@L}5 _$% l0$)$$Hȱ$ UhL" `e$$%`$%`  R@P!( L(1   Y I`  d  Ld M * @  $ % CC$$)ǥ%1 Udߥ$9%: !0 S$% DD˙`  }J)Lr d M * @  $ % CC$$)%1 Udߥ$9%: !0 S$%} DD˙`  }J)Lr J  ((  p L ()   J}NjL= ( L 0q A    IB JC;? D W } LL  ` W )LA!  ߰")-݆ p" } $G@LL 08`Q")<2Q0 -G$Ș݆ UL# ; p8(()(0ʥ)NQ` }$GȘ݆LU )L ݆ L GȘ ݆LL )W>Z   HH)H }p h  hyhy D L> L JJ    ! LA*` BF }7'8  M HN H` 8 Z  \LdJJ!"!GFE@F (!L }EE !E^ ^ E E7EȩEdE/EȩE  D } .L }  ;F d  ;?F7F? ( .   Z D LL d } . D  L    p  E` , d)  D L) 0BM݊L݉} ML  N݆ L NLML [ TEqEHȱEqEh 0Gȹ G} HLL GɛL  LFREE SECTORS G) *Gȩ GȽG GȌ*jj >G}Ǡ}N 2 FORMAT. t* 5) 1L!`) 0NΞ 0 L1) 1 L!BAD LOAD FILELOAD FROM WHAT FILE?) 0 ?}ǿ0#B 1L!WHAT FILE TO LOCK?) 0 0$B 1L!WHAT FILE TO UNLOCK?DUP DISK-SOURCE,DEST DRIVES?TYPE "Y" IF OK TO US@}E PROGRAM AREACAUTION: A "Y" INVALIDATES MEM.SAV.FE! +L1   `*  70 2 2A} 0.* 1 y0 0)INSERT BOTH DISKS, TYPE RETURN^, 1 y038逍 N, 1L! ,B}ǞC, t*  Lx+, 0 ^, 1 y0 , ,0,0 ,L+ ,I0 ,Vǭ0C}ǫΞ, 0 }, 1 y0C,ШC, 0K'!" H H 'h h Lx+!EF 5L1L!D,I,HhD}` NOT ENOUGH ROOMINSERT SOURCE DISK,TYPE RETURNINSERT DESTINATION DISK,TYPE RETURNE}Ǎ`  `8 rL1`-* 1P* 1 y0Y`hhL!NAME OF FILE TO MOVE?- 0 0|DL% <.F},^ 1 70 0 .@L# .BJ 1  DEHIB V L1 ,} 1 70,L.  G}JB|,#P#DE 1 HI BDEHHII 1 B 1 ,^ 1 70,0La- B V,#PH}G,^ 1 70 0L#L!-* 1P* 1 y0Yj383}mm ݭI}I}`8}``|* ? ɛ,`|:-)| / 1L!`DESTINATION CANT BE DOJ}S.SYS0 0H{ 24Δ 28/L!/) 2 Π 2 0 ξK}hAΞB,0 J 1 BDEHI,HÝDE 1HIHIDELSAVE-GIVE L}FILE,START,END(,INIT,RUN)O S0 1`BDEPHI V` S0H 1 L!M}0 0 1L~0`PLEASE TYPE 1 LETTER,0`hhL! 70 1L0L<1 ,;ɛ7,"ɛ:ݦ1ݥN}A"D|ݤD|ȩ:|ȩ|ɛ,,(/+.ީ1 1,ɛ`轤{NAMEO}: TOO LONG B VL!` L1I H1EΝDL1?@D|mDiE` V0`8d/8 i:222 1 LP}!ERROR- 130ɛ+,' 20*.. өr2 1``2TOO MANY DIGITSINVALID HEXAQ}rDECIMAL PARAMETER800 0 8 00`,0'D800 H,ɛh`2L1NEED D1 THRU D8xuR}r ECIMAL PARAMETER800 0 8 00`,0'D800 H,ɛh`2L1NEED D1 THRU D8xuVPP PTU PSetting Up ATARI 130XE RAMDisk U PRAMDisk Not Formatted! [ U P   T} P@BDPEJK V@C08? PiLPhPhPPP PLPPHPH`HI BLV P}`@U} BLVDPQ8:DUP.SYSPK V@C08? PiLPhPhPPP PLPPHPH`HI BLV P}`@&Q짠򠠠v W} Πռ$IK\ bŠr s} X} @۱ Exit To Basic ۲ Exit To DosE FP b۳ Printer Configm n} Y}<ϠSPACEBAR͠Ӡ@Ah READ/PRINT ALL Z}G NOTE: This DISK J/S to read Scr may contain .BAS Disk Catalog & .COM files. BCALC Article [}[ * BANKS Template Check Directory CREDIT Template for more .COM or INTEREST Temp. BASIC p \} rograms!  5 Check 報 forE ] more OHAUG news m articles!! ]} ,5 forE ] more OHAUG news m articles!! -&2|Vol: 8   Assembler|| Atari 8...  !!!D G||S T\ ^l || a} ||  ||--> <--|| b}g  ||  || Atari User Group Inc.(c)1985 |***m Alan Sharkis, Edc}itor ****** %43 Rose Drive3 :******@ WEast Meadow, N.Y. 11554[ `***}d}3|Charter Member NEAR*US ATARI USER Gp.||> LX [|}e}3|Charter Member NEAR*US ATARI USER Gp.||> LX [|}aO) !"`3!3$EF%MN&UV']^(f99ԠŠ q} SAVE "D:NEWSLTR.BASbKK䠱cAA󠱱 r}Z䬠dmm堲à_ Ӡįί s}'̠ŠǭԠ̮ 6--56-@9A'6-@EM36-@QY?6-@]ӠϠŠӭ t}7ҠԬŠ̮Ϡ̮R`@;E:(AR`ΠŠ̮Ҡ u}ŠқQB7t@d$'@(,@d063@:o?AKA Q-'A@es'@ v})5K:6-6-)6-A2-556-@933;,;,;,;,;,;,;,;A2,L(6.D1:WELC w}4OME.SCR(~EA !A@h8F3B7t@dJPE@TX@d\. AP6.6.  x} $(. A 8-@!P8($Programmed For The Ol' Hackers Atari9-@"T9(% User Group Inc. By:Kris Holtegaar y} dF00(' Modified By:Thomas J. Andrewsx666.,THE OL' HACKERS' ATARI U.G., INC. NEWSLETTER67B:,%,.7<@ z}8(,&-B:,6&7<,0 A,F @L 6. 67@J_,.#67,.C6-+@cj&,'@nr%@vL67, {}.r'A @I#-A"P' H6.D1:MAINMENU.HLP$@MT5@XdA@hH(}!A |}!A@h3" AP(" A7H:]B7t@dLR'@VZ@d^l9A @pxE-@"| }}BV( Selection: ]6.l/ )/+"AU)"A&,*4AFY"AUA(]."A&*B:,"6.$* ~}C . A:0"A&6.7I4+"@2Mt A%P+% D:HANGMAN.BASf55 @Ix)!@ }R * @e)!@,APT"@I0>(}!-@B`9(Exiting To Basic...E@dQART;" }@P(}!-@,8(Exiting To Dos0.>;.#"@QBH A9LR# AVa. 1"@Re6. D1:HELP.*'- }1 A1 ` 9"@e?/6.BCDEFGHIJKLMNOPQRSTUVWXYZ9 A(Ci 267B:,%,.>:,*2B:,"@mqA(u A } / +@-/(@#?TURN DISK OVER( /-@CJ/(@NTHEN PRESS ANY KEYZ 5AdAU) }& A' <5% D:PROG.BAS o+A%A @@F7-@JN@RrQ(NO PROGRAM THIS MONTHc-@v@ }:oAR B'(FLIP DISK AGAIN AND PRESS A KEY1 A'>K8)B AO^ 6 (}-@ bf@ j6( What's Your P }leasure?" _B7t@d#'@'+@d/59-@9=@ArX(enu rint ead: _)T 8"@wv(( }.( Main Menu.8 A"- "@15AT9D 8"@HT((.(Z cRead Fileg.8 AGP .-B: }+,6. D1:**.TXT.67<,.7<, F A2/QA )5@Ud<(}F A4huN   Ay 4 }F:A,"A6*@"@@&;4 A7P **"@e?k*F:A,"ApA1P pA @ow4@e{*F }:A,"Ap:(}L-@!%@)p(Not In This Months News Letter ! AGP AGP! A1PH TA  }@'A@hT((} %@짠Ez 00(( à aB } 7t@d '@@d&4@*68(D@w:daF:Ad,"AFA7P F:@hm, @"quA5yE }(3(' 堒EAdAUB''F:Ad,"AU*T:,"A6Pt%AdAU }(}% A4PZAdAU(0(Z($Press a Key or Trigger for Next File''F:Ad,"A }U*T:,"A8 *@!%@@)y'AdAU*$<NA %6.D1:PRESSPRT.MNU*5G@} }@@HN(}n((6-C:hhhhh Ȅԩ`,!A@hLa!A " AAe(" A@P }CA @#6QB7t@d'-'@15@d9?9-@CG@ KnJ( Selection: Q)h!!"@irx)"@e| }AH"@x)ADP"@c-6' A:E@IZAAP0K AE^(}3D1:PRESS } PRT.HLP= A4G A9*KÛbC6-@f.66-@V:N!6-'6-36-@R^96-C ARbS6-F:A,"A6 }GE(! Viewing Complete Press Any KeyL)O$SÛU (}-@KO@S'"A8K(Your Printer is Not On Li }[ne...U AGP<"Ap2(Printer Help File Not Found...< AGP*= (}-@_c@g3(ERROR # F:A },= AGP\ A9&-A*: $7@>N6-!"@eR'6--6-7 AIPF (}-"(P };RINT STYLE?0( . DRAFTF(. DOUBLE STRIKE$0)@?K6-&@dO0 )!AHPVU (}-3( PAGE CO }LUMNS & LINE SPACING?U(. 2 COLUMNS AT 6 LINES/INCHh%(. 2 COLUMNS AT 8 LINES/INCHG(. 3 COLUMNS AT 6 LINES/IN }6CHh(. 3 COLUMNS AT 8 LINES/INCH( )( @e:@)!@hDWAIPg6-@f[c6-@Vgo'6-@s-6-C }"@f)"@hO6-@&[6-@*2g6-@v6A!@fE6-PI (}-!( PAPER TYPE?4(. CONTINUOU })SI(. SINGLE SHEETS( )( @e-3)!@f7;AR?J"@fNk6-&'Û$M@o6-%6. } D1:**.TXT+6-16-=6-B".C"M A92fJY (}-,(ll, dd, ven, or8-@jY(irst Odd, t }#hen Even Pages| )55@e'-*@y17*@i;A*@pE[ATPT6-+"@p_h,-@lD( very Page } or artial Block?HT6-@y$6( )(@i:@*@DWAVPD"@i[AYPv:( First Page?  A } WP,@R: AWP 6-P:,:( Last Page?  AXP,@V: AXP  6-P:,>0 A` }&@wP:0 A`Pp<.(&Check your printer, then press .2< AYP 6. A{ }U (}-9(LOADING BUFFER with Page %...U(Use -P to Pause+(Use -C to Cancel+-@ }38^*("Every Page must be Loaded, even if6-@7[R(it isn't to be Printed.^-@_j= 6. 67,.67,. }C#6.)6.16-%=@w0/ - A4B6-'6-@@Fl/-"F:Ad,"A8" Ap,F:Ad },"AF", A12& &Ae5AAePAfEd67<,. AfP67<,. AfP67 }<,.! 6-%6-%@9E ! ,"F:Ad,"A8" AIq^,F:Ad,"AF", Au }Ay ..'@ "P:'@$+,*"@y/3Ay7B..'@FNP:'@RY,*"@i]aAyen&9 Ar& }@UP:,"9(@=X "(G6  '6-+",$%+",$+@Y&,6(=:,N ((( }":6-+",$@ $%+",$@(1G*@'5MN*: 6-6-@@Qm-$6.*":6. v  "F }:Ad,"A8" ACR,F:Ad,"AF", AG<67B:,%,.7<,)67B:,%,.7<,<67B:,%,. }L7<,"6-?: BwithF ItheM file name QUICKCAT.TUR. MEMORY. The program(}G uses all but 318 bytes of your volatile RAM therefore not many changes are possible. You MUST use TURBO BASIC w(}ith this program. If you have any comments they are welcome. Please write to RON FETZER, 22 MONACO AVE., ELMON(}OT, NY 11003, U.S.A. This program is in the PUBLIC DOMAIN. February 1997. _>bENDt< ELMON(w! !FILEC'< B`;@@G,;@KZ,0A@^jBA pe( ( (,}%e(TTo load the PREVIOUSLY saved file* cDISKFILE to the RAM DISK D8: use DOS OPTION C'('(g ıŬĸ,} 2%(%( /FILES ON RAM DISK D8:<""(4 49-A -- --- E-R ---F= @V\=@3`e@ikqsy D,} 8:MEM.SAVP4 A@4@$(@,.4GD8:*.*Z@KZd++@:7@^b<@fl,,!@RpA@n4,}7@ <@,44*(# 74 A@x(< G @KW B[B( (B2Go to LOAD INFO or ,}+QUICK CATALOGER (LOAD/QUICK)=37@/3<@7B,4L)7@FJ<@Nh,4l= AF37@lp<@t,4Q)7,}@ <@,4qF%D:QUICKCAT.TUR[` ([(LIf you have used the QUICK CATALOGER BEFORE then you must do the followi,}ng:dd([You MUST load the file DISKFILE into the RAM DISK D8 so that the new files can be appended[[(S to this file,}Q. Or you can load ALL files into the RAM Disk by using D1:*.*,D8:*.*$($([ Please type DOSd(d(XWhen you,} are finished loading the filetype OPTION L and for the filename useAUTORUN.SYS c(c(WAt the END of your session with t,}Vhe QUICK CATALOGER you must reverse this procedure. UU(MYou must save the filesZ from the RAM DISK D8 to a floppy di,}sk.Use OPTION C(! VD8:*.*,D1:*.* D:CATMENU.ARBust save the filesZ from the RAM DISK D8 to a floppy di,D6;;BFILEADISKFILEDNAMEPADDFILEEDARRAYFIL1ARRAYAADNUMBERNAMETEMPREVSORTYNNAMHGDLISTZKEREX0}TEERXXTSTBBYKKF1F2F3F4F5MPCINEMMENDIRECTORLOANEW_FILEERASE_FILESORSHOW_SORPRINT_SOREND_PROKSTART_L0}OADEESERROLFILE_NUM_SORREVERSE_STBICDALFA_NUNUM_PROMPRNEND_FILE_ERROSCROLKEPXPRINT_ALFA_NUX0}GTITLTFL_PREEEEPAGPRWTTWTXYDRFILE_CNDISKFILDFILTZERW #)0}.CU U jB 0G EG ZGoGGGGGGGG1}GGHH*H 6H BH NH ZHoH zH !H"H#H$H%1}*H&H'I (I)I*"?/2+@6:,A>B-2CFJ.JNR/cLVZ0R^b1Xfj2^nr3nwx4}1}5YD 678"#9*+:23;:;QU?HPZ[@bcAjkBrsCyDU1}Em FGH%&I-.J48K [<@L0gEFMMNNTXO\\`P]efQmnRuvS|1}T` UVWg !X'+Ytb01Z89[@A\HI]OS^jXY_`a`hiapsb@xc@1}d@ efIg"&hp*,i24j;,;@BI,;@MY,<ss;@]d,;@!ho,;@s,;@1 },;@! ,;@!,;@!"),;@!-4,;@!8?,;@!CO,FN+;@SZ,;@^j,;,;@n,<6. D:DISK.1 }GCATB6-H6-N6-P6. D8:DISKFILEZ\dTn]x6.K cAR#`-@gk@o#(ՠ1 }!( (!(1: Disk Directory( 2: Load Disks!!(3: Add Individual Files##(4: Erase Individual Files1 }x( 5: Sort Files''(6: Display Sort on the Screen(7: Print the Sort(8: EndB A0-@ |1}@&8Select a Number >>B B*9g )!@=t)P:,(D("Error: Select a number from 1 to 8V-@'x@1}]( g A0b\TOU 6. `(((((("(%(((+(U#DIRECTORY FOR W1}C!HICH DRIVE 1 OR 8 >>"@%8A"@<OA=()(S ERROR SELECT EITHER 1 OR 83MA = A1}"@+6.D1:*.* "@/K6.D8:*.*"#@OQW `#(, 6@:7<,,!@G1}6A@@(J/ ( /@:7<,, @G:>ABST^&(&(^ FILES ON DISK h;( (/D1}o you want to continue(Y/N) >>;ARr'7<,4Y A@ '$P'A|QTO6. `% A21} !@<%\_l"Ap`((((_(<@ [DATA FILE 'DISKFILE' NOT ONl RAM DISK D8R1}Il"Ap((6.H%SHALL I CREATE A NEW DATA FILE(Y/N)>>R BMk&7<,4Y&@o7<1}&,4NA (] `6-% B*L(AR " P; BPV-@Z;(To go to the type 'MENU1}'A AP6.((A Is there a disk in drive #1(Y/N)7<,4MA7<,4NAP9 A1}#@- B"949*7@=A<@Ea,0 6.* AP-@$ei@mr(w-R-1}@ !R>4MENUAM6-q6-B:,$1}@ '(C( =USE 5 CHARACTERSM A "@ARAPB A1Vd#@h*(/B@1}5&B@!JD1:*.*$6-*6-6ARB6-Pg0 :^^7<@kr,4 DOSw SYS)71}<@ ,4 DUP SYS)7<@$H,4 RAMDISK COMA`DCC7<@LT,4 DISKX cCAT)7<@gn,4 MEMs SAVA`1}#Nq 6-%6-%6-B:,.-@'+@!/HA(MAX. FILES=810S-@ LP@"Tng( FILES LOADED=qM@rSY!A1}@ `((((!(E( YOU REACHED MAX. FILE COUNT!OMADYRU'Y\X&"@]6.  67,.&6.b))671}$@ &@<$@+,.7,l/"7@/3<@7Z,4SECTORS%/ A@v"@^xA`` @ |1 }` ->4(7$@"&&@*0<$@4K, DISK --->>M@ O_)) 7$@cg&@kq<$@u,1!}w 3 6. 6. 6. !6-'6-3AR  \`PQTO* 6. 6. 6-}1"}C'6. *`6-@L6("For type 'MENU' for file name--@P-What is the file name>> 4MENU1#}#ApE 6-B:,!@k(;(Error: File name is too bigE Ap / 6.67,.6./6.{ *1$}< 6-6-B:,67%,.4L( (L>>M6-v6-B:1%} ,$@'(C( FUSE 5 CHARACTERSM A H@ JuR \ APfS`-@yB(1&}"+You must re-sort to include these' 2filesLM@`6OSPpQzTOI 6. 6. 6. #6. +6. 161'}(-76-=6-C6-I6-b`6.0 A6. 26. M TD6. _ fV6. q xb6.} 1(}F 6. -@F(Does this file have an extension(Y/N) >>*7<,4Y A P@' A *AI()Fi1)}-le name - LESS extension>>26-B:,> @1I67%,.M(- Extension - LESS decimal point>>66-B:,B @1*}M67%,.!67@ C,.67,.!6. A H6-Iv6.(H(What file do you want to erase} 1+} >>2 6-B:, @0#67%,.267@4s,. 6.B("What disk # or name>>+6-B:,7 @wB671,}%,.9`AR$-@!%@)M9(ɠ͠Ǡ@Qx? 6-% (6.7<@|,1-} ?6.7@<@!$,$,7<@(,,41 P"6-&, AP.&&67$@!TX&@ \b<$@!f,.8L 4*4F67$1.}@! &@ <$@!,.2 dL6-B APL]l"A6VP"j`(>:AS,1-1/}@ @MF(ŠԠĠPMA `A " `(>:AS,+-@QU@Yk7(šAM@oo"A10}q:`-@@_:(RE-SAVING D8:DISKFILE - WAIT!tSAVE DISKFILE~@c6- -&11} '' 7$@!&@ <$@!#=, R`ARCQ 6. 2-@UY@]RErase another file(Y/N)>>12}#*7<,4Y A @' A'8*AO`-@<rB(+You must re-sort to eliminate these filesLM@vO13}PQTO 6-6. 6. A` ( (((A(*You must assign a file name for the sort8(8(-The14}G filename should have an extender of Y( (M=Please enter the filename and extender(max. 8 lttrs + .SRT)>>YA15}5URC4DISKFILE(9(Error: You cannot use this nameC Ap 1`-@ Y]@a1(Ǡŧ16}G 6-B:,67@S<%,..67<,.D8:;6.7<%,GAR@WY_( 6-% A`17} 2+7<@,4 8!6-&+ A <&&67$@!<@&@ DJ<$@!N,.F A Pl"A6Z.`-@18}@ i(( Ԡՠ+(.(d(1: Sort by File Namen(2: Sort by Disk NamexE( Ams"-@ w@19}!;Select a number >>E B%i` )!)P:,(>("Error: Select a number from 1 to 2P-@'mq@uV( `1:} A7 jT]3AR`$-@;?@C3( ǡ " P# 6-6-6-6-#61;}j.  6-$+&,A6-P:',"AP-+&,&6-S 6-%S7$@!nr&@ v<$@!1<} ,/7$@!&@ <$@!":,A@f&6.7$@!>B&@ FL<$@!P[,f67$@!_c&@ gm<$@!q,.7$@!1=}&@ <$@!!,B&67$@!%)&@ -3<$@!7H,..6-&B!NsA  A_`-@w@1>}9/(ԠӠŠ<(>:AS,I(>:AS,SM@`=Z_ART":`-@^b@f:(ǠԠϠ1?}͠ˠĸ,@E6-6 -&@'' 7$@!IM&@ QW<$@![,J T6. AR1@}(^QhTrO| P 6-+6-.y6. 6. +AP8( (8(What SORT file do you want to see} 1A}[ >>B4DISKFILE(8(Error: This is not a SORT fileB AA 6-B:,67@_n<%,.467@r<,.D8:A1B}6.7<%,6`-@ @#3(Π٠պ6(.( (.(1: Files in alphabetical order##(2: D1C}(isks in numeric orderA A@-@,0@4R7Select a number>>A BV` )!)P:,(>("Error: Sele1D}ct a number from 1 to 2P-@(!%@)oV( ` A@ jT] " P8` @s 6-1E}$&6-,6-8AR0`-@(,@0_0(ǠԠŠ 6-% @cr&+7<@v,4 1F}C !6-&+ A 0&&67$@!$(&@ ,2<$@!6h,.: A D]l"A6N7`-@lp@t4(TO 1G}G4 PRESS ANY KEY7(X-+&,b&&6.7$@!8<&@ @F<$@!Jc,l9 "9( 7<@gr, 7@v,<--1H})v7 "7( -->7<@-9, 7@=Q, 6-%"@"UkP *(*( o You have &1I} disk files= 6. AR=Do you want to continue (Y/N)>>'7<,4Y Ap@ '$P'AQT1J}O 6-@"K: )"@: ,A @  QT OP G 6-6-6-61K}-!6-)6. 16. 76-?6. G6. *8( (8(What SORT FILE do you want to print >>4B4DISKFILE(1L}\8(Error: This is not a SORT fileB A >8( (8(Disk Library Name(Max. 25 letters)` x>>H; 6-B:,67@|<1M}.%,..67<,.D8:;6.7<%,R-`-@26@:*( Ԡպ-(\:(+(1: Print files in alphabetical:(1N}M orderf(((2: Print in numeric disk orderpG( ( A!`%-@QU@Yw=Select a number>>G B{z1O}B` )!)P:,(>("Error: Select a number from 1 to 2P-@'FJ@NV( ` A!` jT] 6-1P}36-6-6- " PP)@7Y#AR)6-1`-@]a@e1(ǠԠ1Q}* 6-% A"+7<@.2,46 U!6-&+ A"P&&67$@!Y]&@ ag<$@!k,. A"P1R}l"A6%6./ T%6- <-+%,A867$@!X\&@ `f<$@!j,.<  1S}@P: '`-@"@&'( Ǡ$  ")"P. AR8 QB TL OV K Aq6-@1T}T '6-@T36-A?6-AbK6-A` U!Ap* AA%6-A16-A=6-AI6-A$1U}mU6-A2j U!A@* A%6-Ab16-Ab=6-A$I6-AU6-AHt -@q~ 6-%1V}@ &&6.7$@!&@ "(<$@!,@, ..6.7+%,$@!DH&@ LV<+%,$@!Zn, ..6.7+%,$@!rv&@ z<+1W}%,$@! , ..6.7+%,$@!#'&@ +5<+%,$@!9M, ..6.7+%,$@!QU&@ Yc<+%,$@!gs, "@w(@1X}C 7@<@#, 7@'+,/ 57@9=<@AM, 7@QU,Y _7@cg<@kw, 7@{,1Y}Y  g"@g(@!'7@+/<@3?, 7@CG,K Q7@UY<@]i, 7@my, "@}1Z}(@ 7@<@), 7@-1,5 ;7@?C<@GS, 7@W[,_ e7@im<@q, 7@1[},  g"@#g(@'-7@15<@9E, 7@IM,Q W7@[_<@co, 7@s, u"1\}@T u(@@K ZYou have &@^w disk files "@T{1]}P   (@) AR/Y Q T( O2 K 6. `-@]K(Did you do a à f1^}Pirst(Y/N) >>< '7<,4Y A&0@ '$P'AF QP TZ O3>:@Tw, CONDENSEDd V`6. -@{V1_}s5Did you set the paper to the top of its form(Y/N)>>n *7<,4Y A&@' A&`*Ax @wP1`}:( LG(:K cL( Q "Q(g pFILE NAMEu DISK 1a}  FILE NAME !DISK % 7 i "i(; DFILE NAMEI QDISK U X\ eFILE NAMEj rDISK v y} 1b} FILE NAME 'DISK i "i(DISK- ;FILE NAME @ H DISKN \FILE NAME a i DISKo FILE NAME 1c} O "O(  DISK# 0FILENAME 5 = DISKD XFILE NAME pp(d}=1d}?=K ++( k= Q T O1e}' 6- 6-% ( OO(>d -- &( ((1f}((!(&( 5+"@T#Z)"A*")"Ab*"5 A)" Q "Q(^ gFILE NAMEl tDISK x  1g} FILE NAME DISK  ., i "i(2 ;FILE NAME@ HDISK L OS \FILE NAMEa iDISK m pt FILE NAME1q}B%DOS SYSB*)DUP SYSBSRAMDISK COMBVMAINMENUHLPB^WELCOME SCRBfAUTORUN COMBgAUTORUN SYSBiPRESSPRTMNUGBDmNEWSLTR BASBBJOYSTCKTXTB:CCATALOGTXTB CATMENU ARBByQUICKCATTURBJ}BCALC COMB4INTERESTBC BBANKS BC kCPBCREDIT BC B (DBCALC TXTB"HEBANKS TXTB1jFCREDIT TXTB5GNTERESTTXTq DISK6 i "i(DISK$ 2FILE NAME 7 ? DISKE SFILE NAME X ` DISKf FILE NAME @ O "O1r}(  DISK 'FILENAME , 4 DISK; OFILE NAMEJ pp(d}=1s}6=BT ++( b=^ Qh Tr O| /6-1t}D6. 6. '6. /6.  -+&, &&6.7$@!HL&@ PV<$@!Zj, #6.7<@ny,#6.7@}1u},  6.67@&,. &&67$@!*.&@ 28<$@!<d,.   Q T O +`-@hl@p+(End of P1v}rogram 7-@F7(#Copy the RAM DISK to a FLOPPY DISK! ?-@JN@R5(Use Option C 'D8:*.*,D1:*.*?MA@1w} + A0u+(3>:@'"3,@+  B7;+A Q T [`AR(((E(%DISK FULL OR R1x})EMOVE WRITE PROTECT TABQAR[ B-5! /%(= XUNABLE TO SAVE DISK #/ B\q# 0 6. ((0w CATALO1y}G ANYWAY(Y/N)$ (7@"<@&3,4Y(6-@7B% 27@FJ<@NY,4N(6-_e2 Ai& A%0 T:1z} O6-1AR? /` ( ((/(8 gCOUNTING DATA FILES!D # A1`#@kI , A1P1{}"6-%@8, A1EN Hl"A6(1(@ UFILE COUNT = ;M@0Y>`H A1X Pl"Ap((71|}C( BLOAD 'DISKFILE' IN TO D8:DMAPARl  BFARQD:QUICKCAT.TURl"Ap((70l} @%q6ppPB B #A@%HHz%{% ԍz%hh@z%L_ ( , ) ( *%1@0 F 5~} ( *E ( h* * {/ .L? .L% *)}F  >L"&F&F& U0L%$ɛ 2L%5}ǻH{$=ɽL& . 6¥΅i$i ݥi$ , .A$ < \.L&-$:/./ : .L5}ǽ&H , '- h* 0DG .DH &L%L`'?*HyK) HHhH曥 '- h* L`曩yK(L'Ȅ5} ) -ě yKěyKH? m LHL'D`ƛ '-H8KhHL'ƛ ) -yKHL'5}Z ` h*ƝƓƞLh* h*ƜƞЅ"" o(8('P  '- (Lh*`e?` h*Lh* 5}h*枩x P  o(i(i'"e '- (Lh*'` B V䦯` (L( ) ,`ɛ5}Ǒ`澥 8 HHEEh h 摥`ةPE Ei(EiEd%5}ǩ %} \Ԡ?K L󅐩Kѕ0EGDGmKHyz y*z*JIIKʈ0_?_ʅ5}ǩLJLșJLii?L HMHWHIHiHiH9`( '@5}KHJeƍhe)`!88HIhi!Iȑ拥L* *HIĒ L @`EE` #5}"#` *`ɂI@Ɂ IL*ɃɄɅ𽥸@a{ L*ݰFM5}Ƕ`EE` 4L.H+e+H+i+jݭH8傅H僅HeHHiH +`Η++Θ+Κ++Λ+5}Ls+Ƙ ƙ8``+e++i+H8+H+H8嚍HHH +`++++L+J`5}e JLȹJL]i 8+ȥȩ‘ ;$i e,` L,JLeJLȹJLiJL`Ŗ ,5}8ei ;L!,Hi +h L,JL8嚙JLȹJLJL` ,`EE(`yK(`5}Nj '-摥` JLȹJL`H , ,h -ŊKe报Ō` ;L<-iiEE5}GL!.)[8eiL- .$$$ 6K ,捥ŕ .LJ- O. 4L5}- B. D آ$ ݩ ,`KƕFLJ-$`` O. ؠ0$)$Ȅ$05}Ǡ$$` $`$ɛ){aI $` , . ) ( - U0Lh*yKH` *F"# GJ5}#8HԥjH ؠH) ,=#hFɛ ,'# >L* 22 s20 6=+ s2##ɛ# ,JHH`5} y0J#J#e -ͲH L/ ;L/) o0 ؠH) ,#h0! ; ,#İﭱH -5}ǥŊ ` ;L/) o0 ؠH) ,#h0! ; ,#İ` E")L0 ;5}ǃLݠw #` JG '` ,1F 22 s2F ( BDFEJK V 4L. BDEI5}H V > (L. 41 ɛ ,L1摥е > ,𩤑EE` 22 s2 2 w6L0 6L.  22 s2 2 w65}Eߩ ( JBǝDFEK VL0 BʝDKE HIH8ʝHHKI VL0 ( 5}}HHK}IHL. 22 s2+ 6=&/ 7 h* , .L.`r$#` .DL.H`e E` , h*5}Ǒ '- h*`#ɛ  8`ȹ#ɛ  `#Fɛ` 22 s21 6=,日$! K , ) -yKH h*5}` E`ȱȱ) ;$ 0>` ; ؠH)$h08L3 2 >(`hhL"& *5}Ǥ L0@H"#MHJ#ZHr#gH#Ll3L3`݈H0)L3: IL3 IL3 ݥH5} 0H)h =){H3#)JJJyH[#)JJyH#)AJ~H#L3 `3 L` E` `3 '- LLh*5}DGIDG2GG`EGIEG8G,G` (ԩ ؠȱH) ,Fh y0F# j>`ȱ0$5}$$$H)JHh) ȱLc5ȹ0.H)ʈ0 ίH,$ $ $ 5}$0)$q6ȹ$0.Eq6$ $ȹ$H)r60$hq6r6ȹ$)$ȩ.$L5.愳ȹ$)5}$mHH$q6r6$ɛ$-$,$$ɛȱɛ )$K8K8I5}JLB6Jȱɛ󩀅`v6=FDF:814`8`F:"# ($BFEǝD VCH (h`H5}Ǣ 0E+#8` Dڢ$#ɛ#@Le:8V膋0# ;)#膋 5}ǽ8787#(8`ȹ#DA# = ذ 7#)L7,τ 6=Ȥ 8㤲 7ץi5}DžL7Ȅ =#ɛ =##Ù# `L7 =`8` -Ŗ 8` ;L8`) 85} ; ; `SQABSQRNEXLOINCNSUAV 8889998-9=99 9)Ԧ =`= 9 O. -:H h= 5}ǢJ `L8 9$> ޢJ (ې` ݰ =L8` 9 ޢJ ڐ` ݐ` 9J fڐ` -: O. L8 : : : 9L8` 5}: : : O9L8` #: Dڥ ݦ 8 fڐ8`橥Ũ櫥ŬՐ` : : : 9 I: O9 W: (۰L8` 9 ݐ` 9 ސ` #:5}G 8橥Ũ櫥Ŭې Dڥԥ `hh8```ţ䥠ş``0.5}=`)HH `HH `#DAL:i 6= -Ŗ ` ;L:) 8 5}; ; ݩ :Lr: =8勅 =##ș#HH `#ɛ5( ) # L<;L; = ذ)򊅌8劅 5}:#ɛRI )8`L;#ɛ(,#ɛ )*%#@$ɛL{; <`ȹ#)ɛ8`Ј#(Ϣ5} #@$L;@$ <ե8̦ϭ@$#A$#ȹ##ɛLW; ;ei` <ɛ#` <^ = < =L<5}ǎiL < <ɛ0` <* ڰ / (۰ < =L7<iL7< <ɛ'` <+ fڰ - `ڰ < =Lr<`@$#5}ɛ,8`ȹ@$ɛȹ@$ɛȹ@$ɛ#ȹ@$ɛօ` < ݦ < `HH`ii@$@$ɛL=` < ސ8` <5} ڰ ݰ` {= O=` {= =`ˢ8I0;I[A8`8Ae@`#ɛȹ#ɛ̄`8` = =5}NJe@`8` >I8`HI` < `##ɛ`##`#`=#> ݢ*> ݢ$> (ۢ*> fڢJ 5}ǘ `0>EEiEi$ ,I&拥`hh$K8` *` . 0> j>5}KٴH0HɛFHL>ɛL> j>ɛ.L> LF$膔rʆШ2F>?F> L>r$ ș$` .`5}ǔʩ $`ʆ`q膔`$$z`z$$ $2%`8&ir`i&r8rLm?&&LL` ?% L?5}Ǎ` ?% >?ƍ`|%K >/ .YF$"oF?vF? * |%KL%襀iť80Hi5} hi 芢8 0Hi hi ` *PF:FFHHG 0E wE hE E hE808 4L. ( BFE5}ǝDKJ V0զK E]LbA)LsA ;$0$L@$ 6 1A报Š𮐬 A棥Ť𝐛 (`5} WAL@ BHI V0"` BHIED V0`hhL0 ` WAFL@ ; 4L@ 5};8eiL~A 22 s2 2 w6LO1 6L. *H"LV@ *GFGHG 0E wE hE E hE C hEşL|@ţşţ륡ŠŤ5}ߥ8埅8壅8埅8壅 2C CBCB h* -Ů ;LOB , -WŭQ ;LwB5}G#i#FG CȄ 8+ e, LJB .D - h*`ƫƬ8`5}ǡ`ƫƥƣLBƮƭƫåţ-şhhL|@8e@률Hh``8e@ɥHh`B5}$CCGL}E *FGGLA#=`ĕ#DAIG 6=IG㥖eʅ@ץeɅ@IG;IH8I#h8;I5}iAș#日 HIH>Iș#h8HI>Iș#LCEG oD斥@日@ -Lh* oD日@斥@ᥗ ELD5}ǥ0눱8$ ;0$LD 68ei ݥ` *GjHG 0E wE hE E hEşţL5}|@ E ,桥Š棥Ťܐ * , -Lh*EiEiɛ` *ɛ`8` &LSEHGHG`G5}CƠ 0E SE`hh *`GڠL}E -Ŗ 8` ;LE`EFG HpG#f〈㉀o5})倆쀛>Lcp,4+++6?}~DIRGOTSAVLOASETWIDLISAbB0111/2A   d5}DJŖD6+\t@>'('&.22DAC347@2~}D1:*.*D1:C T%rrorError%rrorXh0ressakey&iley&ree5} 2ecalc/&&?by2/7/&&/.2/7#/,5-.JGHCS򀀦[$%,%4%0osition#ursor 2%452.#/5}090osition#ursor 2%452.-/6%0osition#ursor 2%452.5pperleftof"lock,owerrightof"lock5pperleftof$est02).45}0osition#ursor 2%452.,)340osition#ursor 2%452.&/2-!4*ustify,$ollar$ .#ommas .$ecplaces.9,2#5})(&ileexists 2eplace9.2350.dHH5IVI ABC40123456789 (2GVCgPanama City, FL FEB%=AB05+AC05}9}!=AB06*AE06@(AA=(AC04/100/365)*AD06>BR_h MAR%=AB06+AC06n!=AB07*AE079} @1XA=(AC04/100/365)*AD07>GVCgInt comp. monthly APR%=AB07+AC07^l!=AB08*AE08rx@0|9}GA=(AC04/100/365)*AD08>Fsð-INT RATE/yr MAY%=AB08+AC08M[!=AB09*AE09ag@1kA=(AC04/100/3659}7)*AD09>GVCgCOL -Find month JUN%=AB09+AC09=K!=AB10*AE10QW@0[A=(AC04/100/365)*AD10>Fs9}&and year of your JUL%=AB10+AC10,:!=AB11*AE11@F@1JA=(AC04/100/365)*AD11>GVCg initial deposit.9} AUG%=AB11+AC11*!=AB12*AE1206@1:A=(AC04/100/365)*AD12>GVCgEdit: add Day, Yr SEP%=AB19}2+AC12 !=AB13*AE13 &@0*rA=(AC04/100/365)*AD13>Fsof init. deposit OCT%=AB13+AC13x!=9} AB14*AE14@1aA=(AC04/100/365)*AD14>GVCgMove right to NOV%=AB14+AC14gu!=AB15*AE15{9}@0QA=(AC04/100/365)*AD15>Fsin same month and DEC%=AB15+AC15We!=AB16*AE16kq@1uA=(AC9}G04/100/365)*AD16>GVCgEnter the Initial JAN, 1998%=AB16+AC16M[!=AB17*AE17ag@1kA=(AC04/100/3659}5)*AD17>GVCgDeposit in your FEB%=AB17+AC17;I!=AB18*AE18OU@(YA=(AC04/100/365)*AD18>Bac9}$count. Be sure MAR%=AB18+AC18*8!=AB19*AE19>D@1HA=(AC04/100/365)*AD19>GVCg shows zeros.9} APR%=AB19+AC19(!=AB20*AE20.4@08A=(AC04/100/365)*AD20>FsCOL :Find month MAY%=AB20+9}AC20 !=AB21*AE21$@1(qA=(AC04/100/365)*AD21>GVCg & year of matur- JUN%=AB21+AC21w!=A9}B22*AE22@0aA=(AC04/100/365)*AD22>Fsity date, Edit to JUL%=AB22+AC22gu!=AB23*AE23{9}@1QA=(AC04/100/365)*AD23>GVCgadd day and year. AUG%=AB23+AC23We!=AB24*AE24kq@1uA=(AC9}?04/100/365)*AD24>GVCgCOL , next to SEP%=AB24+AC24ES!=AB25*AE25Y_@0cA=(AC04/100/365)*AD25>F9}C/smaturity date has OCT%=AB25+AC255C!=AB26*AE26IO@1SA=(AC04/100/365)*AD26>GVCgprojecte9}d balance NOV%=AB26+AC26%3!=AB27*AE279?@0CA=(AC04/100/365)*AD27>Fsat maturity... DEC%9} =AB27+AC27 !=AB28*AE28&,@10A=(AC04/100/365)*AD28>GVCgAFTER HAS JAN, 1999%=AB28+AC29}8!=AB29*AE29!@1%nA=(AC04/100/365)*AD29>GVCgBEEN HIT AT LEAST FEB%=AB29+AC29t!=AB309}*AE30 @(^A=(AC04/100/365)*AD30>B TO RECALC MAR%=AB30+AC30dr!=AB31*AE31x@9}1MA=(AC04/100/365)*AD31>GVCgTHE SPREADSHEET. APR%=AB31+AC31Sa!=AB32*AE32gm@0qA=(AC04/19}(00/365)*AD32>Fs MAY%=AB32+AC32.<!=AB33*AE33BH@1LA=(AC04/100/365)*AD33>GVCgNOTE: If you sa9}ve JUN%=AB33+AC33,!=AB34*AE3428@0<A=(AC04/100/365)*AD34>Fsyour new templateJUL%=A9}B34+AC34!=AB35*AE35"(@1,sA=(AC04/100/365)*AD35>GVCgdo NOT use same AUG%=AB35+AC35y!9} =AB36*AE36@1bA=(AC04/100/365)*AD36>GVCgfile name as the SEP%=AB36+AC36hv!=AB37*AE37|9}@0 NA=(AC04/100/365)*AD37>Fs master file. OCT%=AB37+AC37Tb!=AB38*AE38hn@1rA=(AC04/9}100/365)*AD38>GVCg(_> NOV%=AB38+AC38DR!=AB39*AE39X^@0bA=(AC04/100/365)*AD39>F9}s DEC%=AB39+AC39-!=AB40*AE4039@1=wA=(AC04/100/365)*AD40>GVCg JAN, 2000%=AB40+AC40}9}!=AB41*AE41@1RA=(AC04/100/365)*AD41>GVCg FEB%=AB41+AC41Xf!=AB42*AE42lr@)vA=(A9}-C04/100/365)*AD42>DI1PS MAR%=AB42+AC423A!=AB43*AE43GM@1QA=(AC04/100/365)*AD43>GVCg APR%=A9}B43+AC43!=AB44*AE44"(@0,`A=(AC04/100/365)*AD44>Fs MAY%=AB44+AC44ft!=AB45*AE45z9}@1;A=(AC04/100/365)*AD45>GVCg JUN%=AB45+AC45AO!=AB46*AE46U[@0_A=(AC04/100/365)*AD46>Fs9} JUL%=AB46+AC46*!=AB47*AE4706@1:nA=(AC04/100/365)*AD47>GVCg AUG%=AB47+AC47t!=AB489}C*AE48 @1IA=(AC04/100/365)*AD48>GVCgSEP%=AB48+AC48O]!=AB49*AE49ci@0mA=(AC04/100/39}$65)*AD49>Fs OCT%=AB49+AC49*8!=AB50*AE50>D@1HA=(AC04/100/365)*AD50>GVCg NOV%=AB50+AC509}!=AB51*AE51@0#WA=(AC04/100/365)*AD51>Fs DEC%=AB51+AC51]k!=AB52*AE52qw@1{A9}8=(AC04/100/365)*AD52>GVCg JAN, 2001%=AB52+AC52>L!=AB53*AE53RX@1\A=(AC04/100/365)*AD53>GVCg 9}FEB%=AB53+AC53'!=AB54*AE54-3@(7kA=(AC04/100/365)*AD54>B MAR%=AB54+AC54q!=AB55*AE9}55@1FA=(AC04/100/365)*AD55>GVCg APR%=AB55+AC55LZ!=AB56*AE56`f@0jA=(AC04/100/365)9}!*AD56>Fs MAY%=AB56+AC56'5!=AB57*AE57;A@1EyA=(AC04/100/365)*AD57>GVCg JUN%=AB57+AC57}9}!=AB58*AE58@0 TA=(AC04/100/365)*AD58>Fs JUL%=AB58+AC58Zh!=AB59*AE59nt@1xA=9}/(AC04/100/365)*AD59>GVCg AUG%=AB59+AC595C!=AB60*AE60IO@1SA=(AC04/100/365)*AD60>GVCgSEP%9} =AB60+AC60!=AB61*AE61$*@0.bA=(AC04/100/365)*AD61>Fs OCT%=AB61+AC61hv!=AB62*AE62|9}@1 =A=(AC04/100/365)*AD62>GVCg NOV%=AB62+AC62CQ!=AB63*AE63W]@0aA=(AC04/100/365)*AD63>Fs9} DEC%=AB63+AC63,!=AB64*AE6428@1<]A=(AC04/100/365)*AD64>GVCg@0aA=(AC04/100/365)*AD63>Fs8[    @L%!%} =} LL M[MM-NNpOOPPPPPdQQLRRR\S]SS/TNTmT/U0UUUVVV V!V"V#V$V%V&V'V(V)V*V+V,V-V.V/V0V1V2V3V4V5V6V7V8V9V:V;VV?V MG BANK$ ACCOUNTS!UPDATE :08/09/97BANKS.BC ˠŠ% bu! y=}Int/year!Int/ MonthAcct. #%Balance!Rate!Maturity!TermTypeInterest%365 Days!30 Day %31 =}Day -! -"!&-*!2-6:->B-FN-R%Z-^!d-h !n-sy01%>}A !@Pnone!noneCHKcomp/mon%=AB06*(AC06/100)@pp!=(AC06/100/365*30)*AB06@u9 !=(AC06/100>}C/365*31)*AB06@W02%BR !@`11/01/9818moC/Dcomp/mon%=AB07*(AC07/100)A2!=(AC>}?07/100/365*30)*AB07A !=(AC07/100/365*31)*AB07Ae I_M%U_Y%__c %i_Subtotal%=@S>}gUM(AB06,AB07)Br %=@SUM(AH06,AH07)A2p%=@SUM(AI06,AI07)A!P %=@SUM(AJ06,AJ07)A%bd p=t }=>}==  = = "=& +=/ 8=<% E=I!P=T ![=q ˠŠ% y!>} 03%Ab3!@p!05/03/981 yrC/Dcomp/mon%=AB14*(AC14/100)ASA!=(AC>}?14/100/365*30)*AB14@)!& !=(AC14/100/365*31)*AB14@0cE0J4%PT!Zn%=AB15*(AC15/100)t!=(AC1>}5/100/365*30)*AB153 !=(AC15/100/365*31)*AB159>D0I5%OS!Y]!c!=(AC16/100/365*30)*AB1>}6" !=(AC16/100/365*31)*AB16(-3086%>B!HL!Rm!=(AC17/100/365*30)*AB17s !=(AC17> }/100/365*31)*AB17 &_*%2_6%<_@ %F_Subtotal%=@SUM(AB14,AB17)Ab3%=@SUM(AH14,A> }DH17)ASA%=@SUM(AI14,AI17)@)!& %=@SUM(AJ14,AJ17)@0c M=Q \=` f=j s=w |=> } =  =% "=&!-=1 !8=< !C=Y ˠŠ% at! x > };In %t/Quart er90 day %91 day !92 day!A-E !K-O !U-Z b07%A U!@%"no> }ne!noneSAVcmp/quar%=AB25*(AC25/100)@!HP!=(AC25/100/365*90)*AB25@)BF !=(AC25/100/365*91)*AB25@5wI !>}#=(AC25/100/365*92)*AB25@AeQ ,=0 ;=? E=I R=V [=_ d=h q=u% }=>}=! = != !"='% 1_5% >_-=AB09+AB19+24B4DS!)=AH0>}9+AH19+AH25AW#U`55>_-=AB09+AB19+24B4DS!)=AH0<5    @BL!O!!} B} LLLMdN'OOPnQ/RR$SgSSSS`TT7UUU+VsVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVB}CqVVVGCREDIT CARD SUMMARY D:CREDIT.BCUpdated : 08/04/97! ! !w!B}H!!     L  B} ! !  !!!    B}<    @0A E0F J0K O0m!=@SUM(AD05,AM05)A5V!sw!}B}!@"!!"!(6 !AD !<@ !FJ !PT !Z!=AC05-AN05A5V B} 1 1 1 1,!=@SUM(AD06,AM06)26!<@!FJ!PT!Z^!dh!nr !x !B} ! ! !#1!=AC06-AN067r  2 222 222 222 2!=@SUM(AD07,AM07)@v!B}! !@!!%!+/!59 !?C !IM !SW !]a !gw!=AC07-AN07@{B}  3 333 3 %39!=@SUM(AD08,AM08)?C!IM!SW!]a!gk!qu!{ !B} ! ! !&* !0>!=AC08-AN08D 444 444 444 4 444!=@SUM(AD09,AM09)B} !!!$(!.2!8<!BF !LP !VZ !`d !jn !t!=AC09B}-AN09 - 555 555 555 5 15E!=@SUM(AD10,AM10)KO!UY!_c!im!sw!}B}!  ! !" !(, !26 !<J!=AC10-AN10PU _cw!__B }_ *=@SUM(AC05,AC10)ATV)=@SUM(AC05,AC10)ATV  En ter amou nt paid and Reca B!}mlculate.  Enter    New Bala !nce into  column sy}B"}\     as Pr !evious B alance. `0a e0f j0k o0 1-B#}J! 813-886-5 000 Then zer !o intere st and N1O S1T X1Y ]1 1-! 800-VISA- 91B$}1 items #1 !-7, incl uded in  2 222 222 222 2 1-! 800-344-4 355 current !stB%}C(atemen t.  3 333 -3. 33 1-! 713-666-1 050 444 444 444 4 444 B&}&A1-! 918-661-5 000 555 555 555 5 E5l 1-! 800-CARD- FAX vB'}! " +/ 33]lD- FAX v@] o=o=o=o=o= ) /BCALC7 LAnalog Computing #63T Th_ BCALC is a spreF)}adsheet using 8K of memory and approximately 24K for data. It comprises a 64 x 64 grid, columns AA to CL and rows 01F*} to 64 Three types of data can be entered in a cell: TEXT: anything not beginning with a number (0-9) or (=) or (-F+}). permits numbers to be entered as "forced text". NUMBERS: a number that begins with 0-9 or (-) or F,}(.) Do not type commas, they can be displayed using formatting commands. FUNCTIONS: (formulas) arithmetic or algebF-}raic expressions starting with (=). Five functions are: (^) (*) (/) (+) (-). CONSOLE KEYS: START: used to abort aF.}ny input in any mode. OPTION: displays status screen: Filename, free bytes, recalculation status and mode. SELF/}ECT: enters command mode (text window changes to gray). DIR n - disk directory for Dn:. WID ccnn - Width of columF0}n "cc" to "nn". Width must be greater than 01 but less than 32. i.e. WID AC04 sets column AC to 4 characters wide. SAVF1} Dn:filespec - SAVes the sheet to disk. LOA Dn:filespec - LOAds previously saved sheet. LIS Dn:filespec - LISts spF2}readsheet to disk in Ascii format for use with word processor. Use cursor to define block to be listed to disk. Do not F3}attempt to LOAd a listed format file. GOT ccrr - GOTo cell "cc" column and "rr" row. Range must be from AA-CB anF4}d 01-47. (puts cursor on top/left of screen, thus row 47 would put row 64 on bottom of screen). SET ccrr - sets "cc" coF5}lumn and "rr" row references to be displayed on bottom of text window. You can have a "heading" row displayed on bottoF6}m, corresponding to the column your cursor is located in. CONTROL KEYS: Control Arrows for cursor movement andF7}G used in lieu of [RETURN]. i.e. You enter data in AA01 and want to move to AA02, hit Ctrl-* (right arrow) and tF8}8he data is entered in AA01 and cursor moves right to AA02. Ctrl-H home to cell AA01. Ctrl-D deletes blocF9}k of cells (prompted). Ctrl-C copies block of cells. (Formula cells unchanged) Ctrl-M moves block of F:} cells. (Formula cells adjusted) Ctrl-T text is forced when entering numeric or "=" data in cells. Ctrl-G global F;} format of column cursor is positioned in: L,C,R justification Left, Center, Right. D dollar ($) sign toggled. F<} J commas on/off. 0,9 number of decimal places displayed to right of decimal point. ESC makes choice fiF=}nal and exits. Ctrl-F format individual cell. Escape reformats cell and exits. Ctrl-E edit current cell. CtF>}rl-P prints spreadsheet. (prompts for upper-left/lower-right cells) Ctrl-O recalculation mode on/off. Use it in ofF?}f mode when entering data or it will recalculate after every entry and slow things down. Ctrl-R recalculation ordeF@}r changed from rows to! (columns, and vice-versa. Ctrl-A All cells recalculated now. Ctrl-K Kill (erase) cFA}urrent cell. [Caps] toggles upper/lower case. Both recognized in formulas. FUNCTIONS must be typed in format uFB}sing (@) symbol, followed by function, followed by parenthesis. (=) is used to make function entries in a cell. eFC}.g. =@ABS(AF12)+@SUM(AC03,AC08) SQU - squaring SQR - square root ABS - absolute value (- becomes +) RND - round vaFD}lue (closest integer) EXP - exponentation base 10 LOG - logarithm base 10 INT - greatest integer Following require 2 FE} cell entries separated by comma: @CNT(AA01,AA22) - counts number of cells in a block that have entries (number, tFF}ext or formula). @SUM(AC03,AC12) - adds the entries in a block. @AVE(AE12,AG12) - find the average of all entrieFG}6s in a block. exits BCALC to DOS. C o=o=o=o=o=(AE12,AG12) - find the average of all entrieDN ?o=o=o=o=o= BANK ACCOUNT SUMMARY FOR BCALC I By Frank Walters BANKS.BC is a template fileJI}G for BCALC spreadsheet. BCALC, by Barry Kolbe and Bryan Schappel, was published in ANALOG magazine, issue 63, AJJ}J3ugust 1988. PURPOSE OF BANKS.BC: Summarizes7 Vall your banking accounts,[ dincludingi savings, checking JK} and certificates of deposit, etc. You update the balances each month and it computes your projected intereJL}st for the next month and adds all your balances and projected annual interest income. Keep track of your money! SETJM}UP: Load BCALC.COM into any Atari 8-bit computer with BASIC disabled. Minimum of 48k required. From BCALC, presJN}s any key and then SELECT, which allows commands from the text window. Type LOAD D:BANKS.BC and press Return JO}to load the file from drive 1. AA01 includes printer codes to set Elite pitch [ESC+M] and double strike [ESC+GJP}] for Epson compatible printers. Edit these to set 96 columns for your printer, since the spreadsheet is too wiJQ}de for 80 columns. Edit AC01 to reflect the current date of update. AA02 has the filename. The tempJR}late has space for three different banks in rows 03, 12 and 22. It includes a place for phone numbers too. Since JS}the name and phone number covers a sequence of 4-cells (AA-AD) you have to be careful not to exceed the widthJT} of each cell. It is easiest to use inverse and CTRL-E to edit a cell at a time. Use CTRL-T to force "text" mode JU}if a number or (-) or (=) is the first character of a text entry. Enter your bank account numbers in column JV} AA for each bank and the current balance in column AB. AC is for the interest rate (not APY). Use text entries JW}ifor AD (maturity date or none), AE (Term), Type (CHK, C/D, SAV, etc.) Type interest in AF (compoundedm monthly, quartJX}erly, none, etc.) See the sample entries for examples of how to do this. Then type over them or CTRL-K the sample blocJY}(k entirely if not used by you. This, 2should6 >completeB your customization of the form since the remaining cellJZ}s are formulas which do !not% ,require0 customizing (normally). USING BANKS.BC: Once each month, after recJ[}Geiving your statement of current balances and interest paid, load BANKS.BC into BCALC and update the date in AC0J\}\1. Compare your interest received with monthly interest projections in columns AI, AJ and AK. Pick the column that fJ]}its the number of days in the interest period. You can estimate the interest difference for February or temporarily J^}edit one of the formulas, changing 30 to 28 temporarily to see what the actual amount is. Banks do make mistaJ_}E_ekes, you know. I've caught several banks making errors in their favor which I had correctedl qafterx spottJ`}ing descrepancies on my computer. Imagine my great satisfaction the first time I called my bank and talkedJa} to a human, saying, "My computer found out that your computer made a mistake." Finally, update the bJb}alances in column AB. CTRL-A twice to recalculate the spreadsheet and it will update your balances andJc} projected interest rates for the next interest period. Press SELECT and type SAVE D:BANKS.BC to save yourJd} updated form to your working disk. DO NOT SAVE OVER THE ORIGINAL TEMPLATE. It is your backup copy. PRINTING YOURJe} BANK SUMMARY: Set up printer and place cursor on cell AA01. CTRL-P prompts to press Return at upper-left cell of bJf}lock. Press Return and move cursor to lower-right cell (AK29 or 30) and press Return again to print your formJg}. COMMENTS: Feel free to modify any portions of this template to make it more useful to you. Formulas caJh}n be viewed by placing cursor on cell which shows "formula" in status line at top of screen. CTRL-E will dispJi}[lay actual formula in text window at bottom of screen. Frank Walters 08/10/97 i o=o=o=o=o=ill dispHt o=o=o=o=o=  ?CREDIT CARD SUMMARY FOR BCALC I By Frank Walters CREDIT.BC is a template fileNk} for BCALC spreadsheet. BCALC, by Barry Kolbe and Bryan Schappel, was published in ANALOG magazine, issue 63, ANl}ugust 1988. PURPOSE OF CREDIT.BC: Used to summarize all your credit card information in one document. It provides Nm} useful information about current balances and phone numbers to report lost or stolen cards. When a statement is reNn}ceived, you can compare it to the data printed from this template. After entering any current interest charges aNo} new balance is computed. Recent charges not yet billed will also appear in this summary. When you decide the amouNp}Gnt to pay, you enter it in the "Paid" column and it computes the remaining balance for you. You may find other usefNq}qul features. DESCRIPTION: A full printout of this template requires the printer to be in condensed pitch. Nr}I have included the printer codes for Epson compatibles in cell AA01. You can change them for other type printers. Ns} AB02 displays filename. AB03 has the last date of entry, which you should update each time you add informationNt} and save to disk. The remainder of column AA and AB contains credit card name and number. Below the mNu}ain plate this information !is% -repeated1 Afor informationE only and includes expiration date and phone numbersNv} to report lost or stolen cards. Column AC of the main template lists the current balances of all your cards.Nw} It is the SUM of all cells from AD through AM, Previous Balance to item #8. AD shows previous balances of Nx}cards where you did not pay the full amount due. AE is to enter interest or fees due, entered after you receive yoNy}ur credit card statement. It! will update your current balance. AF-AM are individual entries for charges mNz}ade thoughout the month. AF-AI are formatted for charges under $100.00, AJ-AL accept up to 999.99 and AM is for N{}big items under $10,000.00. Larger cells will accept any entries under the maximum limit, even one cent. AN is whereN|} you enter amount paid each month. After recalc, it is subtracted from AC, Current Balance and remainder is displN}}ayed in AO, New Balance. AC13 shows total of all card balances and it is repeated in AB13 so it is displayeN~}d on 40 column screen with cursor in column AA. CUSTOMIZING TEMPLATE: Edit column AA to show names of all yourN} credit cards instead of the sample ones. Enter numbers in column AB. Do this in both blocks 05-10 and 17-22, which are duN}plicates. You can use CTRL-C, the copy command, to copy a block from AA05-AB10 to AA17, if you prefer. Finish witN}h the expiration dates and phone numbers in the lower section. Save to disk with SELECT and type D:FILENAME. DO NOTN}CF SAVE OVER ORIGINAL CREDIT.BC TEMPLATE. That is your backup copy.J USING BANKS.BC: Column AC, Current Balance,N} is a formula. Do not enter numbers in this column. Enter zeros in those cells from AD to AM that have sample entrN}ies. Using your unpaid credit card receipts, enter the amount of each one in the appropriate row of colN}umns AF through AM. Amounts over $99 should be entered in AJ-AM. Use CTRL-A twice to recalculate all cells. ThN}Aat should reflect current balances except for any unpaidE balances from previous statements. If you havN}e these amounts, enter them in column AD and recalc twice. Save your credit card receipts and update your templateN} periodically with new charges. When receiving your next statement, it is time to make use of CREDIT.BC for real. N}Ǜ RECORDING PAYMENTS IN CREDIT.BC: First enter any interest or fees in column AE (Int). If you have both interest N}and fees, use AE for interest and any other empty cell from AF-AM for the fees. It doesn't matter since they aN}re all added together to make up the Current Balance. Recalculate twice and compare Current Balance with balaN}nce on statement. Now the balance in your spreadsheet should equal the balance on your statement, except for oN}utstanding recent charges that have not yet been billed to you. Your spreadsheet shows your actual debt, in this casN}e. The charges will show up next month. Enter amount of payment in column AN (Amount Paid) and recalculate twiceN}. Column AO reflects your new balance, after payment. Since AO includes the remainder of Current Balance, it thN}erefore includes all items from AD through AM. Cursor to column AD and enter the amount from AO, in Previous Balance.N}Ǜ Then cursor right to enter zeros in AE (Int) and all items from AF-AM, since they are already included in the New N} Balance. Finally, enter a zero in AN, Amount Paid. Recalc twice to see updated Current Balance. It shouN}ld include the unpaid amount after a partial payment plus any recent un-billed credit card charges. Edit theN}G date in AB03. Save changes to your working disk. PRINTING YOUR CREDIT CARD DATA: Remember to edit the printN}er codes in cell AA01 for condensed pitch if your printer does not use Epson codes. CTRL-H homes cursor toN} AA01. CTRL-P for print command. Return to enter upper-left cell of block. Cursor to lower-right cell of block anN}d press Return to print. If you want the entire template, including the information and phone numbers in the lowN}er section, use cell AO22 for the lower-right block. If you just want the recent update, use cell AO12 as lower-right. N}D I hope you may find this BCALC template useful. Try it out.i jw o=o=o=N}Do=o= hope you may find this BCALC template useful. Try it out.i jw o=o=o=L o=o=o=o=o=  =COMPOUND INTEREST FOR BCALC G By Frank Walters INTEREST.BC is a template file fR}or BCALC spreadsheet. BCALC, by Barry Kolbe and Bryan Schappel, was published in ANALOG magazine, issue 63, AugR}ust 1988. PURPOSE OF INTEREST.BC: Used to compute monthly interest and balances for any bank account using fR}ixed interest, compounded monthly. It is not suitable for variable interest rate investments as the rates areR} unpredictable. INTEREST.BC covers a five year span and requires only a few, simple entries to produce a printoR}ut of your future investment prospects, month by month. Note that it uses all 64 available lines in BCALC, so moreR} than 5 years is not practical at one time. For longer terms you could print 4 years at a time, load a fresh template aR}nd update the years and leap year days and use the ending balance of the 4th year as the starting balance of the 5thR} year. SETUP: Load BCALC.COM into any Atari 8-bit computer with BASIC disabled. Minimum of 48k required. FromR} BCALC, press any key and then SELECT, which allows commands from the text window. Type LOAD D:INTEREST.BC and prR}_ess Return to load the file from drive 1. AA01 shows the filename of the template.c AA02,AB02 display a wR}Graparound of the Balance that would appear on JAN, following AA64-AB64, completing a full 5 year cycle. AA05-AA64 laR}bel 60 months in 5 years. AB05-AB64 show computed balances for each month. Column AC has interest earned duringR} the month labeled on the same line. AD is the number of days per month. AE is the result of a formula that computesR} interest rate for that month, based on number of days and annual rate in AC04. =(AC04/100/365)*ADxx) AC04/100 R}converts annual percent to decimal, which is divided by 365 days to convert it to 1-day's interest. *ADxx multiplR}ies number of days in row xx to compute interest rate for the specific month on that row. It is unnecessary to print roR}sws AE and AF, which is on-screen help. ENTERING YOUR DATA: Refer to your bank statement or CD certificatew yto} R}determine the starting date, Principal and actual interest rate. DO NOT USE ANNUAL PERCENTAGE YIELD (APY) RATE. R} Cell AC04 is where you enter your interest rate. Then scan cells AA05 thru AA16 to find the starting month of your inR}vestment. Edit AA cell to add day, year to that month. Move right to AB cell of same line and type amount of PrincipR}>al in the 0.00 cell, replacing a formula in that cell: E GAAS AB 09>MAY 1, 1997 5,200.75 DO NR}OT USE COMMA during entry, it will be added automatically by the program. Because you replaced a formula in columR}n AB, you cannot re-use this same template for more than one account. After printing, you must re-load INTEREST.R}BC from disk to enter a new Principal and interest rate. Move cursor down column AA until you reach the year andR} month of your maturity date. Edit date, adding day, year of your maturity date. This will mark your Balance R} at maturity in column AB. That's all your entries: two text and two numeric entires and you are ready to calculR}ate and print. RECALCULATE--CONTROL-A: You must now recalculate a minimum of three times to insure all formR}ulas are correctly applied in the proper sequence. Use CTRL-A each time. Screen will flicker and re-draw as eaR}Gch recalculation is completed. Your cursor will return to cell AA01. Move cursor down to date of maturity R} and you will see your balance at that date. Each line shows the balance and interest earned during that mR}onth, which will be added to the balance to compute the next month's balance. All balances and interest prior to yoR}ur starting month should be 0.00. Balances below your maturity date are projected amounts, based on the same interestR} rates. PRINTING YOUR RESULT: The entire spreadsheet will fit on one 80 column printer page but that is unnecessarR}y. To selectively print the entire term of your investment, place cursor on cell AAnn (nn=line number of date of PrinciR}pal.) Home cursor to AA01 and Press CTRL-P. Press Return to mark upper/ left of block of cells to print. CuR}rsor down to line number (xx) containing your maturity date and cursor right to cell ADxx on that line and R}press Return. Printer should be turned on and ready to print. That's all there is to it. CHANGING YEAR DATES IN 19R}98: Once you print each of your savings, checking, or CD accounts, there is no need to use this tempR}late for them again unless you lose the printout. But for future deposits you may have to update the years in columR}n AA at the beginning of 1998, 1999, etc. Simply edit each cell in AA that contains a year and change them to theR} next higher year. Year 2000 is a leap year with 29 days in FEB. Be sure to change the 28 to 29 in FEB of the new R}year 2000, and also change the 29 to 28 in FEB of the new year 2001. The days are in column AD, across from R}the name of the appropriate month. Then re-save the updated template to disk. Be sure you edit the original templateR}Ǜ and not one you have already entered dollars and interest rate. After saving the zeroed template then you can enteR}r new balance and interest rate, etc. BANK INTEREST DOES NOT AGREE: A very few banks use a dubious practice oR}f not paying interest on day of deposit but instead pay interest on day of maturity. That results in the fR}Girst month's interest being 1 day less than the number of days in that month. Subsequent months will compR}ute interest based on the correct number of days but your balance on the second month would start out too small.R} To adjust for this sneaky practice you can subtract 1 day from the days of the month you opened the account in cell R}AD and add 1 day to cell AD in the month PRIOR to your month of maturity. This interest will be added to the priorR} month's balance to create the maturity month's balance. OR--you could go down to your bank and complain to theR}G manager that you are being cheated out of one day's interest, compounded over the term of your account. That's whatP}EE