe懰楆ƇƆ`L)L=醈ɛi懠,ɛ󥆦 Seօ` Lt Ԥբ=}H e" hLQL=醈 *? , DEHI ` DLr 4 e"ɛ ,ЬLQ DL>} 4eɛ SLtI L L L L L@ ; ` ; ` ; ?} ` ; m` L=@@ȅ@`I`)` ; USN ; FG ; ?: ; @}201 ; &' ;  ;% ;L Lå ` : : :ڰ :ΰ :ǰ :оE%A} jE `0``֪ (ϰ`(8`8` B}ԤՅ` e"4 L= Ԅձ80  &ԅ L  eԪp`L) HJJJJ C}h) 0:i`Ԅ 0 ["ȱ)ȥ,  ՅԄ֩`?Ԣ )ɠڭ ) ڕLD} ^ L)8@L` )8@D:)8@-٩֔$ሄL` E} ^Ű$` hŰ` &ư` Rİ` Vİ ` rð` ƐL=0L L ;&)ԥ)8@עJjH@MF}C)JJJe)e F ¥P & F Q LL)HHHHHH Vİhhhhhh ðhG}ԅ` L %ઘ%ᨊ` ઘᨊ` EઘEᨊ`<|'gԥ0L=`  *  &L_,H}ڄ  eڅԥeۅհ"8څ֥ۅא8ܥݰ`۠Q%0ԅإՅ٥ަ0%Q% LI}ե0Lڤ`օנ6&֐ eו`L)ԘբՅ Ԣ Յ֠&&֐eܥeJ}ېڈ $0!ee80å/8ܥ۰uڕ0eUiV`TK}UV`8UV`eTi`8TȢ` !L8醊 æ f Ŋ :ƒޑȽ*ޑL}ȽTޑȽ~ޑȽޑȽޑȥԑȥՑȥ֑ȥבȥؑȥّȥȩhihHiH&HHH wh Lhh`hh`8M}` L=醊 f ŊHȱȱȱȱȱ妊 w Qh LhhHHe`*ȱȱN}ȱȱȱjEE `EjI ` p D il ie o"p"q" i i i i i io"8O}o" K膖  Lo"L=؝ٝڝ۝ܝ륄Lei  P}`L=饏őŐ%Ƒ8 Ƒ` f,L= fhhHH`, :hihHiQ}H`` J :hihil  ¥Ӡ L  @Մ$ Q` Q` QLQH R} h @Յ՘JJJJ y) 0:i`AVC2 5 - <) - < S}L L e e`e`&&&&&&eee` &&eee&*` uT}8)Ӱ% hhȱԅȱԅl ʰԤզ`hhheӨhiHH` u u88Ӱڪ :(jheӑhi LhU}פօۄڠ܄ݠFfؐeڅܥeۅ0&ۈ`L >ӆiHi0Hƒiֹ*i0Ѕ &ݤݥ &e܅ܘe݅V}hhLlӅ؄م܄0օצӽАԥեܤ Q `ƒ*ޅޅ wإW}ٰ5֥װ+ eܥe*ݨ &eܪeeըeԐ`L L L ӆ 4Ԥզ L_ ӆ Ԥզ LX}_ L LL=ӦԆՆֆ׆Lw Y٤ ۘ` Y  L~ Y ې Hh`פōČԅeY}Յe &"8ӥب`ƒޅ*ޅ L=؅مƒ8*ޥ֥אeԥe`Z} w㰶H wֆ׆h8Lԩ!HHֆ׊HHʽ޼*ԆեHL!àLLeԐ `8԰L)[}>><s3>00x|73>00x`c6<9c` 33c366fffg~33>00xgfffff<11111]}{UUUU *U@PTUTP@U* 0b1<=?<GD0EHI B^} V`}   Turbo BASIC XL                _}                                 `}Version 1.1 (C) 1985 Frank Ostrowski0} ! @} RLl LwD1:*.*P:E: VH) h(`ha}h@,lHH HHHHHHӍl"H HHl !`GHFHJ*K+\`* ` ӥԤ`pp@F]!Bb}A8!452"/"!3)#8,#ompilerc &rank/strowski` a$%Ȏ$!%!xөˍ c} e` e`@X ` ~   ʎDL ՠԢӱԙӹ`֝DEIHd}B V0ZڝDa۝E8օܥׅݥܝHݝI V02Ӡڑڑ0 BLVl `= Xe}ixD!YiE!80!1T  T \L/ 䥐 LZ Keine FehlerProgrammlaenge = 8o"f} Bytes GL# ĩ 䛛Bitte eine Taste dr cken L# ĩjB JKD E 0٩̍` !g}0` StoppedLL '!`HHBHI ąhh`旽`L5 ' '0 ' åh}ȥȥȥ ,© ĥŔHȱhL`Ԅթօׅآ&եeօ֥eׅץe؅` ٥ ¥ ¥i} ¥`HJJJJ h) 0HHH hhh`  F¥ =¥HJJJJ Fh) !`:eileO™!BHIԝDj}E L¥ Kein Basic-ProgrammLڥ۰ 'ܥݰ- ' ' ? ' ' ' ' ' 'iڐ۰`ok}"ܙݙ `ŭJ++i2R|+\Ng\+++c|dHyksl}|cc.t++i+`bfzvR+++++C|"u m}Speicher vollLei8eieiee褩%Ʀƨn}` B 0`H I/O Error - h L ' 'Ȧ䖐Ȅ !Åo}Թ"Å ť æّ`l Aƛƛ HiH Eh h L1ɭHisHL&Š Őƅڽ'p}ş`Ɯ ŅԽŅ L]ť<.ڈX"k87 9;?੃ 驏 饞7<:ƛƛșڥșڄLP H q}0.) ` &Ơ & H H` HIH hۆ `e (iLǽǽǽǽǽ"r}"țILFFȕ ȦǛǦǦǛǛǡǛǛǦǛǛǛǛǛǛǛǰǰǰǰǡǡǡ#ǡǦǽǛǽțǛljȉȉȉ#s} ,(""(2000000..222222222222222222222222222222**22*22(222(2222222222 ,(""(0000t}000--**2*(22(2222222FL驃 ǩFL驃 驗 LFLj ǩL驀,u}ɏɓ ɕ LǩLjȩ 驗Lj FL驃 驟 jȩL`FƠƠ 驉 jȩL驫,,eev}H 馜Ɯڹۅh LǠ EL1ɠ Eũ L1ɘH Ǥh8f@iiz (iLHLhhLmw}ؙěƛLȊȹؙěƛL8 ː#H Integer <0 oder >65535hԅթإԙإՙLȩ ƛgɻbɯ\[ɖXx}ɁSɌOɎKɔGɚXɜWɘ9ɀ<ɂNɃVɄYɈ\ɉcɊɋ-ɍɆɓ ɇoɅL;ě`ɃLLLˢ,,Ƀy}LLL^LȹF ɗUЮ,L-ɩLLLɹɅ IL-ɹɅ積 ILȊ8$יLz}șؘHؙěƛh`Lɩ,,LȹɃ ˈiإԙLʹV W Zл,,ة{}L-I#HɠA6'؅չ؅ԢIL-ɹؙěƛLLɹ(iL-ɩL-ɘHȹ؅ȹ؅ *!h`'|} hhՠ L HH` 䅤 ř 轊轊) ½  nicht compilierbar`  ***}} MUELL ***LLISENTECONNELOASAV4CSAV5CLOA7ERROS*URENUVDEWDUMXTRACTOKEN  :, ,Lhh~}ՠ LHH`H QJSBh` L Compiler FehlerL%ɂɸɠؠL}ěAت0װ)? Խչ L婢 ȹ )? !ěп`8P,,,,ȹ؅ȹ؅}4@.f"g6hLiOj26FɀQɁJTPq,p,o,r,C,BL!sv@ ԩt,u,yH }6hL!x,wH Lm楂ń兰!0$iԐń児ߩ àԈ 8 驠 (  ;}?L!F 橠L6ȹ؅ȹ؅ ذ А,  ,LL6hhH hLU L 8 驠 ( ȹ}؅ȹ؅Hi⢆ àhL!U,,, 詄,L6 ,),I 驪 驘 驨 驊L} !"#$%&'()*/012346=>ADEFGHIJKLMNOPQRSTUVWXYZ[\]^_5789:kl†,-+ ÈƇ.}L>}!.8NQ 驠,,$ ȹL L 颺,,ԩ 6詤L6 橱L6멢Ⱦ 6<,L!m,nH ȹ }hL!, L=,,,,,  QJSA`ު 阆٦` Ausdruck zu komplexLHH }àّٙhh`ئ`, 魁I& L= zȤɉ  L L XL L= }L- p L奝` LLL L꥝ 줗  Hdqr p> +HT V=,Ɂ%؅ԭ؅ՠ} ȱԪ 6+ L L $0 L 饙3 ` F HL L驅L驕,H zh ~} ɉ` E)  ذА جL- LL E2 ذ'#А ج -L2멄L} LL Zahl>255` zȩ LL!,,,H B LhL  hi  ` E멑 zȩ 륝 z L'L E LL}魁 H ,L L魁 LL #L餗 H , L HH 1hh`$,%H E LhL,H E멑 } ~ LhLLé,H hȥȥ`8Ƌ` `iȥi`H h DO fehlt` REPE}AT fehlt` WHILE fehlt` ,H hгȱȱLLL,H pɄ 񩄠  L婥 hL饀HH }ĩ  hh`ԥՠ8԰ձ ĩ L{ h L  Ħ {` zȤؠ }馕䔰 'LB` Ħ {`:LȱHeȱih` h ` IF fehlt` 2 H 饝}٢ æّ` E멑 t$0= L&L ŤH L phH t Lh 6(() 驰 6 ĩL } Ƭ*L FOR fehlt` + 饝` p L, 饝`-,J,.H h,KH hH 饝h` B L}/ 0L E L1L 쭁2,6,4H hHi 饝h` p ة9,:;LH 렌 =h,8H } = 렊 = hL魁6=,TH! H h?7 驠 L L H HI} Hۅ` L魁?L@,A,B,C,D,E,F,GH p LhL 렌 =I,HH 레 = 렊 =L pɄƛ L ĥ}b:j3L_L,N(' zȥ7ج ٥`P,R(/ ٥` ON.GOTO/GOSUB expLƛ }1LL LƚƚƚWL } Turbo BASIC XL Compiler Version 1.1 ===================================Welches Programm soll} compiliert werden? Geben Sie zuerst die Laufwerksnummer zwischen 1 und 8 ein, und w hlen das Programm dann mit den Pfe}iltasten , ,  und . Dann RETURN dr cken.Control D = R ckkehr zum DOSControl R = Reboot )LL}19卣 H $!h)!! ĩBD EJK  '0$ '  'ɛ撦? Ǝ LhT }T ĩLXixYii Ǝ   ɛI'-#4=0+&*"1}9L)0dž )L䒰D :)i  . (8 !BDE}JK ĩ}  L ԠʯΠ J LL ӠʯΠ JL o")1 )  } eŀ偐LM' :'7? / LLLL6墄,ȱuuL ,Lȱȱ }LL,ҩȱӠ$0 ,Lȱ iiҠLՆԥ֥נȱհ } J Zeile fehltȱ֪ȱ`ܹ J Label fehlt`Ԇե֥נȱȱհ8ְױօօ`ȱ}ܑݑ 7L LH Nh-:H NEXT fehltL EXIT ohne ...L LOOP fehltL UNTIL fehlt}L WEND fehltL# N ENDIF fehlt` Filename fuer das compilierte Programm?1 D}  :.CTB@ !0A+19ߐ~ © ƥLɛ%0:A[H h У.C}TBD:TUZ[ oT"U8oX"Y } Noch einmal speichern (J/N) ? !)_JN`LG R 0`H I/O Error - h LG 0` éȑ}ȑȑ 驛 Ģ éȑȩ` ""!B+W!k!}Tɩf{KH-}2(*oi.LG;3609JNxPSPS};wU >kQt3J,HNjv;}>WToU!J 1!^u$`@!r4 %gs}}8 4"+F:,(<(AQRRWDIWSRFTCNICDMINANLWWDWDDDHPFUTEMKIPODQTQNICNRCDHHTRNC}CFTDTDEEFPECMMMPAA*ATA~AAA\ AA 02A A }$A D VAW{|}~ @@@3@@@}@@u@AU@ @e!"#$@%@&A '@(@$)@H*?}+,-./0123456789}:;<=>?@ABCDEFd1@1} } HOME ENERGY PROGRAMn    A##@@K:bb9@,9@,9@,9}@<@,9@,9@<@,9@,mm9@,9@,;@$@,9@,9@<}@,9@,;@,9@,GG;@,;@,;@,;@ ,;@,;@,WINDOW R} VALUES1.01,2.22,1.815,3.155.909,1.667,1.437,2.137.909,2,1.724,2.564DOOR R VALUES.41,.75,.95,1.}1""FLOOR R VALUES AND TEMP CORR3.2,0,3.2,30,1.23,0##CEILING INSULATION R PER INCH"3.5,3,2.5,4.5,5.5,D6}7@,.WINDOWS/67@,.DOORSD67@!,.WALLS6267@1,.CEILING267@A,.FLOORS *;l68@},-@-68@,-@B68@,-@W68@,-@l68@,-@@DUCT MULTIPLIERSJ%%.2,}.15,.1,.15,.1,.05,.1,.05,.05T%%.2,.15,.1,.1,.1,.05,.05,.05,.05^##AIR CHANGES PER FOOT OF CRACKh39,74,52,24,32,33r}READ WINDOW R VALUES|-@@-@@"68<,-   READ DOOR R VALUES}(-@@"$68,-( $$READ FLOOR R VAL AND TEMP CORR5-@@"$68,-("168,-5}  READ INSULATION R PER INCH(-@@"$68,-( READ DUCT MULTIPERS-@@}-@@-@@"68<%$@,-   ''READ AIR CHANGES FOR INFILTRATION}&-@@0-@@:"68<,-D   NINSIDE DESIGN TEMPX6-@u6-@}Y%( (%(PRESS TO BEGIN:])@b,, #}WINTER OUTSIDE DESIGN TEMPERATURElv 6-& A}WINDOWS A DOORS A0WALLS A@CEILING APFLOOR ARDUCTS} A`REPORTS RESULTS 6-'++ "DO YOU WISH TO MAKE IMPROVEMENTS?:)@6.>:,6-@}4NA .* !}DO YOU WISH TO IMPROVE WINDOWS. 4Y A,( }DO YOU WISH TO IMPROVE DOORS, } 4Y A ,( }DO YOU WISH TO IMPROVE WALLS,  4Y A0*.* !}DO YOU WISH TO IMPROVE CEILING}.4 4Y A@>-)  }DO YOW WISH TO IMPROVE FLOORS-H 4Y APR,( }DO YOU WISH TO IMPROVE} DUCTS,\ 4Y ARf A`REPORT RESULTSp 6-'z$ $ HIT RETURN TO GET SAVINGS)@}+ Ap+CALCULATE A YEAR OF SAVINGSWINDOW SUBROUTINE#6-@#!@A@.. %}HOW MANY} DIFFERENT TYPES OF WINDOWS96-@6-*68,-968,-&&  ARE WINDOWS WEATHERSTRI}PPED$. 4Y6-@8-@B# SIZE #!@A`L NUMBER OF WINDOWSV`!!} SIZE OF WINDOWS (H,W) FTj t68,-$$~6-%+%,$68,-8,%8, TYPE OF WINDOWS 1}. SINGLE GLASS 2. SINGLE + STORM 3. DOUBLE PANE%% 4. TRIPLE (DOUBLE + STORM) TYPE O}F WINDOW FRAME  1. WOOD 2. METAL OR JALOUSE  3. FIXED6-8<, 68,-8,%8,$'} 68,- }( 268,-?$$8<,$<$DOORS SUBROUTINE#6-@#!@A } }NUMBER OF DOORS SIZE OF DOORS (H,W) FT  68,-$$6-+%,$  TYPE OF DOORS}*  1. WOOD4 2. WOOD + STORM>!! 3. METAL URETHANE COREH$$ 4. METAL POLYSTYRENE CORER\6}8,-8,f68,-8,$'8,p6-A8z## ARE DOORS WEATHERSTRIPPED 4Y6-@i68,-?}$$$$ WALLS SUBROUTINE '6-@6-?'6-?h ## }TYPE OF WALL CONSTRUCTION  1}. BRICK VENEER   2. STONE  3. WOOD SHINGLES   4. STUCCO  5. MASONRY BLOCK   6. LOG}   7. OTHER: ,, $ENTER CALCULATED R VALUE DIRERTLY& ,, $WHEN ASKED FOR INSULATION R VALUE0 : ??A1}@A1PA1`A1pA1A1A2D )6-? $@P! A2)BRICKN )6-?$@! A2})STONEX 6-? A2 WOODb *6-? $@! A2*STUCCOl #6-@ A2#MASONRYv '6}-@%$@! A2'LOG 6-OTHER .. &FOR LIST OF R VALUES FOR INSULATION ** "ENTER -1 FOR }INSULATION R VALUE INSULATION R VALUE  #  A5# A20 &68,-%%%&!@A}3@ "" HOW MANY STORIES IN HOUSE  (( WHAT IS THE CEILING HEIGHT (FT)  %% WHAT IS TOTAL PERIMETER }(FT)  &&68,-$$&8@,&8@, 68,-8,$'8, $ !!LIST OF INSULATION R VALUES ,, $}LIST} OF INSULATION R VALUES, WALLS ** "NO INSULATION (AIR) = .94 ((  BATT INSULATION IN WALL = 11 )) !H}ALF INCH ASPHALT BOARD = 2.4 ** "1/2 IN GYPSUM OR PLASTER = 1.39 ** "1/4 IN WOOD FIBER BOARD = 1.12 ** "}FIR OR PINE SHEATHING = 1.92 ** "3/4 IN PLYWOOD PANELS = 1.88** "1/2 IN PLYWOOD = 1.57   }$CEILING ROUTINE6-@/6-?a6-?a/!@A@`&& }WHAT IS TOTAL CEILING AREA} OF THE HOUSE68,-11 (HOW MANY INCHES OF INSULATION IN CEILING## TYPE OF INSULATING MATE}RIAL  1. FIBERGLASS  2. MINERAL WOOL##  3. VERMICULITE OR PERLITE  4. CELLULOSE FIBER"  } 5. U-F FOAM,66-$8,@68,-%%J68,-8,$'8,T$FLOOR ROUTINE#6-@#!@}AP@## }WHAT IS TOTAL FLOOR AREA68,-.. %HOW MANY ITEMS OF INSULATION IN FLOOR!@}AQ TYPE OF FOUNDATION 1. OPEN CRAWLSPACE-- %2. ENCLOSED CRAWLSPACE OR BASEMENT 3. CONCR}ETE SLAB68,-%$@%8,%68,-8,$+&8,,'8, $P DUCTSZ6-?d"@6-}@$n$$ IS YOUR DUCTWORK INSULATEDx!@AS LOCATION OF HEAT DUCTS:"" 1. ATTIC} OR CRAWLSPACE%% 2. UNCONDITIONED BASEMENT 3. IN SLAB FLOOR'' 4. INSIDE CONDITIONED SPACE}$pWRITE A REPORTz }HEAT LOSS EVALUATION  6-,,  ITEM AREA R-VALUE HEAT LOSS}  SQ.FT. BTU/HR -@@**68,-P:8,$A%?P,'A**68,-P:8,$A%?P},'A68,-P:8,%?P,BB 7$@&@ <+&@,$@%8,,8,8,8,6-%8,6-%8}, PRINT INFILTRATION LOSSAA  INFILITRATIONP:+8@,%8@,,'@%?P,))6-%+8@,%}8@,,'@CALCULATE DUCT LOSS26-'+8@,$$,&6-@26-@ @E6-@$} @56-@.##6-?%?$+@&,84N* @Ab@=%!@6-% Ab@}B @6-@L 6-@V6-8<%$@,`""  DUCT LOSSP:$%?P,j 6-%$}t   (~  TOTAL P:,P:,  DESIGN CONDITIONS:!! OUTSIDE DESIGN TEMP:}!! INSIDE DESIGN TEMP:!! TEMPERATURE DIFFERENCE:$X$$FIND SAVINGS USING DEGREE-DAYSb 6-Ai  6}. LANSING MId6-P:$$@$,f6-P:$$@$,v"" }TYPE OF HEATING FUEL USED  1. ELECTRICITY  }2. NATURAL GAS  3. FUEL OIL6-?UAqArAs Ap0ELECTRICITY$$ IS} HEATING UNIT A HEAT PUMP6-A40YAqP1 ENTER EER OF HEAT PUMP#16-$A- AVER}AGE $ COST PER KWH#-6.KWH6-P:'%?P, 6-$6-P:'%?P, 6-$  6-& At }NATURAL GAS*40 'AVERAGE $ COST PER THERM OF NATURAL GAS44 6-P:'+B0$,%?P,9 6-$> 6-P:'+B}0$,%?P,C 6-$H 6-&R6.THERMS AtFUEL OIL2. %AVERAGE $ COST PER GALLON OF FUEL OIL}2 6-P:'+B$,%?P, 6-$ 6-P:'+B$,%?P, 6-$ 6-&6.GALLONSGIVE} RESULTS6-P:$A,'A6-P:$A,'A46-P:$A,'A("46-=/+ "}TOTAL $ COST OF YOUR IMPROVEMENTS/6-P:'$A,'A$ REPORT SAVINGS AND PAYBACK.$$ }ANALYSIS OF I}MPROVEMENTS8   B  ENERGY NEEDEDL ORIGINAL HOUSE  V IMPROVE HOUSE  `  }(j SAVINGS& t ~  OPER. COSTS ORIGINAL HOUSE$ IMPROVED HOUSE$  }( SAVINGS$  PAYBACK  YEARS   // 'ABOVE IS BASED ON ONE YEAR OF OPERATION I}N $@DRAW HOUSEJ    T"@@"( ^&@@&(  h&@}@&(      r,@@,(  |,@@,(  .@}@.( $D:ENERGY:ů̠٠Рͪ SHAREWARE, HARDWARE PLANS by: 򛛛Ihis Batt }ery Backup system isdesigned to work with the Atari130XE, or 800XL computer. If youare running a BBS on an expandedmemor }y Atari, this will allow you torun the message bases in the Ram-Diskwithout fear of losing them due tothose little power " }blips" and longoutages. The little 10 second powerlosses are the most frequent cause ofheartache to a BBS SysOp.Well!, }fear no more. This hardwareproject has been several months inthe making and testing. I have beenusing it on my BBS (BBS: } EXPRESS!) forabout 3 months now and the Great thingabout it is you don't even have to openthe case on your computer as i }trequires no alteration to your computerwhat so ever. At first I thought about offeringit to Antic, or Analog for a har }dwareproject but then decided to release itas a SHAREWARE type, hardware plan.As you already know, Shareware reallyisn't }Public Domain material. If youuse these plans and they work foryou,any donation you care to makewill be appreciated and!, } mightencourage me to design a batterybackup for the MIO board by ICD,which would certainly be cheaper thana UPS, transve }rter type system forabout $200.00 and up.Plans For Battery Backup areCopyright (c) 1986 by:Pete Hunter Auctioneers In }c.2760 W. WhitesideSpringfield, MO 65807These plans can be built for about$25.00 from Radio Shack Parts.The Author ac }cepts no responsibilityfor them due to inability to controluser design techniques andworkmanship.Send all inquiries or }donations to:Pete Hunter2760 W. WhitesideSpringfield, MO .. 65807This circuit diagram was written withTextPro and sho }uld be viewed same orsimilar type program to be shure thatsome of the control arrow symbols aredisplayed properly. } |----------| | 12 Volt | -<<<|---o--o--o____o__o---o--o-- | | | | Gnd| | | | | | | | }| | | C1 | | =C4 | \ =C5 o--|(---o | |.1uf| R4/ | | .01uf | | | | \ |T1 | | } | | | | |o)|(o | | | | | | )|(--Gnd. | | o----o--o---o |o)|(o | | | | | }| | | | | | | |1 | C2 | |+ R1\ \ \R3|1 o--|(---o =C3 / /R2 / |7v | .01uf | |47 }00 \ \ \ | | | |uf | | | | | | | | | | | o-->|---o o-------o--o---o--o- } 276-1101  Gnd. 1N5400 Gnd. Power Plug connection to computer.Pin Configur }ation 7. .6 3. .1 5. . 4 . 2 1. } +5 Volts2. Shield3. Ground4. +5 Volts5. Ground6. +5 Volts7. GroundIf you can't find a 7 pin, DIN pluglike what is o }n your Atari powersupply you can get a 5 pin, DIN plugfrom Radio Shack..#274-003 for thepower plug....If you use the 5 p }in plug be extracareful as it is the same plug thatgoes into the Monitor Jack. If youplug 5 volts into the Monitor JackI } am sure you would have problems sopaint the plug red or something likethat if you use the 5 pin plug. Anyof the terminal }s that are marked +5or ground will power the computer.BE EXTRA CAREFUL WHEN HOOKING THEMUP AND OBSERVE PROPER POLARITY... }NOTE* All part numbers given areRadio Shack Part Numbers. Otherparts of equal value may besubstituted.Parts List:T }1..Transformer..273-1515..18vct (2A)V1..276-1770..5v regulatorHeat Sink for above..276-1367D1,D2,D3..276-1101..1N5400 Diod }esR1,R2,R3..271-1301..10 ohm resistorsR4..271-012..100 ohm resistorR5..Optional...See text!C1,C2..272-131..0.01uf capacit }orsC3..272-1022..4700uf..35v capacitorC4,C5..271-135...1uf capacitorsThis power supply can be assembledwithout a PC boa }rd by using a 5 lug,terminal strip. Be extremelycautious as you will have 117 voltspresent. The 2, 117v wires on thetr }ansformer should be taped andinsulated to prevent electricalshock. A PC board and plastic ormetal case may be used if des !}ired.PRECAUTIONSSome electronic experience is MOSTESSENTIAL to build this project.DON'T EVEN attempt it if you don't "}have the qualifing experience. Get afriend or someone knowledgeable inthis area to help. Most "HAM" Radiooperators would #} be able to help.GETTING STARTED:First wire the line cord to the 2,117 volt power supply leads on thetransformer and i $}nsulate them bytaping etc. You may also want toput a 1/2 amp fast/blow fuse inlineon one side of the power cord forprote %}ction. You can tell which sideof the transformer to hook the 117vline to because the low voltage sidehas 3 wires coming fr &}om it and the 117vside only has 2 wires.Assemble the rest of the circuit asper the diagram. Look the circuitover very c '}arefully before startingand if it is in a text file on diskI strongly recomend dumping it tothe printer, or drawing it ou (}t onpaper before starting the assembly.If you use a metal case for yourpower supply don't let the regulatoror heat sink )}get against it. Somepeople like to bolt the heat sink tothe case for extra cooling but itwill cause a short with thispar *}ticular type of regulator. Ifextra cooling is needed bolt it to apiece of scrap aluminium and keep itinsulated from the c +}ase. A plasticcase REALLY is better for ourproject.At the top of the diagram you willfind "D1" and "R5"...This is the ,}diode that allows the current toflow from the battery to the computerupon power failure. The resistor "R5"is a "BYPASS" "c -}urrent limiting"resistor to allow the power supply tocharge the battery. You may or maynot want "Charger" capabilities. .}Ifyou use a Motorcycle, or Car batteryyou will probably want to charge ita small amount. A 140 to 150 ohm, 1/2 watt resis /}tor will allow abouta 100 milliampere charge rate. A 700ohm, 1/2 watt resistor would allowabout a 20 milliampere charge. I 0}norder to determine other charge ratesand the proper combination ofresistors I suggest you purchase an"Ohms Law Calculato 1}r" from RadioShack for the small price of about50 cents. It is a small, sliding,cardboard chart similar to a sliderule. 2}In summation of the chargingsystem:If you don't want to attemptto build it just delete "R5" from thecircuit and charge t 3}he batterymanually, with a separate batterycharger. You can insert a DC AmpMeter in series with "R5" todetermine the amo 4}unt of current thatis actually going to the battery. The Diode "D1"will only let thecurrent go in one direction which is 5}from the battery to the computer. Novoltage will be allowed to go"upstream" from the computer to thebattery.If you use 6}lantern type batteries, theyare not designed to be charged sodelete "R5" from the circuitshould you decide to use this typ 7}e.I recommend a Motorcycle, GardenTractor, Car Battery, or Gel Cells beused as these will keep the computergoing for seve 8}ral hours. If you use GelCells be sure they are at least 5 Amphour batteries. A 12 Volt batteryIS NECESSARY even though we 9} are onlyending up with 5 volts to the computer. The 7805 regulator needsat least 3 volts above it's operatingvoltage to :} work properly. Thus the12 volts as 8 volt batteries are inshort supply. Anything other than 12volts are not recommended ;} becausethat is what I designed the circuitto work with.If you have trouble, questions, orsuggestions please call me at <} myBBS in Springfield, MO....The Auctioneer BBS417/887-4969...24 hours or!, write tome at the address at the top of the =}text.Please feel free to share these planswith your friends, or other BBS'.They are intended for plubicdistribution and >} may be shared ordistributed freely.Good Luck!Hope you enjoy the project! Sincerely, P ?}ete Hunter zD@@@@DDD$$BB00ss @D`oLLLL @LHLx DDNDA}$BB$  @hD(@d`@DDND@@H䬤""".⤤ꮢDD NB}N B"DnjƨȨΨȊ䤤**,**Īꊊƨ¢JJJJNJJNDD(HC}BB""@FNƨ nnʎ Ĥ( ,**@@JNJJΪƪƂn@JJnJJ ND}@NLNJBB@(ll(O |TUkO|`+ * 7|z`HH`L1}ɛ|UL||}L }II)PE}W | | 4} } |L1}Xi@ͥYi΢͑ˈXi˥Yi̩ˈ̠@ˈ`΍HPjH**&*&iͩF}ze΅`U|URUT |TT`X˥Y̠ˈ |RUTL1}`TXyR}˥Yyj}̥UJeː̅`@@@@@G}@ Uj1,HJJJJMI)P})P`,H MI)P})PH}`(PxkJKkJL1}kJ PI | 4} } ~JkɛLR~~Lq~}Ld~kL~K C|kL ~ ~kKk I}C|L} }JkL~ ~kUUiR|UTkL ~Ҏ҈L ~I P | 4} }`%H$H` L1}XșJ}~șL1}|?|}B|?|?|L~ ~)/ B VXͩB͍DE V~șzL1} ~ L~S COL80 7A00 7K}F80 '@@@@((((@@@@@@@@@@@@@@@@ ~~L})6^^<s3>00x|73>00x`c6<9c` 33c366fffg~33>00xgfffff<N}11111{!!\]_\ED!EOHI B V`}   O} TURBO-BASIC XL 1.5 (c) 1985 Frank Ostrowski!  ӥL]""$$ (pP}%J[WܠjeC /D%Zub2gTSt$8®݊Ò2% 5RQ}Ţtd.’$3@X7t5w5$?## $#L+D:*.*S:C:P:$#.#) `:#(6ENeU\l؏&/ؕ؄sأ$R}LENeU\lأ$8آǔƐƉƐƇ4cY%٦rULۉCۄړp^gyض%iwܸJڅ*ܣ$ڭڞجئأأS}$ ,(""(222000000..222222222222222222222222222222**22*22(222(2222222222 ,(""(T}0000000--**2*(22(2222222 V`hh@,lHH$HHHHHHӍl"U}H$HHl $`GHFH\` ` 4ӭ l 4Lq ӠԪӅԆL} Ӡ L( V}) ` b% +L:#HH 0 HHLj%ӥHlL{ee 8eeeW}eӦee褢%ƚƜ`88夅奅8X}夕奕Ӡȱȱȱ㦢`L+`8` .E)))8@8e0 Y}*څۅ܅݅ޅ߄ԠF0y"ޥy"ݥy"ܥy"ۥy"ڥy"و0ǠF0y"ݥy"ܥy"ۥy"ڥy"٥y"؈Z}0ǠF0y"ܥy"ۥy"ڥy"٥y"إy"׈0ǠF0y"ۥy"ڥy"٥y"إy"ץy"ֈ0[}ǠF0y"ڥy"٥y"إy"ץy"֥y"Ո0L-`8`E)))8i@0 *ڄԠ\}"("!""" "L**""""""&О"("!""]}" "L**""""""&О"("!""" "L**^}""""""&О"("!""" "L**""""_}""&О"("!""" "L**""""""&Оd`}"("!""" "L**""""""&ОL-6"e"a}"e""e""e""e""i""}"""}"""}"""}"""}"""}""ǭ"m"""m"b}""m"""m"""m"""m"""}"""}"""}"""}"""}"""}""ǥՅօׅ؅مԅՅօc}ׅ؅`` ` ` `80 `ԥՅ +.JJJJ)iFiFi1FicFi'ȐȦoFiUd}ȐFiiFi#iFiGi Fii@F iiFiiciՊFigi'iՊօשBL-`Ie}))83Ԥԥդե֤֥פץؤإ٤L,K6"ХL--L--L-f}-E0:e٥eإeץe֥eՐ؅٥ׅإօץՅ֩L-8٥إץ֥հ'I8g}م٘؅ؘׅטօ֘ՅL-ؤm\G0Q@Ն֩م؅2եمֆשم"ե؅֥م׆ةեׅ֥q}BXTURBOBASRTIBP\TURBOCOMCOMBQENERGY BASBCBATTERY TXTB @HIGHREZ COMBMTURBOBASCOMBTURBOBASDOCBTURBO DOCBWINDOWS COMBUMPER BAS؅ץم؆لԘ)q +` . |. &7i |. ,%!L?.`刱䈱㈱∱r}ሱ`ԅՅօׅ؅م`ԍՍ֍׍؍ٍ`ԍՍ֍׍؍ٍ`L.L. Խսֽs}׽ؽ` L%/`ӽޕ &ԅ)@إ)JJJe)e - Mt} 1. &Je0F 2 . /L(8`@ԠՈքׄ؄` . |. , . . |. , #/L(8`0 I@ԥ)u} 2f / . & r 1. #/ &?P , .Iiԩ +)ԅ ,ӽޕL(`8`$v})Ԧ61718191:1;1 (ť)8@0$Յ)e)e -F . / , . &1 1.w} #/ &F I`U9>`D'RFuCU?b9dYdg@W2@?tS)%)@0)%ԅԢ / . &G x} 1.Ӱ6 #/ &.ӽߕ ,ԅԥ B1 (`8``0?i? . . / , #/ &ԍՍy}֍׍؍ٍ . . ( / , O2 / ,0 .JeF 2`L+) .e٥eإeץe֥ez}Պi؊؅٥ׅإօץՅֆե1ԥ'JffffJffffJffffJffffم`ԩ&&&&*&&&&*&&&&*&{}&&&*`Pi`)JJJeԅԘ)Peԅ`եԆ8@EB)JJJeԅԥ)PeԅԘ)3eԅԽ3eՅ՘)JJJ}3|}}3`)JJJeԅԥ)PeԅԹ3eԅԹ3eՅդЧ` 0@P`'Nu pX@(#d,X L(  兢}}0襙 bɥ⥋㩀 50ɥ0DȱȱȄ   ik#ZMkVgğe拰ㅋ~}⅊0 eee拰 L f5дƨħ 4LY4 f5К,樥ŧH 4h h5L4樤ܱ.* O %30}  5Ԅ +(fԤԈ`ř嚰Ԥ`ڥۥड़0-԰eڅڐۈ0eeL+58` }O#`,#5  6`]5 6DE 68DHEIHI V0$ 6Sл B} V,# 6` $#LllBHI V0HH V0Ԩh``{a$%Ȏ$$xө$Ѝ$ `} `@X a Ӆʢ ʎD  _ɠ %` ɩHH `өL: g% D}:AUTORUN.BASөjJHH`ՠԢӱԙ!ӹ!`֝DEIHB V0Y|ڝDa۝E}օܥׅݥܝHݝI V0+Ӡڑڑ0`l `  䅠 _ɠԐ}e拢 &L &Lħ © ¥4 䥝ň剰' k ɀ8@4= LY ĩ`OJ ]J?L} KԪȱLRHHצ R, hhLRHHHHHH /0ȑȑޠhhhhh}h`HHHHHHHHHH $H bɐhȥLHhhhhLň剰)}i桰` )``L(兢ħ #$ x Hҩ h$襚ҥ ԝ`} UV #T` ` `,H ¥ȍ` JKhLŢ  #)I L ¤Ȣ`L¦ ¦ Lĩ} ½J*K+ $LąLĩ …L~ …`H Ġh é`,H hH Ġ  ĭ 8}}} L n [h`LkL © 8倝偝 Ġ  ĥ󥃅  Lĩ LH} éLH#h ĩ`H hKJ L+ , H hHHħ s hKhJ  Lĩ# qL } ŘL ũ& QŽLM " ĽNL  ĥԝL՝M  ĥԝN%LV  ¤ħ` Ťħ` ƪ Ċ }Ťħ` ¢`届 x݅ L ĽCӠɀ L]Ɉ L] Ln LŠI}HEDBL$HH hh +L `ħ LĢl ¦`YDAER ԅՅ֦}󅗄`L+ ¢p 0 Hp hɈL` ,#,$,!Lé ,H ĥDEԝH՝Ih L}©L $`L© , k ĩԅ  + ĥ 夨ħ`2ƪƪ ! A!Ƚa!Ƚ!Ƚ!Ƚ!Ƚ!}``氤hhL1@$ƪư 0 0 n$P`L+FҐ֥װ綾إٰو LǠFf}ؐ ee&ee* &eeeԪeըee$.ƪ@!Ƚ`!Ƚ!Ƚ!Ƚ!Ƚ!`檦}!!!!`!@!^!` Ȅ 8 n奱 ٥Lǥ֤צưĘ=ŗ78֪א& } eԥe$`L: L ԅՅօׄ 1פ& ٤ţĢԅeՅe8包卅 ]&} 8Ԩժ%אְ`ֆL夨ħ` FҰg8&0ei֥i0Tׅiإi0BJe؅eم0&f}fff&0 &0 eeL+օפإ颎 %8包ԥ卅 L ɥ }ȱъŠe拰8``,ªȱȱI ѝ3ȥLɥHHO]}  ȥe暰Х ȥL+ʅȱhh`Lħ OԪȱԨ``L :0} `L(奷 bɥ󥋅ȱȱȱȄ#鈄0B8eeŶ}ɛ,@LBˤ,ɛ`L?± ˤ樱f Oƨ x݅ + ~ [ˠ O樥0# +  L˥`}LL :ɛ,$PH h $P润䧰 ʐLʦ䧐 +` ʐL3LBˢ}ԝD՝E֝HםI L 兢L]& 兢L% ,L6 ,L6 &L6 (L6妪@!I@!` ؐb`P KW ؐRB ؐ}=;G ؐ4@ ;+ƪƪ@!=A! (ƪƪ@!A! ƪ@! ,@@檦@!`!!!!!!`ƪ@! ǩjҤ} /L.٤ƪƪ@!@!, 舽`!`!!ـ!!٠!!!!!`@!jI*` . ֪ (}ϰ`(8` ֤ׅԄ +҅L: Lyƪ8吪周Ly sũ + ŐL Ly sŠԄ h L}} L}٩    e쪽pLyL( + ڥHJJJJ h) 0:i`  ک; n +ȱ)ȥ%}ݓ Lh ԍՅԄׅ֩өL:ƪ?Ԣ )ɠ )  -L &Lڦ@!)@!` n)8@} -L:` / n)8@I= n)8@/ѩ֔$ሄ ,L: + n 0L8 n} 0L8 n H1L8 n /L8 n /L8 n D/L8 n 1L8LLإL( &)ԥ)8@JjH@}MC)JJJe)e .F / .P . &F . #/ &L.L(HHHHHH /hhhhhh &} Y/hԅL:,` L _ܘ%ᨥ%Ly _ܘᨥLy _ܘEᨥELyٚ<|'g 0L`}!!!!i ` &LإL٥LyɥLzvmZ ƨ!0 4 䦵 ¥ԝD՝E֝Heם}I Lܤį eį L` x݅ƨLLLܤ ©`#ۢ Lĩ_,ߤ} ڄ . eڅԥeۅհ"8څ֥ۅא8ܥݰL۠Q%0ԅإՅ٥ަ0%Q% }L-ե0LޥڤLyمօנ6&֐ eו`L( Hħ hբՅ `ޥԢ `ޥՅ֠}&&֐eܥeېڈ 7 \ 7 j N \ N j$0!ee80å/8ܥ۰uڕ0}eUiV`TUV`8UV`eTi`8TȢ` $L„')Q ȱ8 e}新`8`L齀).Q Ӱȱ8e新 O :L䅫# *$Ŭ} Ʃ HL"䥫ș L` Ml/#樱0ZS'`ȱȱȱȱȱȱȄ`ȱօȘuԩׅu՘e֨҄`}I 屝Ҡȱȱȱȱȱ` n$҅J?eԨe` L 兙 兛 n %3 Ԥ` ҩ,} , , L檤 ٙ!ؙ!י!֙!ՙ`!ԙ@!ә !ҙ!` 䤪ƪ!ٹ!ع!׹!ֹ`!չ@!Թ !ӹ!`ƪ!!}!㹁!a!A!Lp ґȥӑȥԑȥՑȥ֑ȥבȥؑȥّ` ***j)e)e`ʭȅiȅ}iȅȩȩ Lfإ  4  \ +] ¥򄟄}   넨ɛ$0L祔 Z f0#ڠ쩀 ߩ6ei$0 녖چ + !5}ɛȑ @膔7 ɛ 襔!ɛL! _ɩ8$IȢ %e拢 } &!$P* &8孨客 "&$ 1L~ L~ &L _ɰe拢 &L~ +0 %30Ԅ }L 9:枢0 O L :H9Hhh tLHH`h}hLCL馩`ʆLC枢0ְşLC`A枢Ɣ!L!L}!T 򈩛LQLD ijq ߰,iŰD VD8` 覲`8` 넬 S( +饰}0 S0:$$ p8`$p (ȩ@҅ҥ򄬤 ߰ A L8򨢄 %Ӥ򈦬ʽ ʽ % }+HH 屝EҨhh$P0Ƭ 襯I `_A[`8`80 &Ոԅ}` 넬$ +  + h갳 h) + , 褔ԙ!` "8` 襔 ɛ "ȱ"}嫤!`! `) ɛ%)a{)_0:A[_դ`RE͕DATINPUԑCOLOҝLISԖENTEҚLEԛIƜFO}NEXԑGOTϑGO TϑGOSU½TRAАBYŐCONԞCO͟CLOSŐCLҐDEǞDI͐ENĐNEנOPEΖLOAĖSAVŢSTATUӣNOTPOINԡXIϤOΒPOKťPRINԐRAęREA}ĨRESTORŐRETURΩRUΐSTOАPOХGEԫPUԑGRAPHICӒPLOԒPOSITIOΐDOӒDRAWTϓSETCOLOҬLOCATŔSOUNĦLPRINԐCSAVŐCLOAĚERROR- }DPOKœMOVœ-MOVŪ*ƐREPEAԑUNTȊWHILŐWENĐELSŐENDIBPUBGEԒFILLTϐDϐLOOШEXIDIҖLOC˖UNLOC˖RENAMŖDELETőPAUSŖTI}ME$PROøEXEÐENDPROÑFCOLOҪ*̕-RENU͒DEDUMЪTRACTEXԖBLOAĖBRUθGO*’PAINԟCLӔDSOUNCIRCLū%PUԘ%GEԚG}OTGOSUTSTETHEΣ<<>ުNOOANĨ<<>STRCHRUSASVALEADATCOPEESIRNFREXLOCLOSQSGABIN}PADDLSTICPTRISTRIDPEE˦INSTINKEYEXOHEXDEDIFRATIMETIMMOEXERNRANTRUN%%%%GOUINSTERER+,%5}&6(+8,<Xk`fghilm^deDѳHc?,Ќ,е,Y_Ҳ+7,/0}1 2!3"4Ɛ"-"."-؂ٿ֐ː}ĐאŐbj+9,+;,ʐͭ}ͭ@ABC\=>[<+:е<,&%rvnnxc<\}-78s_XV+@D&0d*"'2GJh N}Rl~&2 +饰(+VWZ ]a8`L`  ¤ħ.H h L5 䄡 } 䅭 bɠ04Ů .ŭ%) e拰 ĩ L+Ư0 Le}`毤Hɛ) h`  L ȱ R @ʆ ȱȄ Iğ` :62T F :}7 8 Lbԩ- L 8 8,I ɨ 8L.UH `ƨh $ %3   + \L L 8󅯩" } 8" ©" Ư" L8q :Z#]abj(=) W같  L樤ħ`hh`H YhZ }L<>EO ƹƹ0`H f5h`I&` =? FQA` L񄳱ȱI 䦐}Ħ ąŅ T k /䧰 k ,Ǡ ĩJH ThĥȑĥȑĦʊȑ`HHąŅ}H h hhhh ȱIELZ L`ȱI Hȱȱȱȱȱ }, h @ $L+L.*ȱȱȱȱȱjEE `EjI `e`ħ ¥}0 ` Lk 䦪`! 䧰L A@L `I&`L ©؅ L.}0`STOPPED륺 bɠhhL :ʅ` k %3Hƹ h5h`hbjH h #}ԤLQ #LLei  `LԑȥՑȥ֑ȥבȥؑȥّ``䈥剰}#)iiLɠL4űI&`048ץğ=ȱȄ }`L  L0e拠0ȱȄL  䦪`!' >?L (<ж`!  $Л +`,LőŐ78Ƒ8 Ƒ`8` - PѠ}`,,L L PQ 8,L ȱI ѝߠȱ`ԩ},L E  $EL+L],,,؍ 0âLɀL ©7 F󦹩 RbL g }0g `Ո V fL{Ն + +􅕄L AT LINE?BLOAMEVALU>#VAR$LE?DAT>3276INPUDISTACOVERFLO?LIN?}FOTOO LON?DE?GOSUGARBAG?CHMEͣ?LOA?NES?WHIL?REPEA?D?EXIXPRO?EXE?PRO?IS OPE?DEWR ONLCMNOT OPEΣRD ONLEOT}RUNTIMEOUNA!FRAMCURSO!OVERRUCHKSUDONMODNOT IMPRA͠D?>#FILEDSK FULFATAL I/FILENAMPOINLOCKEDCM>DI}?FILPOIN?APPNBAD SECTORӥHՄ +h & .hԩ + ,҅L: ƪn (@Մ$ 0` 0}` 0LoH - . /h &@Յ՘JJJJ X) 0:i`AVC2 sŠ 5  <)  <} L L + e +e`e`&&&&&&eee` &}&eee&*`` 兙 䦪!0 4 ۄܱ **m ݤܱEۅڦڱ= } ܥeƥiեLN@ ` **)]` 00`` ( ((((((((8}`W)ߥ & &e &߽řِ׼JJJJ&eXޥeYߥ䥛 9 FfЎᰈ } `  M 8*` 兙 󥐅i祣L{ &L}  0 & L ȑ & L; # )ȱ L })ȱ) )ȱ 8ƣŐő0eސ`ƙ8ް`)ȱJJJ`}``=`]``` E߭H Ġ} hL±&Lv`[  ȱ R] } L L  䅠 bɰhhğȱȄ L l"0e拱LjLxh TURBO BASIC COMMAND LIST Compiled and Translated by } Dave and Laura Yearke This documentation is provided by the Western New Yo}rk Atari Users Group and may be reprinted freely provided this credit is included. } In case you've just landed from Mars, or just plain haven't heard yet, TURBO BASIC is the exciting new Public D}omain Basic Interpreter that we recieved from the Atari Users Group in Holland. It works on the XL or XE }series of Atari computers. It's almost too good to be true and should be a definate must for all XE or XL} Atari owners. Turbo BASIC, in addition to offering 42 more commands and 22 more functions than Atar}i BASIC, gives the user 1603 more bytes of program space by "hiding" part of itself under the XL/XE's ope}rating system. It also runs 3 times faster than Atari BASIC, includes most DOS commands, has advanced graphics and} programming functions, and is insensitive to lower case or inverse characters for most commands. } TURBO BASIC COMMANDS: Name Syntax Description -----}---- ------------------- ---------------------------------- Disk I/O } BLOAD BLOAD "D:name" Binary loads file name (DOS option L with /N}). BRUN BRUN "D:name" Binary load and run file name (DOS } option L). DELETE DELETE "D:name" } Deletes the file name (DOS option D). } DIR DIR Disk directory (DOS option A). } DIR "Dn:*.*" Directory of drive n, note that wildcard extenders may be used.} LOCK LOCK "D:name" Locks the file name (DOS option } F). RENAME RENAME "D:old,new" Renames the} file name (DOS option E). UNLOCK } UNLOCK "D:name" Unlocks the file name (DOS option G). } Graphics CIRCLE CIRCLE x,y,r P}lots a circle with center at x,y and radius r. } CIRCLE x,y,r,r2 R2 is an optional "vertical radius" for tr}ue circles or ellipses. CLS CLS Clears the screen. } CLS #6 Clear screen opened in channel 6. } FCOLOR FCOLOR n Determines fill color. } FILLTO FILLTO x,y A fill command analagous to the BASI}C commands "POSITION x,y: XIO 18,#6,0,0,"S:" } PAINT PAINT x,y Another type of fill command, this one is a }recursive routine that will fill any closed object as long } as x,y are inside it. TEXT TEXT x,y,a$ bit-bloc}ks text in a$ at x,y. Memory  } DPOKE DPOKE m,v Pokes location m,m+1 with 2-byte integer v (0 <= v <= } 65535). MOVE MOVE m,m1,m2 Block transfer; moves m2 (number of } bytes) from starting position m to new start }ing position m1. -MOVE -MOVE m,m1,m2 Same as MOVE but copies sta }rting with the last byte of the block. } BPUT BPUT #n,adr,len Block Put; same as FOR I=0 TO len-1:PUT #n,PEEK (a}dr+I):NEXT I BGET BGET #n,adr,len Block Get; same as FOR I=0 TO } len-1:GET #N,A: POKE adr+I):NEXT I }%PUT %PUT #n,a Until now, there was no convenient way to put numeric v}alues onto disk or cassette files other than by } using PRINT, which converted them to strings first, a slow and } cumbersome process. %PUT puts the number to the device "as is,"} in 6-byte FP format. %GET %G}ET #n,A Get a number stored with %PUT from the device and store it in varia}ble A. Again, this is much faster than } using "INPUT #n, A". Structured Programming } REPEAT REPEAT Start a REPEAT-UNTIL loop. U}NTIL UNTIL Terminate when condition met. WHILE W}HILE Start a WHILE-WEND loop to end when condition met. } WEND WEND Terminate a WHILE-END loop. } ELSE ELSE Optional extension for IF. The IF } condition must not be followed by a "THEN", but terminated by } end-of-line or colon. ENDIF ENDIF E }nds an IF-ELSE-ENDIF or IF-ELSE condition. Note that this allows !} an IF condition to span more than one BASIC line, provided the ""}IF" statement is structured as shown in Note #}4. DO DO Starts an "infinite" DO loop. $} LOOP LOOP Cycle back to the start of a DO %} loop. EXIT EXIT Exit a DO-LOOP loop.&} PROC PROC name Start definition of procedure. '} ENDPROC ENDPROC End definition of procedure. (} EXEC EXEC name Execute procedure name. )} General Programming PAUSE PAUSE n Pause processing for n/50 secon*}ds. RENUM RENUM n,i,j Renumber the program starting at +} line n,first number is i, increment is j. This func,}tion will handle GOTOs, TRAPs, and all other line -} references except those which involve variables or computed .} values. DEL DEL n,i Delete lines n-i/}. DUMP DUMP Display all variables and values. 0} For numeric arrays, the numbers are the 1}DIMed values plus one. For strings, the first number is the 2} current LENgth of it and the second number is the DIMed size of it. 3} DUMP also lists procedure names and labels wi4}th their line values. DUMP name DUMP to device name, s5}uch as "P:" or "D:DUMP.DAT". TRACE6} TRACE Trace program during execution. TRACE -7} Turns trace mode off (Default). DSOUND DSOUND n,f,d,v 8} Form of SOUND which activates channel-pairing for increased 9} frequency range. DSOUND Turns off a:}ll sounds. GO TO GO TO n Alternate form of GOTO. ;} *L *L Turn line-indent on (Default). <} *L - Turns line-indent off. =} *F *F (or *F +) Special mode for FOR..NEXT loops which corrects>} a bug in Atari BASIC. Seems that in Atari BASIC, ?} an "illegal" reverse loop like "FOR X=2 TO 1:PRINT X:NEXT X" will @} execute once even though the condition is met initially (XA} is already greater than 1). Turbo BASIC fixB}es this bug, but leaves it available for Atari BASIC programs C} which may take advantage of it. *F - D} Turns off the special FOR..NEXT mode to make Turbo BASIC act like E} Atari BASIC. *B *B (or *B +) CommaF}nd which allows the break key to be trapped via the "TRAP" G} command within a program. *B - TurnH}s off the special BREAK key mode. I}-- -- Special form of REM which puts 30 dashes in a program lJ}isting. Line Labels K} # # name Assigns the current line number to the label name. L}This is a convenient way to get around the prM}oblem of renumbering when using variables as line numbers. Labels N} can be thought of as a special form of variable, as they occupyO} the variable name table along with the "reguP}lar" variables. We also believe that the number of Q} variables allowed has been increased from 128 to 256 to allow R} for the addition of these labels. GO# GO# naS}me Analagous to the GOTO command. ModifiT}cations CLOSE CLOSE Close channels 1-7. U} DIM DIM a(n) Will automatically assign a value of zero to all eV}lements of the numeric array being dimensioned, W} and null characters to all elements of a string (The LEN is still X} variable, however, and initially zero). Y} GET GET name Wait for a key press, assign the Z} value to name. Same as "OPEN #7,4,0,"K:":GET #7,name:CLOSE #7". [} INPUT INPUT "text";a,b... Prints text as a prompt before \} asking for variable(s), same as Microsoft-BASIC. ]} LIST LIST n, List program from line n to end. ^} ON ON a EXEC n1,n2,... Variation of ON...GOSUB for procedur_}es. N1, n2 and so on are names of procedures to be run. `} ON a GO# n1,n2,... Similar to ON...GOTO except that a} line labels are used instead of line numbers. b} POP POP This command now pops the runtime stack foc}r all four types of loops. PUT PUT n Same as "PRINT CHd}R$(n)"; RESTORE RESTORE #name Restores the data line indicated bye} the label name. RND f} RND Parentheses are no longer needed at the end of this command, g}but it will still work if they are there. h} SOUND SOUND Turn off all sounds. TRAP TRAP i}#name TRAPs to the line referenced by the label name. j} Arithmetic/Logic HEX$ HEX$(n) Convertk} n to hex string. DEC DEC(a$) Convert hex string A$ to decimal. l} DIV n DIV i Integer quotient of n/i. Mm}OD n MOD i Integer remainder of n/i. FRAC FRAC(a) n} Fractional part of a. TRUNC TRUNC(a) Truncates fo}ractional part of a. RAND RAND(n) Generates random numberp} 0-n. $ $nnnn Allows input of hexidecimal q} numbers, but they are converted to decimal. Ex: "FOR r}I=$0600 to $067F" => "FOR I=1536 to 1663". s} & n & i 8-bit boolean AND. ! n ! i t} 8-bit boolean OR. EXOR n EXOR i 8-bit Exclusu}ive-OR. Memory DPEEK DPv}EEK(m) Double-PEEK of m,m+1. TIME TIME Timew} of day(numeric). TIME$ TIME$ Time of day string, HHMMSSx}. Unfortunately, the time commands don't wory}k properly because they were written for European Ataris z} which operate at 50 Hz, instead of 60 Hz like American ones, the net {} result being that they gain 12 minutes each hour.|} INKEY$ INKEY$ Returns last character typed. }} INSTR INSTR(x$,a$) Returns relative location of start ~} of string A$ within X$ (returns 0 if not found). The m}atch must be exact; strings with the same let}ters but differences in case or type (normal or inverse) will not } be found. INSTR(x$,a$,i) i specifies t}he starting point of the search. U}INSTR UINSTR(x$,a$) Same as INSTR, does not distinguish between case or inve}rse characters. Ex: UINSTR("HeLlO","hello") returns } 1. UINSTR(x$,a$,i) Specifies optional starting point.} ERR ERR Value of last error number. } ERL ERL Line last error occurred at. } Constants %0, %1, %2, %3 - These four constants simply sta}nd for the numbers 0-3, respectively. The difference with using these }in a program is that "X=1" requires 10 bytes, whereas "X=%1" only needs 4 (numbers } require 7 bytes, 6 for the number plus an identifier preceeding it. It is always a go}od practice to make variables for numbers that are used more than three} times in a program). NOTES: 1. Variable, Procedure and Label nam}es may contain the underscore (_) character. 2. To print a double-quote (") in a text} string, use two of them together, instead of the Atari BASIC method of using CHR$(34). Ex: "TE}ST";CHR$(34);"TEXT" becomes "TEST""TEXT" in Turbo-BASIC, both of which produce the output => TEST}"TEXT. 3. Upon initial boot-up, TURBO-BASIC looks for a BASIC file named AUTORUN.BAS. If it finds an} AUTORUN.BAS file, it will automatically load and run this file. 4. Turbo-BASIC also prints out Engl}ish descriptions of all errors, including several new ones for errors involving the new commands:} Error - 22 ?NEST = Loops not properly nested. Error - 23 ?WHILE = WEND }with no corresponding WHILE. Error - 24 ?REPEAT = UNTIL with no corresponding REPEAT. } Error - 25 ?DO = LOOP with no corresponding DO. Error - 26 ?EXIT = EXIT is o}utside a loop. Error - 27 ?XPROC = Error executing PROC. Error - 28 ?EXEC = ENDPROC wit}h no corresponding EXEC. Error - 29 ?PROC = Procedure does not exist. Error - 30 ?# = L}abel does not exist. Also, Error 15 has been expanded to include an UNTIL which } relates to a REPEAT which has been deleted. 4. A multiline IF is constructed like this: } 10 IF X > 10 20 PRINT X-10 30 GO# TOO_BIG } 40 ELSE 50 PRINT X 60 GO# X_IS_OK 70 ENDIF } Note also the use of line labels in the GOTO statements. -- Dave & Laura Yearke } /*************************************Number: 1472 Name: TURBO BASIC COMPILERAddress: CYCLONE Date: 861119Approximate #} of Bytes: 11340Number of Accesses: 40 Library: 2*************************************Description: This is a compile}r to take TurboBasic programs, and compile them intocode that will run about 3x faster thanthe already fast Turbo Basic! }Youalso need the next file, URBO BASICRUNTIME. To operate, just follow theon-screen prompts. Then, rename thefile to AU}TORUN.CTB. Go to DOS, anddo a binary load of TURBO BASICRUNTIME. This will automaticallyexecutethe compiled file AUTORU}N.CTB. I haven't used this much, so Idon't know if one file can callanother,or any other specifics. I do know,howev}er, that the files this createsarefaster than any other Basic-type files! } - Bill SheppardKeywords: turbo,basic,compiler,language-------------------------------------File: TURBO BASICCOMPILER}is an XMODEM File.Press to skip, ownload,ist, or uit.#*************************************Number: 1}473 Name: TURBO BASIC RUNTIMEAddress: CYCLONE Date: 861119Approximate # of Bytes: 11340Number of Accesses: 43 Library: }2*************************************Description: This is the runtime package neededto execute Turbo Basic files com}piledwith the Turbo Basic Compiler. Simplyname your compiled file AUTORUN.CTB,load this runtime package from DOS, andyou}r compiled file will (very quickly)run automatically. - Bill Sheppa}rdKeywords:turbo,basic,language,runtime,compile-------------------------------------File: TURBO BASICRUNTIMEis an XMODE}M File.Press to skip, ownload,ist, or uit.#Ao  L    `hhhdhhchheghhfhhhb)jc˩&&&̥ˍ`̍a&&"}m`˥made˅˥ieXˍkeY̍l8(eim ͭ 3mˑͩ  3gghhmi˥i̭e"}gL %ˑ 3̑ 3i 3f 3e 3bLeʎnfok˭l̩Q j AeE j R| jˬe R"}ooZ j AC jeLhmL m͍eg ͍fh ͍i ͅ ͅ ͑  %ggeg8i"}˥hh 3ͅԥ΅`i˥i`iͥi`8˥`8ͥ`nR j`i(˥i`"}" 3ͅԥ΅`i˥i`iͥi`8˥`8ͥ`nR j`i(˥i` SMOVCHAVALUBUMPENULOSIDBALSLXLOATSDELAGFLOADLOADXXYYNXWWILHST&}TINTWXNTMVILLETTESTEVGCOPPIN &} @&}@ !"#$%&'()&}*+,-./012345678&}9:;<=>?@A ""BUMPER POOL - BY STEVE SMITH7516 BURKE ST&}REET, NEALBUQUERQUE, NM 87109(f#@@S:- A?@Q@@9f9@&}<@,2n }AR@--@@*@@2J AV6-b6-n6-d&}i%236-%@?6-@Q@w]"@i6-@4n% Ai"@&}%6-W6-#-@@W8<@,*8<@,A # 6-% #"@U&}A Af6-8<@,%6-8<@,66-8<@,<6-B6-X!@* @f6-%@&}!@6-&@1#"@)"@)"@16-&@'!@* @'6-%@! 1&}@2! AP"!! @)!@APY!! @*"@8AP^!!!@*"@AP&}cP/"@8*!@*+!@* @,F68<@,-@P AdD#"@* @*!@:68<@&},-@D AhY -*@%@$-7*@@2H68<@,-Y68<@,-{%2@&}I2@P%@@m68<@,-8<@,&@q { An6-8<@&},"6-&@. <6-%@n"@)"@)"@)"@Ae5"@ 6-%@&})!@56-@"@ AeV6-&@@+"6@)"@,*+@"*@,L6-@V&} AeH2+"6@)"@,*+@*@,>6-@H AeG1+")"@,*+@*@&},=6-@G Ae=1+")"@,*+@*@",=6-@V"@)!@;2@@&}@@L68<@,-V A}68&@<@,-@68&@<@,-8<@,Q68<@&},-s2@@@@} APUT BALL IN HOLE%%2:' @&} 6-%@&6-:"@AP7!@6-%@#6-7"@APy -*@@23&}68<@,-J68<@,-^-@@u68<@,-y w-@@#6-@&}/6-?P;6-@E API U6-@a6-?m6-@w AP-%@"&*@%@H&}2@j2@|AA Ae2@@@@&};2@@B@C6-$WA%@de!AP$$ @}$-@@/"@&}