@L}5 _$% l0$)$$Hȱ$ UhL" `e$$%`$%`  R@P!( L(1   Y I`  d  Ld M * @  $ % CC$$)%1 Udߥ$9%: !0 S$% DD˙`  }J)Lr d M * @  $ % CC$$)%1 Udߥ$9%: !0 S$%} DD˙`  }J)Lr J  ((  p L ()   J}L= ( L 0q A    IB JC;? D W } LL  ` W )LA!  ߰")-݆ p" } $G@LL 08`Q")<2Q0 -G$Ș݆ UL# ; p8(()(0ʥ)NQ` }$GȘ݆LU )L ݆ L GȘ ݆LL )W>Z   HH)H }p h  hyhy D L> L JJ    ! LA*` BF }7'8  M HN H` 8 Z  \LdJJ!"! GFE@F (!L }EE !E^ ^ E E7EȩEdE/EȩE  D } .L }  ;F d  ;?F7F? ( .   Z D LL d } . D  L    p  E` , d)  D L) 0BM݊L݉} ML  N݆ L NLML [ TEqEHȱEqEh 0Gȹ G} HLL GɛL  LFREE SECTORS G) *Gȩ GȽG GȌ*jj >G} C8jJ3j2CD( C202C ԠBX` N 1? l LlD:RAMDISK}.COMLu L1 L ;LHL  T`  `1  ɐ     `TU  } L ? .  t`GBJ ~DEHI B V0dV!}QDEHI VF9 ,0 ,0 s0hhL  L` H hDHEh"}DEL8HI4 0 HI,0 0  9 .G VLO#},0 L4*IJ`llD1:AUTORUN.SYSNEED MEM.SAV TO LOAD THIS FILE.D1:MEM.SAV J y08 B|DEHI$} V0 0`B;DEL`?<0LV`@ʆ v s? F0Ξ05: [ BDEHI%} VY8 B V  @  /DE `E:D1:DUP.SYSERROR-SAVING USER MEMORY ON DISKTYPE Y TO &}STILL RUN DOS B;DE J  (` 9 V⪍ ઍ  -'}LLu ÝDEHILV 9 .l 9 .l  `` s$B BH(}I|DE V BLV nB,DE JLV B V BLVDEIʩ BꭝLu  } 3E:}DISK OPERATING SYSTEM II VERSION COPYRIGHT 1984 ATARI CORP.A. DISK DIRECTORY I. FORMAT DISKB. RUN CARTRIDG*}E J. DUPLICATE DISKC. COPY FILE K. BINARY SAVED. DELETE FILE(S) L. BINARY LOADE. RENAME FILE M. RUN AT ADDRES+}SF. LOCK FILE N. CREATE MEM.SAVG. UNLOCK FILE O. DUPLICATE FILEH. WRITE DOS FILES P. FORMAT SINGLEL !N',}#"&))9(&*)/h)''-&؆莟R'S  vL/ˢ L }Insert DOS 2.0s, type Y Λx -}DEfHI 1莏#q! @ y0ɛ8A0,' ȅ 1 1ild! 1L!NO SUCH ITEMSELECT.} ITEM OR FOR MENU! 0 .z:*{}.|{ 1 0 0JB 18L%|DL/}%DIRECTORY--SEARCH SPEC,LIST FILE?[# 0 0 &|D3" 1L!NOT A DISK FILEN !B 1L!E# 1 !BD0}ED:}:1BJ|DE 1DEBHI 1 h0ߢ 0.1}  0?詛 1 y0YЛ 1 ;#L" ;#L! BL1TYPE "Y" TO DELETE...DELETE FILE SPEC2}COPY--FROM, TO?OPTION NOT ALLOWED736 FREE SECTORS COPYING---D1:DIRECK.COMl# 0|D .L/%#3}##JB|DE 1BHID#E 1#0: B 1L!#͑### B 1#c$0SY4}S1}:## # # .#Ƚ# # 𩛙## 1,#PD#ELJ- <.BJD#E 5}1 1HH 0hh|DL%1}:̳# L% #D#EL% 1 0 . .0O% 1L!WILD CARDS NOT A6}LLOWED IN DESTINATION 0 <.|K}N 2 FORMAT. t* 5) 1L!`) 0NΞ 0 L1) 1 L!BAD LOAD FILELOAD FROM WHAT FILE?) 0 ?}0#B 1L!WHAT FILE TO LOCK?) 0 0$B 1L!WHAT FILE TO UNLOCK?DUP DISK-SOURCE,DEST DRIVES?TYPE "Y" IF OK TO US@}E PROGRAM AREACAUTION: A "Y" INVALIDATES MEM.SAV.FE! +L1   `*  70 2 2A} 0.* 1 y0 0)INSERT BOTH DISKS, TYPE RETURN^, 1 y038逍 N, 1L! ,B}C, t*  Lx+, 0 ^, 1 y0 , ,0,0 ,L+ ,I0 ,Vǭ0C}Ξ, 0 }, 1 y0C,ШC, 0K'!" H H 'h h Lx+!EF 5L1L!D,I,HhD}` NOT ENOUGH ROOMINSERT SOURCE DISK,TYPE RETURNINSERT DESTINATION DISK,TYPE RETURNE}`  `8 rL1`-* 1P* 1 y0Y`hhL!NAME OF FILE TO MOVE?- 0 0|DL% <.F},^ 1 70 0 .@L# .BJ 1  DEHIB V L1 ,} 1 70,L.  G}JB|,#P#DE 1 HI BDEHHII 1 B 1 ,^ 1 70,0La- B V,#PH},^ 1 70 0L#L!-* 1P* 1 y0Yj383}mm ݭI}}`8}``|* ? ɛ,`|:-)| / 1L!`DESTINATION CANT BE DOJ}S.SYS0 0H{ 24Δ 28/L!/) 2 Π 2 0 ξK}hAΞB,0 J 1 BDEHI,HÝDE 1HIHIDELSAVE-GIVE L}FILE,START,END(,INIT,RUN)O S0 1`BDEPHI V` S0H 1 L!M}0 0 1L~0`PLEASE TYPE 1 LETTER,0`hhL! 70 1L0L<1 ,;ɛ7,"ɛ:ݦ1ݥN}A"D|ݤD|ȩ:|ȩ|ɛ,,(/+.ީ1 1,ɛ`轤{NAMEO} TOO LONG B VL!` L1I H1EΝDL1|mDiE` V0`8d/8 i:222 1 LP}!ERROR- 138ɛ+,' 20*.. өr2 1``2TOO MANY DIGITSINVALID HEXAQ}DECIMAL PARAMETER800 0 8 00`,0'D800 H,ɛh`2L1NEED D1 THRU D8uR} ECIMAL PARAMETER800 0 8 00`,0'D800 H,ɛh`2L1NEED D1 THRU D8u} }  Lll L"! L"! VL"! l Lq!! "!LD:*.*S:P:E:l"!q"H) T}h(`ӅԄՠ`ӅԄՠԨ`L)ӑ) `Ӣhh@,lHH!HwHHHHHӍl"H!HU}yHl !`GHFHJ*K+\`* `Ӧee褌%ƉƋL"!V}Ӡȱȱȱ㦌L"! ` ` `2a$%Ȏ!!xө~!!W} ` `@X ` ~  } Ӣ ʎDy` SLD1:AUTORUN.CTBՠԢӱԙӹX}`֝DEIHB V0Z3ڝDa۝E8օܥׅݥܝHݝI V04Ӡڑڑ0Y} BLVl `˩`80 ` .JJJJ)iFiFi1FicFi'ȐȦoFiUȐFiiZ}Fi#iFiGi Fii@F iiFiiciՊFigi'iՊօשBL`I))83[}Ԥԥդե֤֥פץؤإ٤LK6"ХLaLaLa\}E0:e٥eإeץe֥eՐ؅٥ׅإօץՅ֩L8٥إץ֥հ'I8م٘؅ؘׅט]}օ֘ՅLؤm\G0Q@Ն֩م؅2եمֆשم"ե؅֥م׆ةեׅ֥؅ץم؆لԘ)q^} ` ? 7i ? %!Ls`ԅՅօׅ؅م`ԍՍ֍_}׍؍ٍ`ԍՍ֍׍؍ٍ``, Խսֽ׽ؽ` ,`}`+ĕ ԅ)@ޥ)JJJe)e e Je0F ga} Lm8`@ԠՈքׄ؄`==W3>Tvb>2b'?h`06?2'A?%C4Vu?f'70P@U??CBH ? & ? QLb}m8`0 I@ԥ) oǢҠ 1  ؠ e Q ?P ¥Ii )ԅ +ĕc}Lm`@"wf?IWQpIG?9 Wa9cU? 0d? 9`?BXGB?7?()q?D>DIh8E?hyx? )D?@ (1V?d}wD3331??xS48`$)Ԧƅƅƅƅƅƅ mť)8@0$Յ)e)e Fe} 䰃 e Q F I`U9>`D'RFuCU?b9dYdg@W2@?tS)%)@0)%ԅf}P 1 ;  e°0 Q (Vŕ ԅԥ  ƕ m`8``0?i? Q g}ԍՍ֍׍؍ٍ * m N ǥ N 0 -åJeF g`L ) e٥eإeh}ץe֥eՊi؊؅٥ׅإօץՅֆե1ԥ'JffffJffffJffffJffffم`ԩ&&&&*&&&&*&i}&&&*&&&&*``ۄܱ T **m ȰҠݤܱEۅڦڱ= bܥeƥj}iեL@ ` **)]P` 00`` ( ((((((((8`W)ߥ & &ek} &߽aȅŊِ׼Ȅ⹕ȍqȅJJJJ&eXޥeYߥ䥈 9ȅFfЎᰈ Tȍ`Ȅ佘ȅ l}M 8*` Ȱi祍La L< ʘ0  L m} ȑ  L ʘ# ` |ʠ)ȱ Lt nʤ n |ʠ)ȱ)n} `ʠ)ȱ ʆ8ƍ0eސ`Ɗ8ް`)ȱJJJ```=o}`]``` H} h`Pi`)JJJeԅԘ)Peԅ`եԆ8@EB)JJJeԅԥ)Pep}ԅԘ)eԅԽeՅ՘)JJJ}˅ԥ}˅`)JJJeԅԥ)PeԅԹeԅԹeՅդЧ` 0@P`'Nu pX@(#q}d,X L `8` ¥E)))8@8e0 څۅ܅݅ޅ߄ԠF0y ޥy ݥy ܥy ۥyr} ڥy و0ǠF0y ݥy ܥy ۥy ڥy ٥y ؈0ǠF0y ܥy ۥy ڥy ٥y إys} ׈0ǠF0y ۥy ڥy ٥y إy ץy ֈ0ǠF0y ڥy ٥y إy ץy ֥y Ոt}0L`8`E)))8i@0 ڄԠ ( !   L* u} &О ( !   L* v} &О ( !   L* &О w}( !   L* &О ( !  x} L* &Оd ( !   L*y} &ОL6 e e e e e i z} } } } } } } ǭ m m m m m m  } }{} } } } } ǥՅօׅ؅مԅՅօׅ؅`hh !LHH`ؠ|}ɀhhHH֥ץ?ȱȱӰ8ְױօօ0LB Error -- à  in li}}ne #  ($8H h ) End of Program: os, e-run, oad ?@ !D L RL L Filen~}ame D: Jȱɛ):ȱɛ.ȩCȩTȩBȥ SLȹD:LKHJJJJ h) 0:iLp 8}` B 0`L<馒撥ԝޥ՝*ޥ֝Tޥם~ޥ؝ޥٝ` ƒޅԽ*ޅսTޅֽ~ޅ׽ޅؽޅ`ƒޅ*ޅTޅ~ޅ㽨ޅ}`撝ޘ*` ӥԝإ՝٥֝ڥםۥ؝ܥٝݥ`LT؅Խمսڅֽۅ׽܅ؽ݅`؅مڅۅ܅݅`}ȱȱȱȱȱ`ȱȱȱȱȱ`٩@ةڝ۝ܝ`թ@ԩօׅ؅`  }LQȱȱȱȱȱ`ȥȥȥȥȥ` wLH wh LQԄՠԅք` L } !ԝD՝E֝HeםI L`Laee 8厅叅eeL!)}L)`x,Ң⅌Ҙ襉ҥ `8$ L8$ ȍ` JKiLH h)}I ! SLJUVT`T L) ʥԤհ` L ` !L8, !L8 ` iLJ놈 LJ놈 ,LQ} HԝDEILꆓBJKԝD՝E CL8醈 B LJ놈& LM J릓N}LJL)NLM%L L j L `L=! Sp D o 8} LpL ,#,$,!pLL ,HBDEhHIL oL8馓HIBL !L8ɅĈeɐ ň}`֥ԅԅՅ,`$8n!?! D i\ iU?! iD iE=D iH ih8DHEI}HI C ,!L `L= JhhlԄե֥נȱհ  ȱօȱօ` L=Ԅ՘0)}ȱհ ȱe懰楆ƇƆ`L)L=醈ɛi懠,ɛ󥆦 Seօ` Lt Ԥբ}H e" hLQL=醈 *? , DEHI ` DLr 4 e"ɛ ,ЬLQ DL} 4eɛ SLtI L L L L L@ ; ` ; ` ; } ` ; m` L=@@ȅ@`I`)` ; USN ; FG ; ?: ; }201 ; &' ;  ;% ;L Lå ` : : :ڰ :ΰ :ǰ :оE%} jE `0``֪ (ϰ`(8`8` }ԤՅ` e"4 L= Ԅձ80  &ԅ L  eԪp`L) HJJJJ }h) 0:i`Ԅ 0 ["ȱ)ȥ,  ՅԄ֩`?Ԣ )ɠڭ ) ڕL} ^ L)8@L` )8@D:)8@-٩֔$ሄL` } ^Ű$` hŰ` &ư` Rİ` Vİ ` rð` ƐL=0L L ;&)ԥ)8@עJjH@M}C)JJJe)e F ¥P & F Q LL)HHHHHH Vİhhhhhh ðh}ԅ` L %ઘ%ᨊ` ઘᨊ` EઘEᨊ`<|'gԥ0L=`  *  &L_,}ڄ  eڅԥeۅհ"8څ֥ۅא8ܥݰ`۠Q%0ԅإՅ٥ަ0%Q% L}ե0Lڤ`օנ6&֐ eו`L)ԘբՅ Ԣ Յ֠&&֐eܥe}ېڈ $0!ee80å/8ܥ۰uڕ0eUiV`T}UV`8UV`eTi`8TȢ` !L8醊 æ f Ŋ :ƒޑȽ*ޑ}ȽTޑȽ~ޑȽޑȽޑȥԑȥՑȥ֑ȥבȥؑȥّȥȩhihHiH&HHH wh Lhh`hh`8}` L=醊 f ŊHȱȱȱȱȱ妊 w Qh LhhHHe`*ȱȱ}ȱȱȱjEE `EjI ` p D il ie o"p"q" i i i i i io"8}o" K膖  Lo"L=؝ٝڝ۝ܝ륄Lei  }`L=饏őŐ%Ƒ8 Ƒ` f,L= fhhHH`, :hihHi}H`` J :hihil  ¥Ӡ L  @Մ$ Q` Q` QLQH } h @Յ՘JJJJ y) 0:i`AVC2 5 - <) - < }L L e e`e`&&&&&&eee` &&eee&*` u}8)Ӱ% hhȱԅȱԅl ʰԤզ`hhheӨhiHH` u u88Ӱڪ :(jheӑhi Lh}פօۄڠ܄ݠFfؐeڅܥeۅ0&ۈ`L >ӆiHi0Hƒiֹ*i0Ѕ &ݤݥ &e܅ܘe݅}hhLlӅ؄م܄0օצӽАԥեܤ Q `ƒ*ޅޅ wإ}ٰ5֥װ+ eܥe*ݨ &eܪeeըeԐ`L L L ӆ 4Ԥզ L_ ӆ Ԥզ L}_ L LL=ӦԆՆֆ׆Lw Y٤ ۘ` Y  L~ Y ې Hh`פōČԅe}Յe &"8ӥب`ƒޅ*ޅ L=؅مƒ8*ޥ֥אeԥe`} w㰶H wֆ׆h8Lԩ!HHֆ׊HHʽ޼*ԆեHL!àLLeԐ `8԰L)} w㰶H wֆ׆h8Lԩ!HHֆ׊HHʽ޼*ԆեHL!àLLeԐ `8԰L))1-U. UP U 'RS Q) y) ) ) Р) }) )   * J2   w ) } w) L# w ) Lf# }L# w) L# LJ$ w) L# w) L# w k  } R  }* * * &* /* R 8* s T* c* }* * ̠* * +   w ) } w) L# w }) L$2+  t w) L%A+  t w) L%%  ͠   w J P+ }y+ + + Π+ +   w ) } w) L# w } ) L% L& w) L% L& E }  L(T !) Lr& + } } w') Lr& L& &,   Q, u,  w') L& } w-) sL& ,  ,  t ,   Ġ, w } + 3) Lq'   9) sL '͠,  t w t w֤ע >ؠ,  },  w֤   UV w   w - w֤ ?) LN( } U t w֤ E) L(8  K)  2L( > > /- L(    } > >  w U L( w @I@R@P@Q@!@'AU@@( }@@8'}} Ҡ Auto booter(By Bill Kendrick Atariserv 1992 Please select: } Run Colorizer 1.1 View/Print Documentation Quit to DOS  RebootK:             } Now loading: D:COLORIZ1.CTBD:COLORIZ1.CTB(}} Ҡ View/Printer(By Bill Kendrick Atariserv 199 }2 Please select:# QUICKREF.TXT, Quick Reference' COLORIZ1.DOC, Colorizer 1.1 Docs. Return to main men }uD:QUICKREF.DOCD:COLORIZ1.DOC(}} Ҡ View/Printer(By Bill Kendrick Atariserv 1992 Pleas }e select: Dump to printer Dump to screen Return to main menu*嬠ݠ* }塠堠#Press when printer is online, or to abort.& ( pauses, } aborts)塠 LoadingPrinting 䡠宠*D:CO }LORIZ1.DOC o"o" """""#"("-"2#7M#<f#A#F#K#d#i#n$sD$wG$J$J$d$q$~$$$ }$$%%%F%`% m%z%%%%"%'%+&,&1&6&;$&@r&Eu&J&&&&&&& 'q''' }'((N(h(( ((((X)])b))&,&1&6&;$&@r&Eu&J&&&&&&& 'q''' 6 Colorizer version 1.0 Questionnaire Form:What Atari 8-bit system(s) do you own and use?_____________}__________________________________________________________________Where did you find this program? (Please include phone }number if a BBS)_______________________________________________________________________________How do you rate this prog}ram?( ) Excellent ( ) Good ( ) Fair ( ) PoorHow do you rate the instructions?( ) Excellent ( ) Good ( ) Fair ( )} PoorName and address:________________________________________________________________________________________________}___________________________________________________________________________________________________________________________}__________________Comments:Please mail to: Bill Kendrick 59 Palm Lane Novato CA 94945Int}ernet: moon!cyberden!PHBILL@well.sf.ca.usThank you for responding!!endrick 59 Palm Lane Novato CA 94945IntKColorizer v.1.0 Quick Reference:By Bill Kendrick, Atariserv 1992("^" signafies to hold down [CONTROL])Draw Modes: [D}] Draw [L] Line [R] Ray [O] Outline [F] Fill [C] Circle [E]} Ellipse [DEL] ReplaceEditing: [U] Undo Capture [^U] Undo [^<][^<] Clear to Color} [^G] Global Replace [^F] Safe Fill ToggleDisplay: [A] APAC Dither Toggle [^A] APAC }Mode Toggl [^C] Color Indication Toggle [^L] Luminence Indication Toggle [up] Luminence Brighte}r (Color Portion) [dn] Luminence Darker (Color Portion)Menus: [?] Status Status Menu Commands}: [X] New X [Y] New Y [D] Draw Mode Select [C] Draw Color } [A] APAC Dither Toggle [^A] APAC Mode Toggle [L] Luminence (Color Portion) } [^C] Color Indication Toggle [^L] Luminence Indication Toggle [^R] Replace [}^F] Safe Fill Toggle [N] Save Name [T] Save Type Select [ESC] Exit to Imag}e Screen [^S] Save Save Menu Commands: [N] Save Name [T] Save Type Select} [^S] Save [D] Disk Directory [ESC] Exit to Image Screen [^D] DOS Inte}rface DOS Interface Menu Commands: [N] Save Name [D] Disk Directory [^D] } Delete File [R] Rename File [L] Lock File [U] Unlock File [ESC}] Exit to Image Screen [^R] Replace ScreenColors: [0] Color 0 No color/Black [1] C}olor 1 Gold [2] Color 2 Orange [3] Color 3 Red-Orange [4] Color 4 Re}d/Pink [5] Color 5 Violet [6] Color 6 Blue-Purple [7] Color 7 Blue [8}] Color 8 Light Blue [9] Color 9 Blue-Green [)]/[ESC] Color 10 Aqua [!] Col}or 11 Green-Blue ["] Color 12 Green [#] Color 13 Yellow-Green [$] Color 14 } Orange-Green [%] Color 15 Light OrangeQuiting: [^X][^X] Restart program [BREAK] Ex}it to TurboBASIC XL runtime promptr 15 Light OrangeQuiting: [^X][^X] Restart program [BREAK] Ex#Colorizer v.1.1 Boot instructions.This is a MyDOS enhanced (1050)density formatted disk. Upon bootingthe following happe}ns:DOS.SYS loads - installs MyDOS 4.56/4RUNTIME.AR0 loads - TurboBASIC XL runtime packageAUTORUN.CTB }loads - BootUp menuThe BootUp menu allows you to:Load Colorizer 1.1.Print or view the other two textfilesGo to the MyDO}S menuReboot the system.COLORIZ1.TBS has been included.It is the SAVE file, loadable inTurboBASIC XL.BOOTUP.TBS has b}een included.See above.Have fun! Bill Kendrick 7/22/1992moon!cyberden!}@well.sf.ca.usbove.Have fun! Bill Kendrick 7/22/1992moon!cyberden! wwwwwwwwwwwwwwwwwwwwwwwwwwwwwr#gqHwwww wwwww}wwwwwwwwwwwwwwwwwwwwwwwwq%gaXwwww wwwwwwwwwwwwwwwwwwwwwwwwwwwwwRvRhwwww} wwwwwwwwwwwwwwwwwwwwwwwwwwwwwB(Rhgwww wwwwwwwwwwwwwww}wwwwwwwwwwwwww28AxWwww wwwwwwwwwwwwwwwwwwwwwwwwwwwwwXAWwww}" wwwwwwwwwwwwwwwwwwwwwwwwwwwwwxv!Wwww" wwwwwwwwwwwwwwwwwwwwwwwww}wwwvg"Wwww wwwwwwwwwwwwwwwwwwwwwwwwwwwwu!gWwww} wwwwwwwwwwwwwwwwwwwwwwwwwwwwu#WWwww"wwwwwwwwwwwwwwwwwwwwwwwwwwwwt#W}Wwww "wwwwwwwwwwwwwwwwwwwwwwwwwwwwt#&Wwww }wwwwwwwwwwwwwwwwwwwwwxxwxwwt#E$Wwwwwwwwwwwwwwwwwwwwxwwwwwwwwu#U%wwww} wwwwwwwwwwwwwwwxwwwywyw!T&wwww" wwwwwwwwwy}wwwxd&wwww " wwwwwwwwwwzۘx&wwww} wwwwwwww̺Af&uwwww  wwwwwwyʪ}˫1xwwww  wwwwww̫ܻܻBhhwwww} wwwwwyܪ˽ܻ̻̫̽bhhww  wwwwx̼̫ܼ̜R}X:xww    wwwwwݻܼܼ̫ܬ˻ۼHkww   }wwwwۭͅܪͫ۫ͪHyxww! wwwɺ8lww}   x  www""""#ə8{ww!  wwxs}\"""""Iy(i8xww ) ww""""!"""xxzx2(hw}!wwu""!B"""""$xwxwwwwwwwu"!8Xww!! wws"""""""""x}wxwxwwxwwwwu"" (hxwww!!ww"""!"""""!gxwwwwwwwwwwwww!"&wwwww!} wwq"""!""""""Gwwwwwwwwwwwwwwq!wwwwww " wwq"""!"""!"""Gwwwwwwwwww}wwwwQwwwwww!! ")wwR"""""!"""'wwwwwwwwwwwwwwA!!wwwwww!! }!wwR"""""!"""'wwwwwwwwwwwwww!"!"wwwwww!!)wwR"""""!"""wwwwwwwwwwwwwwA"!"!w}wwwww!!)wwB"""""!"""wwwwwwwwwwwwww1!"!Wwwwww!!)!}wwB"""!"""""wwwwwwwwwwwwww"!""wwwwww!!wwB"""!"""""%wwwwwwwwwwwwwu"B!"!wwwwww!}!wwB"""!"""""%wwwwwwwwwwwwws$8!!wwwwww!!" wwB"""!""}"""%wwwwwwwwwwwwwq3!wwwwVw!!)!wwR"""!"""""wwwwwwwwwwwwwR8:4wwwuVw!)}!(wwR!"""!"""""wsgwwwwwwwwww3nZ4wwwtEw!)!!wwR!"""!"""""W~gww}wwwwwwww$wwwxw!!""wwR!"""!"""">wwwwwwwwwwt#$wwwwvw!!} "wwR!""""""""^wwwwwwwwwr'$wwwUTw!!  ""wwq!"""""""!wwwwwwwwwa8}4wwvDEw!!!  ""wwq!""!"""%wwwwwwwww2:4wwvUUw !}""wv0W"""!"""",wwwwwwwwu:N4wwwwwgq5xr""#2""wwwwwwwwa"<4wwvuxw} !" ""%"$wwwwwwws.$wwffTW"")}""!\gwwwws4Hb.$wwTEUW"")1'PggUgtH.$wwUDUV }" """)>gTUf7Zps"wvUUUV"^ }wwtp3"wvUUUU """wZ>^wwHTxāB!wuUfff" }""""Pz<>USxd'WSDBWfeEDD |~<uth } gDFeeUeUU"""""""~>~DDHcVDx4DDUV! }""""!p~ :^hvswGhEUUUV""!~:W>P~wX h}UUUV""^~WwWXpxGBXUUww" """"}~~pw0U(dxEwww2 """"~~u~:>d(tfxx(xWwUT}"""w~~x88hdweXDUU" ~x~ w}w vEt32DGexwwww"" ""~~Wu:D"HSGwg`hEWww}""" """~>~WTD2#gwwXvHhWww""")""w~^>~w}UUUVwwvxGWDD"""" ""~>>p>4DD3WwuDxrUU""!"})~>>0z>q #4S5CEvQwGdff!""" """w~z>>\5d5dDD8}4wBTDD!""""" " ""~z>>0> 1zvTDDDD8uD8DD""""" }~z>>P tDDDDD8heeE5Ue""""" """"!~z>~DUUUUHPDDBgCEVw}""""" """"!~z>~>DUUUUHDDEC'www""""" !""~z>}DDDDD&T%VwwwweTD""""""!"""""~z>UUUUUSt7wwuTDDDD}"""""""""^zwwwwwsF%TDDDDDDD"""""  """"""""">7}EUUUUQX$DDDDDDDD!"!"!  """!"!"~rFUVUVPX%UUUVUVUf} ""~2UeUeUePX1TeUeUV """""""""!"""!NQDDDDDD}D@H!344UUU """"""""""!"^r"!4DDDDD4@H!"!#5VeS4""""""""}!!""~3""""6fUUUUDD h2""5UeTC5"!!"!nREU1"""feVVeVeb#hB""6}VUETE"""""!""!"ns$DTDR""!DUUUUffB$hb""5fUeUV """""""""""""!! ""!"}^"C3CCDD""""4DDD4E"""5UUUfe """""""""!""""!^SEfTUTUETQ"""UfefUT(""$43S3E  }! """"^t5eVfUVUVVUT"""!UUUUeSH"!#DDUDU !"""!""!"""""!"""""!^#UUUDE!}DDFUfVU1"""5TDC31h"!%TEUEE !"""""""""""!"""!""!NR5UUVUUUTDC33332"""TDDU1""!C35E35 """"!""""!"}"""!""""!!""!"!5DSCEUTEDUUTUT43C""!3333#"4TUUDE""""""""""""!"!!!!"DUDTT4D43C3EEDUUUVA"#}""UEU&"4UVUUU"""""""""""""!!! "4SD4TTEDUTC333VUTUR"""!UER"2"$UUUUT""""""""""""""!"!!""$}"!""!C34D4CC4DDDUTUTEDTE""!$C"82"#ETDCE7ile%#oyote tmof7arner"ros)ncUUUUT""""""""""""""!"!!""_ffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff"5fB"!&}""FS#C2(a#C!3C32"#2!4UUU"5fB"""UB#SA7S"3!3C3C"421""5Uee"5fB"""UB#SA7S"3!3C3C"421""5Uee"5e2""#dA!'}%Cq%S#3!CD3C#DC1"!5Ufd"5e2""#dA%Cq%S#3!CD3C#DC1"!5Ufd"%e2"23SA5BC3#2CEDS$ED"#!4UeU"%e2"23SA5BC!(}3#2CEDS$ED"#!4UeU"%eA"##C154k52323DVTd4UT2#"4EVU"%eA"##C154k52323DVTd4UT2#"4EVU!5e1#3D155ktB333EV!)}EcCUS2#2!4DEd!5e1#3D155ktB333EVEcCUS2#2!4DEd"5e1""$C!FEiB33"EVUSDTS2"#2"4DEe"5e1""$C!FEiB33"EVUSDTS!*}2"#2"4DEe"%U1"4C1EEur"33EffcDUCB2#"#"!"$DUe"%U1"4C1EEur"33EffcDUCB2#"#"!"$DUe%U1"4E"TUwX4DUgwcTS3C!#""!+}#EUf%U1"4E"TUwX4DUgwcTS3C!#""#EUf%U1"442$TR6UD2$EVgxdTS3D!42"#EUV%U1"442$TR6UD2$EVgxdTS3D!42"!,}#EUV$U04%23UD#4#"#UVwxdTCCD1C22!3EUV$U04%23UD#4#"#UVwxdTCCD1C22!3EUV$e15$"%EE3"##eVwTTBBD2C"1!#DUU!-}$e15$"%EE3"##eVwTTBBD2C"1!#DUU%e155BBDbb!"3VgxTTCBD2C#"!#4UU%e155BBDbb!"3VgxTTCBD2C#"!#4UU$U!!.}"6EB#2Tc!C3VfxwTUDBD3D"!#4UU$U!"6EB#2Tc!C3VfxwTUDBD3D"!#4UU$U1$DcB32!!"BcFfxweUD2C4D234UU$U1$DcB3!/}2!!"BcFfxweUD2C4D234UU$U1#5TC"BA2UEgwdUE#CDD2!34VU$U1#5TC"BA2UEgwdUE#CDD2!34VU%e1DcB$Q3!0}#FUgweVE$CDD2"24EU%e1DcB$Q3#FUgweVE$CDD2"24EU!%U15d%C#35VwwdUT4CD53!3$6e!%U15d%C#35Vw!1}wdUT4CD53!3$6e!$e15v35#"3EfxwdVUDS55D!3"5f!$e15v35#"3EfxwdVUDS55D!3"5f"%e1$FD%! !$4DWxwuUVU!2}S5ED"!""!5f"%e1$FD%! !$4DWxwuUVUS5ED"!""!5f"$e1#5xsF#DEWwuUfUcUED""!""!4U"$e1#5xsF#DEWwuUfUcUED"!3}"!""!4U!$U1#EH&!$EUWvEvUbeET2"!""1$U!$U1#EH&!$EUWvEvUbeET2"!""1$U$e138F$1#5UfgweUeUbuETD31!4}""1$d$e138F$1#5UfgweUeUbuETD31""1$de1""5u2"""5VfgwfUUU2eEUDC0!"!Ue1""5u2"""5VfgwfUUU2eEUDC0!"!U!5}!e2"D12"5ffwxgeDE#VFTUD0""!D!e2"D12"5ffwxgeDE#VFTUD0""!Df12CY!2"#5fffxwwfeTS4EETE20"""df1!6}2CY!2"#5fffxwwfeTS4EETE20"""dU1#38h!3##35eUVVUWvuTCDEET3!"""DU1#38h!3##35eUVVUWvuTCDEET3!"""De1"4'F"!7}22#3Ec#D4CEffUUD5ED"""3e1"4'F"22#3Ec#D4CEffUUD5ED"""3e133&4"234VUD333#4gfvT4D3"# ""$e133&4"234V!8}UD333#4gfvT4D3"# ""$!e1#4%D"242FfefeCDD3Vxu3C#4 ""$!e1#4%D"242FfefeCDD3Vxu3C#4 ""$f13C6C""##VfUfeDD!9}DDVxu3C333 #"""$f13C6C""##VfUfeDDDDVxu3C333 #"""$!e1#37C!3$#gvUfTCDEUUh4C3"" 3!"!!e1#37C!3$#gvUfTCDEUUh!:}4C3"" 3!"!fAǤ""$4wwUUS3CDVfh42#"2!""fAǤ""$4wwUUS3CDVfh42#"2!"""$eB638E"3DvweD22EwxC"$1!;}22"""$eB638E"3DvweD22EwxC"$122""!eB3#38V#EwS!(Wu&wxu3Gsq2433!eB3#38V#EwS!(Wu&wxu3Gsq2!<}433!fB#$C9U"#FwT4&Fx5B5r#1%32"!fB#$C9U"#FwT4&Fx5B5r#1%32"!%fA#44YT"#Wwt&S6e5S7s $2%"22"!=}!%fA#44YT"#Wwt&S6e5S7s $2%"22"!fB"4TxD2"#Gw4d9fDsXc!$24"C2"!fB"4TxD2"#Gw4d9fDsXc!$24"C2"fB$!>}C6hCC!"GwTDFTgUVU23424#C2"fB$C6hCC!"GwTDFTgUVU23424#C2"!$fB4YVTC1"GxeVvxggU3C32S$D12!$fB4YVTC!?}1"GxeVvxggU3C32S$D12$fB4j7Tc1!7xgwwgveDC!C3c$E1"$fB4j7Tc1!7xgwwgveDC!C3c$E1"fBD7dt1"7x!@}xgwuUC!C3S#E2"fBD7dt1"7xxgwuUC!C3S#E2"fB#5Fuf2"6wgweD!32C"F22fB#5Fuf2"6w!A}gweD!32C"F22fS2HGwWC#FwWxvT!!233"E22fS2HGwWC#FwWxvT!!233"E22!gs%gvdc3Vwx!B}Vxwd!!12#"42#!gs%gvdc3VwxVxwd!!12#"42#fDDhvfwtEDVwxfxT!!!3#!4B#fDDhvfwtEDVwxfx!C}T!!!3#!4B#fS%gxDgFUVwwfxd!!!2#!#B#fS%gxDgFUVwwfxd!!!2#!#B#fS6fwSgVefgwfxd!!!2!D}#"#BfS6fwSgVefgwfxd!!!2#"#B"fSTETXwwfegwvxT !"#""2"fSTETXwwfegwvxT !"#""2!E}fWcFUE7xwffgwvxT  "#!2fWcFUE7xwffgwvxT  "#!2fv#eeUwvfgwwwd 0!"!"Bfv#!F}eeUwvfgwwwd 0!"!"Bg$Tvc%wvffwwwT 0!"!Bg$Tvc%wvffwwwT 0!"!B##gc&63!G}wwffgwwT 0!!"2##gc&63wwffgwwT 0!!"2#fS4XCgwvffgxgvT 0!!3#fS4XCgwvffg!H}xgvT 0!!3gcC3&EwgfgxgxvD 0!3!gcC3&EwgfgxgxvD 0!3!"gc$dDBUvwwgx!I}xuwwvT  "$0"gc$dDBUvwwgxxuwwvT  "$0"#gT&uU54tgfwgwewvT!"41"#gT&uU54tgfwgw!J}ewvT!"412$gd6XDD2WfgwwxXDvD!"4A2$gd6XDD2WfgwwxXDvD!"4AC4geFvTTBdWfwwxwVxv!K}D0#4BC4geFvTTBdWfwwxwVxvD0#4BTEgefveD1#DFfgwxgxvD!#4CTEgefveD1#DFfgwxgxvD!!L}#4CeUfvhfeE"5FgwwguC!!"3CeUfvhfeE"5FgwwguC!!"3CfvgwwWuU"EgwwxgvC!!"3S!M}fvgwwWuU"EgwwxgvC!!"3SwwwwvXt6##5ggwwxuC!! !CDwwwwvXt6##5ggwwxuC!! !CDwwwv!N}Wd6"!4gwwvwwuB"!CDwwwvWd6"!4gwwvwwuB"!CDxxwwwfuE3"ngwwxVwweC#!!3DxxwwwfuE3"!O}ngwwxVwweC#!!3DxwwwfuU!!|fwwwUwweB"! CDxwwwfuU!!|fwwwUwweB"! CDwwwveed!!uww!P}weThveA#!! 3Dwwwveed!!uwwweThveA#!! 3Dwwwwvgc11twwffeDGvUA#"!!3Dwwwwvgc11tww!Q}ffeDGvUA#"!!3DwwwwufT2!swwuUVdC6vT@4!" 3DwwwwufT2!swwuUVdC6vT@4!" 3DxwugSBgDDE!R}S#Gge04!"!#4xwugSBgDDES#Gge04!"!#4wwwvgSBۤWxdDDDDDVfT $!""1#3wwwvgSBۤWxdDDDDDVfT!S} $!""1#3wwwvhSB3ܹUwdUUUUTUfT 3!"!1#3wwwvhSB3ܹUwdUUUUTUfT 3!"!1#3wwwwgTT"ݺsgffffTVfT#!!T}""1#3wwwwgTT"ݺsgffffTVfT#!""1#3wwwfcC#|ݺ6xfwuDVfC#!"11"BwwwfcC#|ݺ6xfwuDVfC#!"11"B!U}wxwgd4|˖%gxufeUEfeB# "1A"Cwxwgd4|˖%gxufeUEfeB# "1A"Cxxwwwe4%z˘CXwuVUTFfeA#!!1A"Bxxw!V}wwe4%z˘CXwuVUTFfeA#!!1A"Bwxwxu3zڙqVwfUUTffe@!1A#Bwxwxu3zڙqVwfUUTffe@!1A#Bwwwhfe38!W}˪5wwvUUEfge !!A"1wwwhfe38˪5wwvUUEfge !!A"1wwvffffCI۩#gwxfgwwvT1A"1wwvffffCI۩!X}#gwxfgwwvT1A"1vffufffvS{ܩ36wvR!Q2vffufffvS{ܩ36wvR!Q2ffgffffDܪT$g!Y}e@"A1ffgffffDܪT$ge@"A1wvggvgvvUܼt3Vwe !A!wvggvgvvUܼt3Vw!Z}e !A!wwwgwwvX˹#6wU!"Q!wwwgwwvX˹#6wU!"Q!wwwwwxvɪTDWwvR![}!"A!wwwwwxvɪTDWwvR!"A!xwfxxxݹvTUVxwe0@0xwfxxxݹvTUVxwe0!\}@0ggݩwvTFhvT @#1ggݩwvTFhvT @#1gxifSTWwweB 1#0!]}gxifSTWwweB 1#0fxieV25gwwvT0!1#1fxieV25gwwvT0!1#1fwy!^}hvU2"4UTS2 11# fwyhvU2"4UTS2 11# wwUXfvd3"#33" A0# wwUX!_}fvd3"#33" A0# ffVWxedC2232"Q00ffVWxedC2232"Q00VVeUgxex!`}wuC#332#" Q0$0VVeUgxexwuC#332#" Q0$0UUUUgyfhywwuC#33132 "!R1#@UUUUgyfhywwuC!a}#33132 "!R1#@UUEUw˅gywffC#33"31!12!$@UUEUw˅gywffC#33"31!12!$@UTTVXܦWxxeVT332#3!b}!!!"#$@UTTVXܦWxxeVT332#3!!!"#$@!c}"""""""""#""""""""""""""""""""""""!"!"""""""!"""""""""""!""""""""!d}""!"!"""""""!"""""""""""!"""""""""""!""!""""""""""""""""""2!""""""""!""!""!""""""""""""""""""2!""""""""!"!e}!"""""!""""""""""""""!"""!""!"""!"""""!""""""""""""""!"""!""!"""!""!""""""!""""""""""""""""""""!!!!""!f}!""""""!""""""""""""""""""""!!!""!""""!""""""!"""""""""!"!"!"""""!""""!""""""!"""""""""!"!"!"""!"""!""!g}""""!"""""""""""!!"""""""!"""!""""""!"""""""""""!!"""""""!""""""!"""!""""""""""2"""""""!"""!!""""""!"""!!q}B%DOS SYSB*)DUP SYSBXSAUTORUN SYSBAUTORUN CTBBQFORM TXTBQUICKREFDOCBREADME TXTB>WILEY PI9B{%BETH PZMBBOOTUP TBSBCOLORIZ1CTBBBCOLORIZ1DOCaCOLORIZ1TBS>0COLORS AP2>nMODEL AP2>MODEL GR9""""""""""2"""""""!"""!"!""!!""""""""!""""""""""!"""""!""!!""""""""!""""""""""!"""""!"""""""""""""""""!r}""""""""!""""""""""!"""""""""""""""""""""""""!""""""""""""""""""!""""""""""""""""""""!"!!"""""""""!"""""""""""""!s}"""""""!"!!""!""""!""""""""!""""""""""""""""""""!""""!""""""""!"""""""""""""""""""!!""!""!"""""""!"""""""""!t}"!"""!"""""!!""!""!"""""""!""""""""""!"""!""""""!"""!""""""!!""!"!""""!"""""""""!"""!""""""!!""!"!""""!""!u}"""""!""""""""""""""!""!""""!"""""""""!""!""""""""""""""!""!""""!"""""""""!""!"""""""""""""""""""""""""""""!"!v}!"""""""""""""""""""""""""""""!""!""!"""!""""""!"!!"!"""!""""""""""!""!"""!""""""!"!!"!"""!""""""""""!""!!w}"""""""!""""!!"""""""""""""""""""!""!"""""""!""""!!"""""""""""""""""""""""!"""""""!!""!"""""""""!!"""""""!"!x}""""""!!""!"""""""""!!""#!"""!"""""""""!!"!""""""""""""""!#!"""!"""""""""!!"!""""""""""""""!!#""#"!"""""!y}"!!"!"""!"""""""""""""!#""#"!""""""!!"!"""!""""""""""""""""""""!"""""""""!"""!"""!""!""""!"""""""!"""""""""!z}!"""!"""!""!""""!!#""""""""""""""!""""!""""""""""""!#""""""""""""""!""""!""""""""""""""""!!"""""""!"!""!!{}""""""""""""""""""!!"""""""!"!""!"""""""""""""""""""!"""""""""!!!""""!""!""""!"""""""""!"""""""""!!!""""!""!|}!""""!"""""""""""""""""!""!"""""""!"""""""""""""""""""""!""!"""""""!""""""""""""""""""!!""!""!""""""""""""!}}"""!""""""""""!!""!""!"""""""""""""""!""""!""""""""""""""""!"""""""""!"""""""!""""""""""""""""!"""""""""!"""!~}""""""""""""""""""!"!""""!!""!""""!!""""""""""""""""""!"!""""!!""!""""!!""""""""""""""""""""""""!""""!""""""""!}""""""""""""""""""""!""""!""""""!"""""""""""!"""""""!""""""""!""!"""!"""""""""""!"""""""!""""""""!""!""""""""""!}""""""""""!!"""""""""""""""""""""""""""""!!""""""""""!"!2"!""""""!""""""!""""!"""""""!"!"!2"!""""""!!}""""""!""""!"""""""!""!"""""""""""""""!"""""!"!""""!"""""""""""""""!"""""!"!"""""""""""""""""""!}"""""!!"""""""!"!!""""""""""""""""""""""!!"""""""!"!!"""!"""""""""""!!"""!"""""""!"!""""!"""""""""""!!"""!}!"""""""!"!""""""""!"""""""""""!""""""""""""""""!"""""""""""!""""""""""""""!!""""""""!!""!}""""""""""""""!!""""""""!!""""""""""""""""!"!"!""!!"""""!"!!""""!"""!""""""!"!"!""!!"""""!"!!""""!"!}""!""2""""!"!"""!""!"""!!!!"!""""!""2""""!"!"""!""!"""!!!!"!""""!""!2""""!"""""""!!""""!"""!"""!}!2""""!"""""""!!""""!"""!"""!!"""""""!"!!!"!""!""""""""!!"""""""!"!!!"!""!"""""""""!"""!}"""""""""""!"""!""""""""!"""!""""""""""""""!"""!""""""""!"""!""!!!"""!""""!!""""""""""!""!!!!}"""!""""!!""""""""""""!"!"""""!"""""!!!!""!""""""""""""!"!"""""!"""""!!!!""!""""""""""""!!!"""!!!}!"""!"""""""""!""""!!!"""!!!"""!"""""""""!""""""!"!""""!""!"!"!"""""""""""""""!"!""""!""!}!"!"!""""""""""!"!"""""!!"""""""""""""""!"!"""""!!"""""""""""""""!""!!!"""!}"""""!"!!""!""!!!""""""""!"!!"""""!"""""!!"""!!""""""""""""!"""""!!"""!!}!"""""""""""""""!!"""!"""""""""""""!!"""!"""""""!"!""""!""!""""!!!"""""!}""""!"!""""!""!""""!!!""""""""""""""""""!"""!"!""""!""""""""""""""""""!"""!"!""""!"""""""""!}""""""""!""!!""!""!!"""""""""""""""""""!""!!""!""!!""""""""""""""""!""""!"!!""!"""!""""!""""""""""!}!""""!"!!""!"""!""""!""""""""""""!!"!"!""""""""""""""""""""!!"!"!"""""""""""""""!""!""!}"!"!"""""""""""!""!"""!"!""""""""""!"!""""""!"!"!!"""!!"""""""""!"!""""""!"!!}"!!"""!!""""""""!"""""""!""""!!!"""""""!"""""""!""""!!!""""""""!""""""""""!!"!"!}"!!""""""!"!""!""""""""""!!"!""!!""""""!"!"""""""""""!"""""""""""!"""""""""""""!"""""!}""""""!""""!!"!""""!"!""""""!"""""""!""!!"!""""!"!""""""!"""""""!"""!"""""!!!"""!!}"""""""""""!"""""!!!"""!""""""""""!"!"""""!!"!"!!""""!!""""!"!"""""!!"!"!!""""!!}!"""!!""!"!!!""""!!"!"!"!"!""""""""!!""!"!!!""""!!"!"!"!"!""""""""!"""!"!"!"!!!""!""""""""!}!"""!"!"!"!!!""!"""""""""""""!""""!!"""!""""""""""!""""!!"""!"""""""""!}!""""""""""""""!""""""""""""!""""""""""""""!""""""""""""!""""""""""!"""!""""!!}""""""""""!"""!!"""""""""!!"""""!!""""""""!"""""""""!!"""""!!""""""""!""!""""!"!!}"!!"""""""""""""""!""!""""!"!"!!"""""""""""""""""""!""""""""""!"""""""!""!"!""""!""""!}""""""!"""""""!""!"!"""!"!""""""""""""""""!""""""!"!""""""""""""""""!"""""""""!"!"""""""!}""!""""""""""""""""!"!"""""""""!"""""""""""!""""!"""!"""""""!!""""""""""""!""""!"""!"""""""!!""!}"""""""""!!!""""!""!""""!"!"""""""""!!!""""!""!""""!"!""""""""""!""!""""""!"""""!"!}"""!""!""!""""""!"""""!""""!"!""""""!!"""!"""""""""""""""!""""""!!"""!"""""""""""""""!}!""""!!"!"""!!"""!"""""!""""!""""!!"!"""!!"""!"""""!"""""""""!"!"!!""!"""!""""!!"""!}""!"!"!!""!"""!""""!!""!""""!!""!"!!""""!"""""""""!""""!!""!"!!""""!"""""""!!""""!}!""""!""""!"""""""""""""!!""""!""""!""""!"""""""""""""!""!"""""!""""""""""!""!"""!}""!""""""""""""!!"""""!"!"""""!"""!"!""!!"""""!"!"""""!"""!"!!!"!"""!!!"""""""!}!""!""""""""""""!"!!"!"""!!!"""""""!""!""""""""""""!""!"!!!"""!"!!""""""""""!!"""!"!"!!!"""!"!!"""!}"""""""!!"""!!!".!"!""""!!"!"""""""""""!!!".!"!""""!!"!"""""""""""!"""!!""!""""""!!"""""!}!"""""!"""""!!""!""""""!!"""""!"""""!"""!!!!!""""""""!""""""""""""""""!!!!!""""""""!""""""""""!}""""""!""""""!"""""!""""""""""!"""""""!""""""!"""""!""""""""""!""""""3"""!!"""""""""""""""""""""""""""!}3"""!!"""""""""""""""""""""""""""!!!""""""""""""""""""""!""""""!!!""""""""""""""""""""!""""""""""!!}"""!"!!"""""""""""""!""""""""""""!"""!"!!"""""""""""""!"""""""""""""!"!"""""""""""""""""""!"!"!""""""!!}"!"""""""""""""""""""!"!"!"""!!"!""!""!""""""""""""""!""!"""""!!"!""!""!""""""""""""""!""!""""!"!""""""! n=>w RUVIEWPRINFBUFDISPLAPRINLOASSSCSNTENPRINTDUMM9:=%}> @SAVE"D:BOOTUP.TBS":RUN;@,;%}@, C+f8@A+8A @7ARgCAh\/('}} Ҡ Auto booter\(%}(By Bill Kendrick Atariserv 1992( Please select:( Run Colorizer 1.1%%( View/Print%} Documentation#( Quit to DOS((  Reboot-g@fK:22 @P)g2 @I)!@R@%}P7"@IP<"@PPA"@Q.F"@R(?:B,KdOik (}@@%}--@@:(  E(   Q(  ^(   k(   n^@f!-@@A(Now%} loading: D:COLORIZ1.CTBK A^%D:COLORIZ1.CTBs%wQO]0((}} Ҡ View/Printer]((%}By Bill Kendrick Atariserv 1992( Please select:++(# QUICKREF.TXT, Quick Reference//(' %} COLORIZ1.DOC, Colorizer 1.1 Docs.!!( Return to main menu2 A0)g2 @I)!@Q@P$%}"@I$6.D:QUICKREF.DOC$"@P$6.D:COLORIZ1.DOC"@Q%#h A#h@f]0(%}(}} Ҡ View/Printer]((By Bill Kendrick Atariserv 1992( Please select: (%} Dump to printer( Dump to screen ( Return to main menu2 A0)g2 @I)!@Q@P%}"@IP""@PP'%+Q,O1 A%(}6 hP;mF:@,@!$-f@%}#T(*嬠ݠX)^(}j"@'m%@ AEC-f@#?(*塠%}堠C)J%OR-i@ 7(#Press when printer is online,R( or to abo%}rt.)"@'%AUA:-f@ :(& ( pauses, aborts) AE6.%}塠i-@@ "( Loading)h;-@@ H(PrintingL3aF:Ad,"@e)i) F:Ad%},@(A06. 䡠p 6.467B:,%g,.宠@-f@#p(*%}(-@ &B:,'h@#!(%)(%O4%4D:COLORIZ1.DOC*B:,!@46.7@%},B:,!@8-@8g6g7<,0  6-g  (7g<,(7%g,@( A QXҠ%}Р]By Bill Kendrick, 1992b______________________ D:BOOTUP.TBS.@( A QXҠ$[Uw^b LkK  LM w ꩮV L"V t L~OLz" w֤ע J wU L)}4# > > ꩵV L4# U t LDN w t L~OLz" LEMU!  wU LR$ w )} > > ꩷V L# !  w > > ꩺV L# !  w )} > > ꩽV L$ !  w > > V LR$ !  LDN)}U ! wL$U!  > w֤ע > t àV  w 4 > w 4  > ʠV )}  ; ؠV    V w  D Ҡ}   w J ()} XY J/ w: t wU  wU L%U 멕  (L%  wV  w@ 4 )} 텈P K ȩ_ O_ } wU L& w@ 텈 wԤՅ( ""U 멕  (L}& )} w@  w@ 4 텈P K wԤՅ w@ 텊( "" wU L&  셈 K)} wV LQ'U 멕  (LQ'  w  w@ 4 텈( K  w  w@ 4 V 텈()} K  wU L'-    w " ȩ O }U 멕  (L' 셈 w  w@)} 4 텊( "" U> L32  LU9 G %  UV $  UV w멖 + )}Щ'ЩТ4 5 6 = $ Ȣ UV + Ȣ UV w멖 LR UV $ )} UV w멖 + $ w 45  + w6    6 w W!  $ wV )} Ȣ UV  UV w멖   $ wV g Ȣ UV  UV w멖 4 w )} ; U L) L) V }L) LU-Ln(. wU L*% w$ Q. wV LI*$ wJ )}LI*K w$ Q. wU . wU g / wU L*% w$ Q/  w0 Q w1 QLD-. w)}U . wU g / LI+% w$ Q. wU s/ Q% Ȣ0 UV1  UV . wU )}LI+ w0 Q w1 Q> . wV L+= wLu+ L3$ Ȣ UV % ȩ_ O_ } 셈)} Tɢ% w$ Q. w$V . w*V / wU L&,% w$ Q w0 Q w1 Q/ LD-. w)}$V / L,$ Ȣ UV % Ȣ0 셈1 셊0 w  ` 1 w  ` 테 - )}UV $ . w*V / LA-$ Ȣ UV % Ȣ0 셈1 셊0 w  ` 테1 w )} ` - UV $ LR- LD- + Ȣ UV w멖   J2 t2 w V L)}-U. 2 w V L-. U/ 2 w V L.. U/ 2 w V L0)}.. U/ 2 w V LS.. 2 w V L.. U/ 2 w V L.)}" w " Q̠" w4  W!" w> Q L32 w V L.. U/ 2 w V L)}b/ w    w0V  QȠ w4  W!2 w V L/ w    )}wU  QȠ w4  W!2 w W 2 w W L 02 w % Q2 w )}W 2 w W LM0% 2 w W L0  w6V L0 2 w W)} 2 w W L02 w " % Q2 w W L:14 w 4 Q LUЅ4)} W!4 wU L:1 2 ̢2 w W Ls15 w 5 Q5 w> Q L32 w W )}L16 w 6 Q6 w> Q L32 w W L1 L52 w W L1 L32 w W )}L2 L342 w W L2  w Q L32 w )}W L3. 2 w W L?3 LE2 w "W La3 Lb42 w $W L3 )}L?2 w &W L3 LF @  BV @ 2L3> wP 4P 텈 @ L@ > $)} Ȣ UV L3 셈B 셊 "" B 셈 셊 "" UV $ $ Ȣ UV )}= wL4 L3UQ 멕 Q (L5UR y R (L5R UVQ S S wJ L4K ȢR UVQ)}  HV L5R Q L#5  UV $ $ Ȣ UV  wNV 텈 wԤՅ)} ""Щ̩ @ L95 (W FW lW W W  w  )} ڠW . w 4 >. w 4 8 > W    w !֤  UV  w )}    w !֤  UV  w  W 4 wU L6 W !  $ w !)}֤  UV $ w !  + w !֤  UV + w "  $ w 4+ !֤ )} UV $ w 4+ !  % w !֤  UV % w $ X 5 w)}U L7 X $ X 6 wU L08 X $ X " wU Lc8 X )} X = wU L8 #X 'X : w  4X w )} ?X F w 4 >F w 4  >  KX  WX 8  J w !)}֤  UV J w 8  K w !֤  UV K w  _X "/U!)} 멬   J2 t2 w ꩇX L#:5 w 5 Q! 2 w ꩉX LS:6 w 6 Q! )}2 w ꩋX L:" w " Q! 2 w ꩍX L:4 w 4 Q! 2 w ꩏X L:!)} . +. wV L:U.  2 w ꩑X Lp; X L?< wU < wV g )} Lp;< w  Q! 2 w ꩦX L; X L?< wU < wTV g L;< w)}  Q! 2 w ꩰX LF< X L?< wU < wZV g LF<< w  Q! 2)} w ꩺX L< X L?< wU < w`V g L<< w % Q! 2 w ȠX )}L ݠX L)}?< wU < w`V g L=< w J Q!  X L?< wU < w`V g )}LT>< w K Q!  wfV s ! wU L9! wL>/L5 LU wԤՅ wNV 텊)} ""'ЩЅ4 W!4 wU L> 2 ̢ UV $ U<  X < )}i X  X H t X H  X  L95 X Y )}: w  $Y w /Y F w 4 >F w 4  >  )}:Y EY  TY "/   J2 tU! 2 w cY L@! F +)}F wV L@F 2 w eY L=A gY LO?H w sY L=AH w t L)}DN w t! 2 w tY LB2 w vY LA xY LO?H w ꩔Y )}LAH w t LDN L~O! 2 w ꩕Y H w ꩗Y LBY t L~O!  wf*}V ! Lb@! wLLB/L? LU wԤՅ wNV 텊 ""'ЩЅ4 W!4 wU LB*} 2 ̢ UV $ w ꩞Y LC Y LBȠ  ˠ  *} w J Y   wlV sLBˠ     w J 2 wԤՅ*} wNV 텊 "" F wU LC  셈 HF wU LDT  BV T 2LDT *}w멖 4 QT w멖 4  (LD  w  w@ 4 텈( H  w  w@ 4 텈( H T *}F wV LEU 멖  (LE  w  w@ 4 텈( H  w  w@ 4 V 텈*}( H  LLB ̠Y  L? L95 Y Y    L? L95 Y *} Z J w )  L?< wU < w`V g LF< wJ Q 'Z J w ) 5*}Z K w )  L?< wU < w`V g LzF< wK Q @Z K w ) LU wԤ* } wNV 텊 ""'ЩЅ4 W!4 wU LF 2 ̢ UV $ L95 NZ* } uZ : w  Z w "/d   J2 tU!  * }2 w ꩽZ LG Z LO?H w ˠZ LGH w t LDN w t! 2 w ̠Z * } LbH ΠZ LO?H w Z LbHH w t LDN L~O  2 w Z H * }w Z LHZ t L~O  2 w Z L:I Z LO?H w Z*} L|IH w t LDN [     wlV L|I w 9 [ >  *}L32 w [ LI "[ LO?H w 5[ LIH w t LDNd w 02 w 6[ *} LPJ 8[ LO?H w A[ LPJH w t LDNd w 62 w B[ LJ D*}[ LO?H w K[ LJH w t LDNd w 3 wfV ! LYG! wLJ/LF L*}U wԤՅ wNV 텊 ""'ЩЅ4 W!4 wU LRK 2 ̢ UV $ *}x Uz Uz U U( U  U8' U2 U88 UV Uz: U LS L[LxH UL[ *} tu[  t[ ' tϠ[ V t >Ѡ[ V  >V wV Ӡ[ 8 tV wԤբB JF  *}'RSP \ \ ,\ R\ / \ \ ] *}] ?] _] ~] "/ z}  ]    wV LAN*} w > > t w ꩆ] w ꩋ] LM  w ꩐] w*} ꩕] LN  w ꩚] w ꩟] LAN  w֤ U *}LN > > ꩤ] LqO w֤ U LJO > > ꩧ]  > > *}ꩩ]  > > ꩫ]  > > ꩭ] LqO] *} t > w w t w t  ꩯ}   w J LP ]  ] w *}    > > U U 멬}   UV w  + wrV*} LPU  + wxV LPU LQ wfV LPLPLP LPL P LQ  *}U   (LQĠ] ԤՅXY   w@ 4 텊( ""  ] ɠ}   *}] w֤ע J w  Q wU }LQ  w ^  r J wU LQ w* }   Q + w    wV  Q w~V L}R > w 4 > w 4  >*!}  HV LzR  ^ Lz"L$ ^  Lz" ) J w ) wV )*"} wV } ) wV ) w멄V }  Q w ) w멊V ) w~V ) w$V *#} ) w0V ) w멐V ) w*V  Q wU }LS  w멖V LSU  *$}wU }LSy  wTV LSU j @ 񩜠V  Q /XY Jd  L01*%} 셊 ""U 01  w멢V 텊 "" 쩨V   2L:U w 텈Ϡ W!*&} w 텈 w k! w  텈O W! w  텈 w V k!*'}@ + 0 k!'^ ԤՅO ""̩ k J L"   + Ƞ *(} W!0 k!ԩ̠" W! ) @@@A8@A8@@AU@@*)}@@@$A%@(AfV@y@@@'@@@@@ @@@@AVAr**}ApD:*.*!/G/2/P/AType: 箮Searching...}}DLROFCAE09)!% ?U}~*+}}}%:00 Current Color:00 olor Status:$:00 Current Lumn.:00 umn. Status:$ Current T*,}otal:000 PAC Dither:#~~Drawing olor:00 Screen umn.:~~ rawing Mode:  PAC Mode:On~ffOn~ffOn~ffOn~ff Safe*-}ill:On~ff Loaded file: Save ame: Save ype: eplace:00with:00'[ESC]-exit, highlighted keys to change. ADLScree*.}n luminence?XNew X?YNew Y?C New color?TN Save name? Replace?With?}}}}}}}}}} */} Load file: Save ame: Save ype: ave fileisk Directory[ESC] to exit.TN Save name?DDir.mask? ([RET] for main)*0}DD:*.*Need filename!File exsists! Replace? (/)Cannot open for write!Error  while saving!!!}}*1} Replace? ( Replace ( With? (  With (&}} Ӡ&Load file:isk Dir e*2}lete enaem Save ame:nock [ESC] to exitN Save name?DDir.spec? ([RET] for main)DD:*.*Delete?Delete, ar*3}e you sure? Deleted.RRename? (old,new)UUnlock?LLock?(Graphics 9APAC-2 Pryzm APAC .GR9.AP2.PZM.PI9.P*4}IC.GRA.ILC.APC8(P` RT8,C0HD ŕAPACmode routine taken from APACView.BAS By*6} Clay HalliwellUEnter filename,(no more than 120 chars.)[RETURN], or "!"+filemask for directory.For forced file type, *7}add:"/G"for Graphics 9(.GR9) "/2"for APAC-2(.AP2/.GRA)"/P"for Pryzm(.PZM/.ILC)"/A"for APAC(.PI9/.AP*8}C)}}.PI9.APC.PZM.ILC.AP2.GRAD:D19:D:Directory of:}}(Press a key*9}... . Aborted... Not found!!!Oh \1`Lb0ͭ1ΠILbH@ ԍЩЩ ԍЭh*:}@o"o"t" z" "4###$R$$$M% q%#%%&(&*Q'-'2'3R(6n(7n(9&):)<)>)c)))**;}I**I+P++&,,A-D-R-U---.0.S....b// 0M000:1s11112*<}223 ?3 a3333 3 3 34( b4) 4* 4- 5. 51 #5 95 Q5 5 5 5 5 6 6 7 7 08 c8 8 8 9 *=}J9 9 9 #:! S:# :& :' :( ;+ p;- ;0 F<2 <5 <7 a=: =< =? T> T> |> > > ??8?L?O?{????*>}?G@]@ @ @=AYAAB8BLBBBBCVCCCDE&EDEEEEFzFFpFrFu0GTG*?}GGbHH:I|I|IIPJdJeJfJiRKmeK|hK}kK}K}K}K}7Lc}XLd}[Li}Lk}Ln}Lp}Lw}Mx}Mz}M}EM}M*@}}N}AN}DN}N}JO}qO}~O}O}O} P}=P}P}P}P}P}Q};Q}TQ}TQ}Q}Q}R}zR}}R~R~R~S~S~S~S~S*A}S*TvT.UJUhUUUUO} P}=P}P}P}P}P}Q};Q}TQ}TQ}Q}Q}R}zR}}R~R~R~S~S~S~S~S(" Colorizer version 1.0 Documentation: By Bill Kendrick, using a routine from Clay Halliw.C}ell's APACView.BAS System Requirments: Atari XL/XE with at least 48K of RAM (BASIC disabled) 1 Joy.D}stick (in port 1) Colorizer 1.0 ARChive: COLORIZ1.ARC contains the following files: COLORIZ1.CT.E}B - main program (in compiled TurboBASIC XL) COLORIZ1.DOC - this documentation file QUICKREF.DOC - a sm.F}all file containing a summary of all commands RUNTIME.OBJ - TurboBASIC XL's runtime package QFORM.G}.TXT - A questionaire form MODEL.GR9 - A Graphics 9 (grey shade) picture MODEL.AP2 - An APAC-2.H} (colorized) version of "MODEL.GR9" WILEY.PI9 - An APAC picture BETH.PZM - A Pryzm picture .I} COLORS.AP2 - An APAC-2 picture of all 256 colors. Loading Colorizer 1.0: Load "RUNTIME.OBJ" from D.J}OS. You will be prompted by the runtime package to re-run, load, or go to DOS. Type [L] for load. Enter "COLORIZ.K}1" and press [RETURN]. Colorizer 1.0 should load and you will hear a low tone for about a second. The title/load scree.L}n should appear. About APAC, APAC-2, Pryzm, and Interlaced APAC: APAC ("Any Point, Any Color") is a m.M}ode for Atari computers with the GTIA chip (in newer 800's all XL/XE systems) that allows all 256 colors to be disp.N}layed simultaneously anywhere on the screen in 80 x 96 resolution. APAC was first described by Thomas Tanida in ANALOG.O} Computing, Issue 60, May 1988 (pp. 64-71). The image is created by having alternation lines of color-only pixels (.P}graphics mode 11) and luminence-only pixels (graphics mode 9). APAC-2 was created by me as a simple adaptation o.Q}f an APAC routine found in Clay Halliwell's APACView.BAS. The ony difference between APAC and APAC-2 is how screen.R} memory is set up. Rather than having the memory displayed normally, meaning the image would need to have the pixe.S}ls of color and luminence data on alternating lines, which in turn means rewriting all of the drawing routines, the scre.T}en memory is set up as two halfs; th top half is of color data, and the bottom half is of luminence data. The Disp.U}lay List takes it from there by alternately pointing to the top and bottom halfs of the screen memory. Pryz.V}m, developed by Darryl Young, is a 256 color mode that has a resolution of 80 x 192. Rather than having alternating lin.W}es of color and luminence, this mode uses two screenfulls and flips between them every 1/60th second. Inter.X}laced APAC was developed by Jeff Potter (who made APACView, a GIF viewer, ILBM Read, an Amiga IFF ILBM file.Y} viewer, and other APAC-oriented programs) from an idea suggested to him by Charles Blaquiere. Like Pryzm, it has .Z}a resolution of 80 x 192 with 256 colors, but it doesn't use two screens alternately displayed, which can cause fli.[}cker. Instead, it uses two APAC screens, one with the even vertical lines and the other with the odd. Interlaced APAC .\}files are fully compatible wit Pryzm files. File Formats: Graphics 9 files are stored as 7680 bytes o.]}f luminence data. APAC-2 files are stored as 3840 bytes of color data and 3840 bytes of luminence data. .^}Pryzm files are stored as 7680 bytes of color data and 7680 bytes of luminece data. APAC files are stored as 768._}0 bytes of alternating lines (40 byte segmenst) of color and luminence data. About Colorizer: Coloriz.`}er is a program I developed for adding color to 16 grey shade (Graphics mode 9) screens. This idea came to me after I g.a}ot my ComputerEyes video digitizer. I had worked with different ways of displaying APAC screens with TurboBASIC XL.b} and finally came up with APACSet2.Lst which is an APAC-2 mode installer. I thought that the grey shade images I h.c}ad created would look good in color, and since APAC-2's screen memory is set up in such a simple way, I could easily .d} add color to it. What Files Can Be Used: Colorizer 1.0 can handle loading four different file formats. .e}They are: Graphics 9 (80 x 192 x 16 grey shade) APAC-2 (80 x 96 x 256 colors) Pry.f}zm (80 x 192 x 256 colors) APAC (80 x 96 x 256 colors) All files are loaded and displayed in .g}APAC-2 mode. APAC-2 files load the quickest because no conversion is needed. (Every other line of Graphics 9 and .h}Pryzm files are skipped and every two lines of APAC files must be loaded to two areas of the screen memory instead of in.i} sequence.) Colorizer can save in any one of the above formats except Graphics 9. When it creates a Pryzm .j}file, it just saves every line of data twice. Using Colorizer: Once you have loaded Colorizer, you wi.k}ll be prompted to enter a filename or press [RETURN] alone or "!" and a filespec for a disk directory. [RETURN] al.l}one will display all files in the default drive/directory ("D:"). If you enter "!" and a filemask, it will search .m}for that filemask. (If no drive is given, "D:" will be assumed.) When a filename is given (if no drive is given.n}, "D:" is assumed), it's type ("Graphics 9," "APAC-2," "Pryzm," and "APAC".) is displayed near the bottom of the sc.o}reen. A file's type is determined by extender. The legal extenders are: .GR9 or .PIC: Graphics 9.p} .AP2 or .GRA: APAC-2 .PZM or .ILC: Pryzm .PI9 or .APC: APAC any other or no extender will set.q} the type to Graphics 9. If a file you are loading doesn't have one of the above legal extenders or it's extende.r}r is for the wrong type, the file type can be forced by appending these "/" parameters to the end of the filename: .s} "/G": Graphics 9 "/2": APAC-2 "/P": Pryzm "/A": APAC Once you have entered a filename and .t}pressed [RETURN], the computer will look for the file. If it cannot be found, the extender will be changed (or an .u}extender will be added if there was none) to a legal one and the file will be looked for again. Pressing [ESC] during a.v} search will abort it and return you to the filename prompt. The computer searches for the extenders in this order.w}: ".GR9," ".AP2," ".PZM," ".PI9," ".PIC," ".GRA," ".ILC," and ".APC,". If no file is found, you will be .x}informed. Press a key to return to the filename prompt. If the file is found, it will be loaded onto the screen.y} and you will be in Image Mode. Editing Commands in Image Mode: Use a joystick to move the cursor (bl.z}inking dot) around the screen. If it goes off of the edges, it will wrap around to the opposite side. You can selec.{}t one of 8 drawing modes with the keyboard: (note: a "^" denotes holding [CONTROL]) [D] Draw pressing [FIRE.|}] changes the color of the position the cursor is at with the drawing color (default mode) [L] Line [FIRE].}} once marks the beginning point of a line; [FIRE] again draws a line from the beginning point to the cursor [R] .~}Ray [FIRE] marks the beginning point of a line; [FIRE] thereafter draws lines from the beginning point to the curs.}or. Pressing [R] again lets you select a new beginning point. [O] Outline [FIRE] marks the beginning point of.} a line; [FIRE] thereafter draws lines from the beginning point to the cursor and marks a new beginning point at th.}e cursor. Pressing [O] again lets you select a new beginning point. [F] Fill [FIRE] fills a colorless area.} (within border lines of color and/or the screen borders) with the drawing color. NOTE: If the drawing color is 0 .}(black/no color) then all colors not bordered by 0 will be erased! If "Safe Fill" is on, then the screen will be c.}aptured. (see Undo and Safe Fill) [C] Circle [FIRE] marks a centerpoint. [FIRE] thereafter draws circles (ra.}dius determined by cursor position relative to centerpoint) around the centerpoint. [C] again allows new center marking.}. [E] Ellipse [FIRE] marks a centerpoint. [FIRE] thereafter draws ellipses (radii determined by cursor positi.}on relative to centerpoint) around the centerpoint. [E] again to mark new center. [DEL] Replace [F.}IRE] changes the color of the current color the cursor is on with a new color (not the draw color) IF the current c.}olor is the one to be replaced. (see Replace) Other graphics editing commands from the Image Screen are: .} [^G] Global Replace This changes all pixels of the color to be replaced with the new color (not the draw color). Pr.}essing [ESC] aborts. If "Safe Fill" is on, the screen will be captured. (see Undo, Safe Fill, and Replace) .}[CLR] Clear to Color Pressing [CLR] ([CONTROL]+[<]) twice will erase the color portion of the image and replace it wit.}h the draw color. If "Safe Fill" is on, the screen will be captured. (see Undo, Safe Fill) [U] Undo Captur.}e This captures the screen image into a buffer. If "Safe Fill" is on, this is done automatically any time a Fill, .} Global Replace or Clear to Color is done. (see Safe Fill) [^U] Undo This redraws the undo capture buffer (cre.}ated with an Undo Capture command or (if "Safe Fill" is on) with Fill, Global Replace or Clear to Color) (see Undo .}Capture and Safe Fill) [^F] Safe Fill This toggles "Safe Fill" mode. If it is on, any time a Fill, Globa.}l Replace, or Clear to Color is done, the screen will first be Undo Captured. (see Undo Capture, Undo, Fill, Global .} Replace and Clear to Color) Default: on Color Selection: All 16 colors are avaliable and can be selected.} with the number keys: [0]-[9] = colors 0-9 [)]-[%] = colors 10-15 ([SHIFT]+[0]-[SHIFT]+[5]) ([ESC] is .}also color 10) The colors are: 0 - black (no color) 8 - light blue 1 - gold 9 - bl.}ue-green 2 - orange 10 - aqua 3 - red-orange 11 - green-blue 4 - red/pink 12 .}- green 5 - violet 13 - yellow-green 6 - blue-purple 14 - orange-green 7 - blue .} 15 - light orange Display Commands in Image Mode: The screen display can be altered in many ways to .}help make editing easier: (note: whenever a toggle is done, a high pitched bell signals that the selection is off a.}nd a lower pitched bell signals it is on) [A] APAC Dither This toggles the pseudo-dithering effect (the sc.}reen vibration which mixes the alternating color/luminence lines). Default: on [^A] APAC Mode This switc.}hes from the APAC mode (256 colors) image screen to the split screen (16 grey shades: top half is color data, botto.}m half is luminence data). In this mode you have two cursors. Default: on (APAC mode) [up] Brighter Pressing [.}CONTROL]+[-] (up-arrow) increases the intensity of the color portion of an image. If you go above the limit.} (7), it will start again at 0. (see Darker) Default: 1 [dn] Darker Pressing [CONTROL]+[=] (down-arrow) decr.}eases the intensity of the color portion of an image. If you go below the limit (0), it will start again at 7. (se.}e Brighter) Default: 1 Displayed on the left side of the screen is an Indicator Bar (usually static) which is a.}pproximately the same color as the pixel the cursor is on. You can change what information is provided by it with .}the following: [^C] Color Indication Toggle When on, the Indicator Bar is the same color as the color of th.}e pixel the cursor is on. ("Current Color" on the Status Screen) When it is off, the color is black/grey (0). .} [^L] Luminence Indication Toggle When on, the Indicator Bar is nearly the same luminence as the luminence of the pi.}xel th cursor is on. ("Current Lumn." on the Status Screen) When it is off, the luminence of the bar is 8. .} Status Menu: When you press [?] from the Image Screen, the Status Screen Appears. Pressing [ESC] returns to.} the Image Screen. It informs you of: The X and Y coordinates of the cursor (0-79 and 0-94), what Draw Mode y.}ou are in, what Drawing Color you are using, if APAC Dithering is on, if APAC Mode is o.}n, what the Luminence of the color portion of the screen is, if the Indicator Bar shows Color, if the Indicat.}or Bar shows Luminence, what the color to Replace is, what the Replace color will be replaced with, if Sa.}fe Fill is on, what the Loaded File was, what the Save Name is, what the Save Type .}is, what the Current Color is (under the cursor), what the Current Luminence is (under the cursor), and what t.}he Current Color Total (Current Color*16+Current Luminence) is. Some of this can be changed (the highlighted letter.}s on the screen tell you what keys to press): [X] X-coord. Prompts you to enter a value for the X-coordinate. .} (0-79) [Y] Y-coord. Prompts you to enter a value for the Y-coordinate. (0-94) [D] Draw Mode Select .} Changes the Draw Mode. (goes through the list) [C] Draw Color Prompts you to enter a value for the.} Draw Color. (0-15) [A] APAC Dither Toggle Turns APAC Dithering on and off. [^A] APAC Mode Toggle T.}oggles between APAC Mode and Split Mode. [L] Luminence (Color Portion) Prompts you to enter a value for scr.}een Luminence (intensity) of the Color Portion of the screen. [^C] Color Indication Toggle Toggles whether colo.}r is indicated on the Indicator Bar. [^L] Luminence Indication Toggle Toggles whether luminence is.} indicated on the Indicator Bar. [^R] Replace Prompts you for Replace color and the color to replace it W.}ith. [^F] Safe Fill Toggle Toggles "Safe Fill" mode. [N] Save Name Prompts you for a Save fileN.}ame. [T] Save Type Select Changes the Save Type. (goes through the list) Save Menu: When .}you press [^S], the Save Menu appears. Pressing [ESC] exits back to the Image Screen. It displays the Load and Save Na.}mes. From it, you can: [N] Save Name Lets you change the Save fileName. [T] Save Type Changes t.}he Save Type. (goes through the list) [^S] Save Saves the file with Save Name as it's filename ("D:" ass.}umed if no drive is given) in the format specified by Save Type. [D] Disk Directory Prompts for a director.}y filemask and displays the dir. of it. ("D:" assumed if no drive given) [RET] alone displays default dir. ("D:*.*.}"). DOS Interface Menu: Pressing [^D] accesses the DOS Interface Menu. ([ESC] returns to Image Screen.}.) From it you can: (note: in all cases, "D:" assumed if no drive is given) [N] Save Name Change the Save na.}me. [D] Disk Dir. Prompts for a disk dir. filemask. [RET] alone for default dir. ("D:*.*") [^D] Dele.}te File Prompts for a filespec, the if you're sure. Press [Y] to delete, anything else to abort. [R] Rename F.}ile Prompts for an "old,new" filemask. (do NOT specify drive/sub-directory as part of the new name!) Renames the .}"old" file with the "new" name. [L] Lock File Prompts for a filespec. Locks that file. (write/delete protec.}ts it) [U] Unlock File Prompts for a filespec. Unlocks that file. Replace Screen: Pressing [^R].} will bring up the Replace Screen. It will prompt you for a "Replace" color and tell you the current one. Enter a colo.}r (0-15) or [RET] to keep the current. Then it will prompt for a "With" color and tell you the current one (the co.}lor to change the "Replace" color with). Again, enter a color or [RET] to keep the current. You will be automatic.}ally returned to the Image Screen. Quiting Colorizer: Pressing [^X] twice will restart the program (erasin.}g the previous image and Undo buffer). Pressing [BREAK] will bring up the TurboBASIC XL runtime package pro.}mpt. [R] will restart the program, [L] will prompt you for a compiled TurboBASIC XL program to load's filename, [D] ret.}urns you to DOS. Future Releases: Future releases of Colorizer will contain these featur.}es and more: Support for other input devices (Koala pad, lightpen, etc.) Split screen mode will be colors on the to.}p instead of just luminence representations of the colors. Faster file type conversion. I hope you enjoy.} Colorizer!! Bill Kendrick I hope you enjoy,l+,*0C0APADSLUSCREENOOFSETUAFSVBUFTITLINPUDIADDTYPENTYPTYPEEXTPRESCLEAEXOAPAPMOCC2}OPPMMOVCCCDOICMDMDNXYICMDMODPMCOPMLUSTATUMDUNDOLDASVFUNDPBELUNDUNDUNDCAUNDOCAUNDORSAVTYPASK2}SVLASKRPLWITRPLCPRMPSAVRPLGRGLOBALRPLYXCCDOUND_ dBB@A8AsA6e2}f _Z x xz z l\'^_ _^l((2}A( @@@ Wa` !"@#$%&2}'88(c)*+,A-B./01234562}7G8889:%z;/O<=>?3F@ABBwsCDrFEF2}F@GHxIOJKLM PN\UOXGPFQRSTUV2}V%SAVE"D:COLORIZ1.TBS":RUNB2Hf1P1렷 :-f@(2}P 4,6.D:*.*0P: @ @ 6-B:,!g7gF2}:Ad, AUPc @UO "f6-"@"6-3g*i*"f6-6-g#6-)6-2}3 AAg*i*6-6-+g,#),//5"i;6-A6- 6-hR"@PA$,(42},f@F/@y@L_R6-A+"@)"@,*"f%6-+6-16-76-gA A;"@*2},3bO:&,%O:&,;1;"@*,3bO:&,O:&,;1 A < =T:f,2}Q4O ,%@)&6.>:,.4D46-f 4L6-g6-f 4R6-h6-f 4O6-i6-2}f 4F6-@ 4C6-@6-f* 4A6-( A$&6-*P 4E6-@6-f2}7 4)6-%h&+@$+"@,,7A$1 4#6-&h%+@$+"f,,1A$10*/96-2}A:,4)4)6-@ 4)"@$%"1!*/%"6-@:,&@"F 46-(P"B2}2V("f:+@ %@2FAf 46-(6-P 4 6-(6-P 4?P 4U2}P 4Pg 4})"A%P#),ff5/@yfC-f@[9%$@@@@_ g12} 46-(6-P 4~6-@ 4P  4P  4P 4P3Q ?O-2}@f6g82f$@P%@P@< ?Q ,O 6-h,P)9A8@,Q O9A8@12} Q( O ,P) 7-f@-f@y'1-"17,* F:Ad,"@(A&-   2} A& . )1  1Q O , k9%AfVC:,A$(B2Hf4Af8+fJ8A @\2}A@dhARgkQ O P x%(}}O(%:00 Current Color:00 olor Status:x($2}:00 Current Lumn.:00 umn. Status: o,($ Current Total:000 PAC Dither:X(#~~Drawing olor:00 Screen umn.:'h2}o(~~ rawing Mode: h&(7$@%g<$@%@,8(  PAC Mode:L-@&B:=:,,hP(d-@&B:=:,,ih(2} +-@@(On#"f+(~ff e-@!&B:=:,,h(/-@!&B:=:,,i3(W-@"&B:=:$@%,,2}@e($@% C-@!&B:=:,,@!(--@6h5(On;"fC(~ff %-@6i(On"f%(~ff2} +-@6@(On#"f+(~ff 5-@ @ '( Safeill:On-"f5(~ff $-f@ ( Loaded fil2}e:$( ]-f@( Save ame:"(.-f@]( Save ype: 7$@&@ <$@, C-@'@%( 2}eplace:007-@1@C(with:00 ?-@8&B:=:,,@!(;-@8&B:=:,,@?( ;-f@;('[2}ESC]-exit, highlighted keys to change. GAY@46-f% A5))26.>:,:4A6-(G6-g  4 6-2}(6-g!  4A6-(6-g#  46-(6-g& + 4D6-g6-%g%!@+6-f' -f@( G 4L2}"(Screen luminence?&P6f*@A6-P:,$hG6-g+ : 4X(New X?P+f*@y46-P:,:6-g- : 2}4Y(New Y?P+f*@46-P:,:6-g0 > 4C( New color?P/f*@86-P:,>6-g2 + 4T2}6-%g6-g%!@+6-h5 < 4N( Save name?P&0,6.0P66.<6-g7  46-(6-g: < 42}( Replace?P-f*@66-P:,<6-g< =-f@(With?P.f*@76-P:,=6-g? A 2}@'*"fA1 AYf A0 bP 9C:,%AfVA$2B2H@9>B2VD"fV+@ 3}%@2bAf 1 Q>O 6-fA@+ARf5 A6>}})ARg(}})3}A@$Q?O6. A@,ARf6 A6?}})ARg(}})A@$3}Q O PW$(}} 4( Load file:8(D-f@S( Save ame:W(k-f@=( 3}Save ype:7$@&@ <$@,I-f@X( ave filek(isk Directory(-@@(([ESC] to exi3}t.5AY@4<" AE&)/6.>:,56-f + 4T6-g6-%g%!@+6-h H 4N-f@'(3} Save name?+P2086.B2VD"fV+@ %@2bAf 1Qp O Pri.(&}} Ӡ3}:-f@e(&Load file:isk Dir elete enaemi(u8-f@4( Save ame:nock [ESC] to exit8(A3}AY@4<" Ae&)/6.>:,56-fA-f@< 4N( Save name?P&0,6.0P66.<6-gW 3}4D+(Dir.spec? ([RET] for main)/P60<6.@PDPP-f@W(34D*46.D:*.* P,-f@3}3(_ 4(Delete?P#0)6.-P9-f@#T(Delete, are you sure?X)_(B"@ Aa3}L)-f@#8( Deleted.>6-hBPAE 4R"(Rename? (old,new)&P-036.7PA AeEK; 3}4U(Unlock?P#0)6.-P7 Ae;J9 4L(Lock?P!0'6.+P5 Ae9Id="@'3})eAYf A`fbP 9C:,%AfVA$2B2H@9>B2VD"fV+@ %@2bA3}fi 1mQ|}|O|;A ,;A",;A",;A$,;@@,;@2,;@V,;g,;@V3},;A8@,;A",}P P;A ,}Y26.(Graphics 9APAC-2 Pryzm APAC Y6. .GR9.AP2.PZM.PI9.P3}IC.GRA.ILC.APC}dB6.8(P` RT8,C0HD ŕAPACmod3}e routine taken from APACView.BAS By Clay Halliwellk}iAYfi(UEnter filename,(no more than 120 chars.)[RETU3}RN], or "!"+filemask for directory.n}g#(For forced file type, add:B("/G"for Graphics 9(.GR9)g( "/2"for APAC-3}2(.AP2/.GRA)p}e'("/P"for Pryzm(.PZM/.ILC)J("/A"for APAC(.PI9/.APC)S(eAY@4w}Qx}3}Oz}U B!"ARf+A@4}}@ARgRA@$UQ}FO 6-g!@&6.7&i<,3 }:4.PI9)4.APCF6-@}4.PZM)4.ILC6-i}4.AP2)4.GRA6-h} A Q}&OB:,!h&7g6-%+!@* @,&+!@* @,6-%+"@)"@ )"@3*},&+"@)"@)"@,~  f6-@~!@6-f~  f6-@y~!@y6-f~3+}QcO(6-+F:A,&@@,$AV2+@>AYfM6-U:@,c2fA@hA9U:A`,i6-3,}fA9U:A`,%A%Ar@]-iAp@'%A38%%g%C%%i@y]8%%@%3-}%A8@!6-%@@ !8A`jj9C:Oh \1`Lb0ͭ1ΠILbH@ ԍЩЩ ԍЭ3.}h@,A6@y7Af6-?:A6,(2ffff.6-g46-h7QJO+@CA)8A`;BB3/}AGAJQ=O+@AQ= 렶D:COLORIZ1.TBS%;BB0q71}72}73}""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""74}"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""75}"""""""""""""""3333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333376}3333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333377}333333333333333333333333333333333333333333333DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD78}DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD79}DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU7:}UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU7;}UUUUUUUUUUUUUUUUUUUUUUUUUffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff7<}fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff7=}fffffffffffffffffffffffffffffffffffffffffffffffffffffffwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww7>}wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww7?}wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww7@}7A}7B}7C}7D}7E}7F}7G}7H}7I}7J}7K}7L}7M}7N}""#334DDUUVffgww7O}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7P}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww"7Q}"#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww""#3347R}DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww""#334DDUUV7S}ffgww""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7T}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7U}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7V}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7W}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7X}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww"7Y}"#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww""#3347Z}DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww""#334DDUUV7[}ffgww""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7\}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7]}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7^}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7_}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7`}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww"7a}"#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww""#3347b}DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww""#334DDUUV7c}ffgww""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7d}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7e}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7f}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7g}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7h}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww"7i}"#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww""#3347j}DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww""#334DDUUV7k}ffgww""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7l}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww7m}""#334DDUUVffgww""#334DDUUVffgww""#334DDUUVffgww47ffffffffffffffffc33333331333ffffffffffffffffc33333331333fffffffffffffffffc3333333333fffff;o}ffffffffffffc3333333333fffffffffffffffffc3333333333ffffffffffffffffc3333133ffffff;p}ffffffffffc3313ffffffffffffffffc333ffffffffffffffffc33ffffffaff;q}fffffffff33ffffffaffffffffff33ffffffaffffffffffc1ffffffaffffff;r}ffffc1fffffffffffffffffcfffffffffffffffffcfffffffffffffffffc;s}ffffffffffffffffcfffffffafffffffffcfffffffafffffffffa;t}1fffffffafffffffffa3fffffffffffffffffa3ffffffffffffffffa;u}31ffffffffffffffffa33ffffffffffffffffa331ffffffffaffffffffa331;v}ffffffffaffffffffa333ffffffffafffffffc3331fffffffffffffffff3333fffff;w}ffffffffffff3333ffffffffffffffffl3333fffffffffafffffffl3333fffffffffa;x}ffffffl3333fffffffffaffffffl3333fffffffffafffffff3333ffffffffff;y}fffffff3333ffffffffffffffff3333ffffffffffffffffDA3333ffffffffffaf;z}fffffDDD3333ffffffffffafffffDDDA3333ffffffffffafffffDD33333ffffffffffffffff;{}333333fffffffffffffff1333333fffffffffffffff1333333fffffffffffffff1;|}3333333fffffffffffaffff13333333fffffffffffafff13333333fffffffffffafff133;}}33333fffffffffffffff1333333fffffffffffffc333333ffffffffffffac333333;~}ffffffffffffa333333ffffffffffffa333333fffffffffffff333333fffff;}ffffffff333333fffffffffffff333333fffffffffffffa3133ffffffffff;}fffa33ffffffffffffff3ffffffffffffffffffffffffffff;}ffffffffffffffffffffffffffffaffffffffffffffa;}ffffffffffffffaffffffffffffffafffffffffffffff;}fffffffffffffffffffffffffffffffffffffffffffff;}fffffffffffffffafffffffffffffffafffffffffffffffa;}fffffffffffffffffffffffffffffkffffffffffffff;}fffffffffffffffffffffffffffkffffffffffffffffff;}ffffffffffffffffffffffffffffffffffffffffffff;}ffkffffffffffffkffffffffffffkffffffffffffk;}fffffffffffffkffffffffffffffkffffffffffffffk;}fffffffffffffffkffffffffffffffffffffffffffffffff;}fffffffffffffffffffffffffffffffffffffffffffffffffff;}fffffffffffffffffffffff""!uUTEz"""!$gxtUDWC4R;}322#!"̆UDUj21#!"""yxyucVfd$E"2""!!ܧUEU[""!!yedVfe34C"2""!̧gVTG2"22!!!3gvegfvS"4B2"";}!!|eeEXb2!1"!"!DgvuTGu3$E#"! !!"LuUUX""!!!Hxu3VfS24U2"".vUUW!"2GhwuC&wT2#DB"!!;}#eeV!#"!#"3XwveUShv3"5T3!!*چUUVv"!"Fh̘wffF5xc34U4!!'˖fUU1!""#5hffUU2iuC3ET!!!ܧe;}UTVB!"2$h̨vfeUBHC35V!!̨fUUFr!!3X˼vUVdC%EC4U"""vfUT!!""%ZffUVD"tD4U!!!LwfUUd1;}"!#"""%JʧvfUUd1XuTTE-ʇUeDg"""!!""!${wudUD2UUD!!!"#-ʆeVEWB#"!"!%\eiveVeD1uVE!!"",˘veeU!!"";}""%EwffUeDQXweU!"!"&ۨfffE!""!"$tVffuUTBwff""ܧfveVv2""!""!!%C6guedC2Wv!!!"̨vefVj2"""&;}!8feUU3Wfg"!""!vefdy2"2#"c8f2#CeW""#"3Mvvufhd"""#"!"'eJS!331wf"2"""vfefW##"!!!'uX;}T 4$!&u!!"".ڇgffF""!"1!6XvD% T1w"!!""#+ۗfVeG"""!3"(gfCU#D2C!h!24ܗvvff2""!!"xudD#3E;}B12##"#wgvg"##2!"""eDFTET3!!!""3""wffe{B"2!"""!"uDUeDT2!"2!"#"vffeyc"2"""xTDUUTCB0;}!""!2=wfey"!#""#"vUUeUUCT0!""#-ʇfvf##2!""",vdDWeDDC!!"2"#"#+fffx3"1!1*چdDFUD4A!!"!;}"2#!%ʗvfuXb"#"3"'xTCEUTBR#3!!!322˧vgffu!!#"#"!ۘdTDSCA!#"#2ܨgvggwf"""""왇dEDDC@!!"!"""#;}vffvwfS2""""mveDVE4A@!"""!"""""xuDTefhugvweT4T3#3TT#""3#"22$"#""-ʨfEUGvwfwwfeeCDCEUTU3"2B33#""222"4۹fhUVvgefVfuVCB%UUVeV"""#3;}23""#2#32ˈeVVvgwffefffUVTUUefwf"33#"#"#B"2"##̘ˇfeefhgvgvwffeTgfgfggg##2333C33"#""3.GvfWvwfvgeedVUwffwvfw2#32333433;}C2"3-7vgfvgveUeUVVVfwvv2"33#2#3C4C42$H̻iwfvffVfUeVVWVvgwwgwg"2#3243CC333#"3uwffgffffVVVeXggwwwx"#33333C333"#2#;}̆vgfvffffUeeTwfvwgvwx3323##"434C"#3"ʉUegfvgeeUUUXfwhxw2"2B3332$C4DC4B>ڻjvVfVfeUUUUDEwvfwwww"34#333CC333323.Wu;}fUfVfUUUeFFgWwwwwww#####3CC3C32#B3O딆fTTeUVeUVWefgwvwww#233C3C4C34CD33.ffUDTefgveefeXVxwfww3223434444CDC43:ffVUEWff;}gveuGWVfwfwxxw#33$343CC3C434C9wfUDFgvuvVVVvWwgwwww"3#33C3CCC333C4Iwved4FwuDVWfgWwgwxww333333343C43D33wveC#WvgfDf;}ugUffw33333344DDDCC37xwgS3gudVuFvfvyxxg"33D434D44C43CHwvfTFhTFVfvhxwxw#3D33DDCDC3DC5xuC)ffvfwh;}ww2433C4DD3C3C39xu2wiʙvfegVVfw##34334444DCDXxd3wvVvfVxwwv2C344333DCCDDuڇd8xWVvfTxxwf;}32DC4D3DC4C43wwVeewxghg#3$334C3C3334ɩvgeUUwff#433C3DD334C5̸yixvxfUVgvh33333;}3DDDD4CFə̪˪wxvVDfvy#2D34C3CD4CD8ܩ۫hfegi334C3433DCC4:ݺ˼˙xyfeVfhC$3334D4CC;}4D9͊y۪˪vvTVUe3C33CCD43D4CIܼܺܪV}vUffW33343CDDD4CCW껹̽ˬܫg޾fefh3"DC4C3CD4C45;}˽vef#4DC4D44CDC4Dͺ̺yzwgeUW3433C44DCC44Dͫ캫xV܆Vk333433D43DDSD˺۫;}ګʘVe}V3C34CC44443CUۼǨʫfef#3D33C3C44CDD}ݩhx|ݸ"4DC443DDCC4CNݫˉx;}Yiʼٜ"44C4D34D3DD4Kəy#3D33C3C44CDD}ݩhx|ݸ"4DC443DDCC4CNݫˉx87""!uUTEz"""!$gxtUDWC4R322#""uTEV}r!!!!"hxxdTDVTDD"32#!"̆UDUj21#!"""yxyucVfd$E"2"""!!?}܆VTEj""!!"jzedefT4DC$23"!!ܧUEU[""!!yedVfe34C"2""!!ܖeeEi2!""""#"!ixeegfe3#C"22"!̧gV?}TG2"22!!!3gvegfvS"4B2""" !!eEUgR!"!"#hwvfegS34D#"!!|eeEXb2!1"!"!DgvuTGu3$E#"!\eUTW"?}!"!"3Hyvu@VvB"5E" !!"LuUUX""!!!Hxu3VfS24U2"!!-efEV!1"!!!""WywtC7wS#$UB"".vUUW!"?}2GhwuC&wT2#DB""!"!veUg!"""GxwdTEwuB"ES"!!#eeV!#"!#"3XwveUShv3"5T3!!2,vfeU"#G?}xffUT7C"4T2!!*چUUVv"!"Fh̘wffF5xc34U4ۖfUUA!""!""GwvveU#xsB"VD!!'˖fUU1!""#5hf?}fUU2iuC3ET!!"$ۗeUUh"!!!"5h̨vVVfBhC3Ed!!!ܧeUTVB!"2$h̨vfeUBHC35V!"ܧffEhc!!"!#CiffeU2'?}D34U!!̨fUUFr!!3X˼vUVdC%EC4U!wUeEr1"""!!"#3IwfUTC#weCDF"""vfUT!!""%ZffUVD"tD4U?}!vUeEt!""%Y̘veUTC!EDE!!!LwfUUd1"!#"""%JʧvfUUd1XuTTE!!""هgffWs""!""ʉTH?}S 3#17e"2"""vfefW##"!!!'uXT 4$!&u!"!113.ʇfvfV2""#"""vYTE25f!!"".ڇgffF""!"1!6XvD% T?}1w""#!"-˖fgVg2"!"!!"'gjvS7 D1" w"!!""#+ۗfVeG"""!3"(gfCU#D2C!h!""(ۘgeVV""2!'gvD52#D2S(?}!24ܗvvff2""!!"xudD#3EB1!!!""""""ۘffeV!"2"2"""#̸xdDT4DT2 2##"#wgvg"##2!"""eDFTET3"!!?}"2"2ܨvvff"!!"""3""yeTeTTDC !!!""3""wffe{B"2!"""!"uDUeDT2!""wgwf2""2"!""tDVUEDB !"2!"#"?}vffeyc"2"""xTDUUTCB0!#""LwffV""2"!!$ʇT4VfDDD !""!2=wfey"!#""#"vUUeUUCT0!!!"2""""-wffe?}x"2""2""͹eTDUUT3S !""#-ʇfvf##2!""",vdDWeDDC"!!!1#2-vfuh"""#3#+vtDeTT4R0!!"2"#"#+fffx3"1?}!1*چdDFUD4A"1!2"1"(ʗffegB!"""")ˇTUETTBA3 !!"!"2#!%ʗvfuXb"#"3"'xTCEUTBR#3"#"˨fffgs#2"""12?}cD6UDQ1!!!322˧vgffu!!#"#"!ۘdTDSCA!!!!"2""""˨fffVxv2""22"숖TDEC4A#"#2ܨgvggwf"""""왇d?}EDDC@!""!"!"2#2"vgwfwg2#3"2#"}ܨeDCC41Q!"!"""#vffvwfS2""""mveDVE4A@""3222"Mvwgeffb"#"#"">۸uedSE@?}!!"""!"""""xuDTefhugvweT4T3#3TT""2""2#""32#2-?}xfWeFfhggvffEDEC4EEU#""3#"22$"#""-ʨfEUGvwfwwfeeCDCEUTU"2$#2"#""#2"#+xeVTVfwvgvvffU3B4EUUf3"2B33#""222"4۹f?}hUVvgefVfuVCB%UUVeV"##3223#2"3"#2ɘteUgwwfvfgvfdT3FEUfff"""#323""#2#32ˈeVVvgwffefffUVTUUefwf#"""3223###"#2뙻fveWgv?}fvgUfgVUEvffvff"33#"#"#B"2"##̘ˇfeefhgvgvwffeTgfgfggg2"32323"33B424\܈GwvVfvgfeeUUUfXGvwwvf##2333C33"#""3.GvfWvwfvgee?}dVUwffwvfw"24#33#2C32"##>ܨUfffgffgvfVVUUvewvwwg2#32333433C2"3-7vgfvgveUeUVVVfwvv"#3#2233C#2##",wxvgffguVVVUeeXf?}ggvgw2"33#2#3C4C42$H̻iwfvffVfUeVVWVvgwwgwg""33#234333B#3$ۼggvveeeUeUUGvvgwvw"2#3243CC333#"3uwffgffffVVVeXggwwwx?}2"2B3#3333C3"3AvffffffVUUUUvfgwwwwx"#33333C333"#2#̆vgfvffffUeeTwfvwgvwx2233333334D4242˺xfVvffffUeVVVwwwwwww3323#?}#"434C"#3"ʉUegfvgeeUUUXfwhxw"#"3333C333#3B#^hveUfggeUTUUdefwgwwwx2"2B3332$C4DC4B>ڻjvVfVfeUUUUDEwvfwwww#"#332C333?}32423.HfUUVffdEUTeUffxxxwx"34#333CC333323.WufUfVfUUUeFFgWwwwwww3#234342333C443.ڶvVUEUfUFeeUDUYvhwwxw#####3CC3C32#B3?}O딆fTTeUVeUVWefgwvwww""3C433DB4C424D>eeUFUVfVfUuVXfgwwwxww#233C3C4C34CD33.ffUDTefgveefeXVxwfww3343#43CCC333C3=gfe?}fTffgvgvgffeWwwwxw3223434444CDC43:ffVUEWffgveuGWVfwfwxxw"#C2CC343C334C3IfUUDevvuwEueVwggxw#33$343CC3C434C9wfUDFgv?}uvVVVvWwgwwww#3333344434CD33(ufvfD4VwvUuEeWffffwyx"3#33C3CCC333C4Iwved4FwuDVWfgWwgwxww3333434344D4C3ChgvfTDFwywUEeF?}fVvfVxxxv333333343C43D33wveC#WvgfDfugUffw33234D3CC3343DCvvd4gvgjWVftWwgxwf33333344DDDCC37xwgS3gudVuFvfv?}yxxg33D33C33CC343C;vuC$zxUvfeeeg"33D434D44C43CHwvfTFhTFVfvhxwxw#4C3C3DDCD4CDCzxwfC'YUftWefw?}#3D33DDCDC3DC5xuC)ffvfwhww3C3D34DD43DCD6wxf2izUUUvfwyywv2433C4DD3C3C39xu2wiʙvfegVVfw"34D3?}D3DCDCD2JtCyefuVvgxwxv##34334444DCDXxd3wvVvfVxwwv4433C4D3CC3C3d4gfefueww2C344333DC?}CDDuڇd8xWVvfTxxwf2433C3D43D44DeY̪fwfeVwwvg32DC4D3DC4C43wwVeewxghg333233D43C4DDʈ?}۪vvvUVxwvh#3$334C3C3334ɩvgeUUwff334433CCD4CDDܨɜٻڪvgfUxgw#433C3DD334C5̸yi?}xvxfUVgvh#4CC4DDCC3345͊˼˩iiveUwwgi333333DDDD4CFə̪˪wxvVDfvy#433C43CCCD47˪ʩʺ?}wgxUVVfw#2D34C3CD4CD8ܩ۫hfegi33#3C3D43DDCIʪ̻뻺vvUVVfx334C3433DCC4:ݺ˼˙x?}yfeVfh22444C3D44CCJ칧ʺ۪g͗fefv{C$3334D4CC4D9͊y۪˪vvTVUe#3DD4C3DDDCD:ͺɛ̼zge?}wg3C33CCD43D4CIܼܺܪV}vUffW"44C4433C43D9ʻܩzwʝxeUVg33343CDDD4CCW껹̽ˬܫg޾fefh?}"43#C4343C44G͚۫ʩyv˽eVDj3"DC4C3CD4C45˽vefB333CCD43C43E۪̼fxTVf#4DC4?}D44CDC4Dͺ̺yzwgeUW33343CCD443CCۻȹ̾ܪifvey3433C44DCC44Dͫ캫xV܆Vk32DC3D3DD4?}CD2ܩ̛hWmۇe|333433D43DDSD˺۫ګʘVe}V34DC443CCC443˽YveV3C34CC44443CU?}Ǩʫfef#433D4DDCD444̜vvFȉ#3D33C3C44CDD}ݩhx|ݸ#D33CD4DCC4CDL˭h?}uX{"4DC443DDCC4CNݫˉxYiʼٜ3334CDDD3DCDD>י˩x}"44C4D34D3DD4Kəy?}3#D43DCC44SD39̹ɛxxh޾3334CDDD3DCDD>י˩x}"44C4D34D3DD4Kəy<7?