/Rɢ*lmJm:n; L    ɢߢ@BC  A    ɢ `BiCil DE BH V`LzR `ii`HH hh`  Ѝэ  0ii  `H  Щѩ̢0h %0 `` ͢ fC` !  0  ԩբ  `HH ؠ0 ) hh` Y ͢R A̠    )?ԩ ̥)? иʆ͊`@ `?L͢L͢>L͢dL͢L͢L͢ȠL͢L͢L͢/L͢ ͢L 廉̠ ͢  ͢ fRX` L͢ ?L͢aL͢ L͢ ! ͢ L <өҍ2`^| ͢  խ L R a0 m ͢ ͢` `΅Ϣ e΅Υi8΍츅ԩύթ` `` γL᥽׳   ͢ ͢ ` 廉ˎ  L [y ͢ r f)?LǪ ̢ ´  LV ͢ y r f1L2D3D4L5L6L7L8LL9LoL  L  > }0& Ԥ    ĤL JmɢL  0 ! ޮ ԤLJmɢL L60 PЩѢiХi L/̆ͭ Ј0 i̝ͭ  m i  ͢ЩѦͽ P % ĤX͝L P a0L ͢  ` >ɛȄ >ɛ 囹` y ԤE̩ЩѩP %02 P a Ĥ L $   ͢`  0  Zʎ LR  ԤV  L R ͢ f)?H Йh̽ ЩѩR % ĤL#L ͢h03 Ԥ  ͢Щѭ̩P %0 L  ޮ ԤRʆ ` Ĥܢ L/L BJKZDE VH hɀ ĤГ BDEJIIH V0 0L BLV Ʈ Ԥ  L s ͢ f)? ]   P iݩP a ĤL ЩiХi` L ?  >̙ɛL ͢Р ͢ ͢ ͢= ͢ ͮv ͢ ͢ $︭A]COPY= e0)ԍՍ, e0ԍՍ 5I ͢ Lx Ю8ʎ 9 ͢ ZL X ͢ } ͢ $80 `1 L ͢ խ踅 ` Ʈ Ԥ< 0/ ܵ 0 ׸  VR ƭ ĤL   Ԯ Ԥ 0ע  V踍P ƭ Ĥз:  թ L L  ͢  ԭ ͢ L ̭   05ii   ` ``Э) Դ  ԭ  L譩խ L ذ" ٰծL`ԮL`ܭТŠL۠͢L͢ L͢ .L͢ P@ Y`S S0 )鸩` H踍 h-鸩LeЮ`? ͢` ' ͢ fS!D"ʢu ͢ ԤL ʍA ͢ SA"& Ӡ ͢L A 0A ) ͢L ͢ ĤLoL``PRESS 'S' FOR SINGLE DENSITY FORMAT, OR 'D' FOR DOUBLE DENSITY FORMAT.INSERT DISK TO BE FORMATTED. FORMATTING... FORMAT COMPLETED. UNABLE TO FORMAT DISK.DRIVE DOES NOT SUPPORT DOUBLE DENSITY. INSERT BLANK FORMATTED DISK.PRESS 'R' WHEN READY OR 'X' TO EXIT. O.K. RE-INSERT ɭ DISK.INSERT BOOTABLE DISK TO COPY FROM. ENTER PROGRAM NAME (MAX. 20 CHARS.) *** PRESS 'C' TO CONTINUE. ***PRESS 'R' TO RETRY OR 'X' TO EXIT. KSID ETTESSAC -:REBMUN RORREDISK BOOT ERROR.1 Create new MULTI-BOOT master.2 Load new bootable prog. from disk.3 Load new bootable prog. from cass.4 Create new bootable disk.5 Create new bootable cassette.6 Transfer prog. to second MULTI-BOOT.7 Rename a MULTI-BOOT program.8 Sector by sector disk copy.9 Format disk. ԠΛ NO ENTRIES ON DISK YET. UTILITY OPTIONS.} ɭԠӠ} ɭԠELGNIS }ELBUOD } DENSITY * SECTORS FREE:- ***** RUNESOFT *****RAM WILL OVER-WRITE MULTI-BOOT.DOUBLE DENSITY DISK REQUIRED.SORRY! TEN PROGRAMS MAXIMUM.SORRY! INSUFFICIENT SPACE ON DISK. EB DLUOW DERIUQER SROTCES - EMAN GNIDAOL  ... ROTCES DABINSERT CASSETTE & PRESS PLAY + RECORD.PRESS R WHEN READY OR BREAK TO EXIT.INSERT DESTINATION ɭ DISK. Ԡ͠ϠҮ Ԡ͠ϠŮ O.K. PROGRAM IS NOW IN MEMORY.MAKE SURE SOURCE ɭ IN DRIVE 1. KCOLB GNIDAOL .K.O KCOLB GNIVAS .K.O = DEIPOC SROTCES  O.K. SECTOR COPY COMPLETED. - RETNE INVALID ENTRY!C: . . . EMAN DLO THIS IS NOT A ɭ DISK. PLEASE INSERT CORRECT DISKThis utility will copy specifiedsectors from source to destinationdisk.You may specify start and finishsectors or enter 'A' to copy entiredisk.You will be prompted to put in correct disk.ENTER START AND FINISH SECTORS (S,F)OR 'A' TO COPY ENTIRE DISK (1,720/1040) INSERT DISK. ŠԠҠŠˮ INSERT DISK. O.K. SAVING PROGRAM TO DISK.SOURCE DISK MUST BE IN DRIVE 1DESTINATION DISK MAY BE IN DRIVE 1-8ENTER DESTINATION DRIVE NO.INSERT DISK IN DRIVE 1 EVIRD NI KSID DNA KCOLB GNIYPOCS(ʔFooolo2nO/FEASIBILITY EXPERIMEWIZARD OF ARKYZ TEN LITTLE INDIANS PERSEUS ADVENTURE WAXWORKS q2C#LUCIFERS REALM BIRTH OF PHOENIX ADVENTURELAND PIRATE ADVENTURE MISSION IMPOSSIBLE VOODOO CASTLE qU`<ө  `HIT RETURN TO START !"$$%$'(*&-/12 "##%&&()*01 %&$'&****)2.1-#   4$"#%&+'21,V8iCge:BD9!\zzzzzzzzzLOOKKILLCLIMBREADTALKOPENUNLOCKEAT MOVE DIG DRINK TASTE JUMPPUSHTHROWTURNSMELLLISTENSAVE GAMEQUITLOAD GAM iDEBJK V BlDEGHI V B V  iDEBJK V B V`S: LUCIFER'S REALM  Ϯ by med systemsHH` o` o z T u 8 BlDEJK VL  BٝDEHI V B Vҍ2LC:`HH h oTUh`  o ܩ``ة̩T U  o u`T uTl U̠  L ` o o  ol 4 L l l l `HH̠ uhh̩l `T uTl U $ o o l o 4 L L ``8`    o`8`m )! o hh! " ! `LL LLy  ` oy hhy LLH} h`H}  T u TU u   m h` ک%  `APPEARS ORDINARY.. H"  ̠ũT u" Th u oL̍H I H ̭I  o ө``H h`ʽNSE W hhh z L h8`` J ` N SE$(ͩάL ^ͩͩʅͩhh5HhhhLi ` hh L o o ̱ o ohh ϭˈ̢hh Ь ` hh A hh. o o L ̱ o ohhL ˈ̩  ˝hh  ` Ω  ` o ޭ  hh @i hh 3`Hh` 1"   L Ln Hҍҍ C ɐҍҍh`0m`ҭҭ`` `)ߝ` T` U Hɛ h`h~ҩ  UUL> а `!H H`  8 " ;  c 6 LIRON CLUBGOLD CROWNCRYSTAL BARLONG CHAINOILCANDAGGERGOLD SWORDLONG ROPE HUMAN SKULL BRASS LAMP GOLD DISK SUNGLASSES WAX BALLOLD COINS (; %&&",')L  *L  ά,˩+-S0K  1=5L)" ./+ 2L L  3L  4 5пLLí𦭢L0  L / 8 6LL_ 9к7бOL Й 4/;j. ɪLL :0  ܩ8; ȩ Q;L HK J  b[Iк L^ɪ; =X "L{L>6<+L @?L AL Ω L IB C D l;б \ &;PO L <L LJOLn L>ML L  E NQ Q_Qɩ ũ [ L) Ш~ w [ E Њ RL TLSPCɪ 7 X0}  ά LL TL UVW X̭_ Yк ]ЫZЧ [Ln  L x\gL x L L' ^?) _# `L&  L  [ _aL  Bӭbȩ ѩ [ x ЫпиLcLn ePdL(L  [  aZLQ fL ghL=! jLn iлL kЭTL M [ lln mn oE  άp!  q srL |L L J uLn LG 'eл wШtП  [ xgL L+ e1y!zЫ zL  쭺L|ũz L]L}a ~PLA_ X [ 8  nɪ:  L L L  \ɩT L vLn   L  LL ' ԩcLn ЬФ L A9 j  &; C !L 2 + $ ;ɪ L ̠ L  "+ީ3L ZЊ`8``43 ,L" +  2L L - E7 ©  [  Ч МД Ђ.LL /c X֍JB:и Ln 0L+  /L L 4L"    L  ۩а  3L׭ Щ  6L /  ГL оyҩҩҩҍҍҩ}   ҩٍҩҩҍҍ  ` `} N莬  L7YOU'VE WON ҧӠ͛BY JYYM PEARSONGETLOPTRNLOLDGPLLCHCLMDRNOPGREELODOR LORMN HLDNSE HITLR JONARY LUCFGE LOBLOO THWSKL TIERPEBRETVPLOOGRDOILHNGRMVGLSCLMCHNHOOCHECHMNDEECLLOHTLRTHRWCHCUTCNVHOOCHNINSRTSWSWDSLITSITDWNSITPW BRSLT CUTSCK"LOTEE%LOTEE'LOTEE(LOTEE)LOTEE+LOWLL-GIVCON.KNOCK/GVCRN2LCFGE4COFESSIRCLBCROWNCRYBARLGCHANOILCNDGGERSWORDLGRPESKULLLAMPDISKGLASSSWAXBALCOINSPITWATROBJCTBLLB ROCK OFFR CHST GENMN CLFF ARMIVAPRWLLIMGESLGHTPLLRSPDRSCNVSVENTSTNESNKECRPSALTR DOO CRPS+OPENG-OLDMN.DOOIN A HOSPITAL BEDVERY CLOSE TO DEATHIN FRONT OF A PODIUMAMIDST GLOWING CLOUDSON A LEDGEABOVE A FIERY PITIN A SMALL PINK TILED ROOMIN A MUDDY CAVETWO DOORS ARE HEREA HOLE IS ABOVEIN A TUNNELIN A TUNNELIN A TUNNEL IN A CAVERNSTREWN WITH HUMAN REMAINS IN A DAMP MISTYCAVERN IN A DARK BLOOD SOAKED PIT IN A CLAY ROOMA HUGE DOOR IS E ON TOP OF A HARD ROCKY CLIFFUNDER A BLOOD RED SKYUNDER AN OVERHANGIN AN OPEN CAVEIN A TRANCEAT A MARBLE DOORA ROPE HANGS TO THE NIN A LARGE SMELLY CAVERNIN A DARK CAVEFALLING..IN A SMALL STEEL ROOMIN A STEEL WALLED ROOMIN A PLUSH OFFICEFULL OF SWASTIKASHITLER'S HERE!SLIDING DOWN A CHUTESTANDING ON A TALL ROUNDPILLAR,IN A VAST ROOMIN A SMALL VENT DUCTIN A VENT DUCTIN A BRIGHT CRYSTAL ROOMA HOLE IS NIN A BLACK VOLCANIC PITSTEPS LEAD EIN A FIRE CHARRED ROOMWITH PINK TILE WALLSAN IRON DOOR IS SIN A HUGE CHURCHTHE PEWS ARE FULLOF SEATED DEMONSIN A CELLARFULL OF BURNED CORPSES IN A CELLARFULL OF CORPSES!AT THE EDGE OF A BLACKFOREST"IN A FOREST#IN A FOREST$IN A FORESTWITH GREEN TREES%IN A FOREST&IN A FOREST'IN A FOREST(IN A FOREST)IN A FOREST*IN A FOREST+IN THE S OF A FORESTAT A STONE WALL,AT THE S OF A WALLWITH AN OPENING-AT A RED GLASS STAIRWAY.AT THE HUGE DOOROF A PALACEHIGH ON A MOUNTAIN/IN A PALACIAL WAITING ROOM0IN SATAN'S CHAMBERHE SITS ON A GOLD THRONE1AT THE START OF THE GAME2NEXT TO ACLIFF,A STONE DOOR IS S3IN A TINY CAVERN4IN A MEADOWA WHITE-ROBED FIGURESITS AMONG GRAZING SHEEP``ɯϠ``NOT NOWYOU ARE````CAN'T GO THAT WAYDROPIT'S NOT HEREYOU CAN'T SEE IT WELLO.K.GETONLY SIX ITEMSIT'S NOT A VISIBLE ITEMYOU CAN'TLOOKNOT NOWI DON'T UNDERSTANDI SEE NOTHING SPECIALYOU'RE TOO KINDYOU'LL FALLIMPOSSIBLETO WHOM?YOU CAN'TWITH WHAT?O.K..UGGH!IT WON'T BUDGENO WAYYOU DRINK TOO MUCHYEECHTOO DANGEROUSOOMPH..SO WHAT?IT BOUNCES BACK AND ȠYOU CAN'T.PHEWW.!YOU HEAR SCREAMSTUBES RUN FROM YOUR BODYA DOCTOR IS TALKING TO A NURSEHE SAYS,he's dying..YOUR LIFE PASSES INVIEW AS YOU DIE..A BEARDED MAN ISAT THE PODIUMHE SAYS,Judgement is at handThe record of your lifeis in my bookHE SAYS,Your life was fullof evil,the path for you is clearA HORRID VOICE SAYS..Welcome to MY realmTHEY SPELL A WORDTHE FLAMES ARE TOO BRIGHTTHE WORD IS,LucifageA CRACK IS IN ITYOU LAND BACK ON THE LEDGETHE CRACK WIDENSTHE ROOM IS HALF FULLOF WATER,A CRACK IS ABOVEYOU FELL THRU A DRAINA CRACK LEADS UP,A DRAIN DOWNSOME TILES HAVE FALLENA VALVE HANDLE IS HEREONE IS RED,THE OTHER GREENA BILLBOARD IS HEREOne of my subjects..A.Hitlerhas formed an army to attemptmy overthrowTHERE'S MORE TO READAnyone bringing me the proofwill be freed from Hellsigned...LORD SATANA DOOR IS NSOMETHING'S HEREAN S.S.OFFICERBLOCKS A STAIRWAY EHE SAYS,Who do you want to see?HE STOPS YOUHE ASKS,Why?HE SAYS,o.k..go in andtell them I sent youSTEPS ARE EIT'S TOO DARKAN OLD CHEST IS HEREIT READS,The WORD is the key THE ROOM IS FULL OF DECAYING FLESHIT SMELL'S TOO BAD!A HORRID ODOR COMESFROM BENEATH A ROCKA HUGE ROCK IS HEREA GENTLEMAN IS HEREWITH A PISTOLHE SAYS,No man may passby SATANS ordersHE STRANGLES YOUWITH A ROPE,YOU BARELY ESCAPEMR. BOOTHSHOT YOU IN THE HEAD! THE SKULL FALLS BELOWYOU HEAR IT BREAKTWO ARMIES ARE FAR SA ROPE HANGS DOWNA STRANGE BRICK WELL IS HERESTRANGE IMAGES SWIRL AROUND YOUA VOICE BOOMS,If freedom bethy quest,the crown is proof!My enemy needs the magic powersof the statue of Deecula,But it is incompleteWhen Deecula is restoredthe crystal seals his fateA VOICE FROM FAR BELOWSAYS..Beelzebub has spoken!A GUARD BLOCKS THE DOORHE SAYS,My name is Reverend Jim,I see sin in youyou shan't pass!JIM POURS POISONDOWN YOUR THROAT!HE DROPS SOMETHINGHE SAYS,HE will want thedisk,go in.THERE ARE THOUSANDS OF SLEEPING BATSAN ANCIENT DOOR IS ETHE HINGES CREAKEDAWAKING THE BATSTHEY DROVE YOU OUTFLYING BATS DROVE YOU OUTTHE LAMP FELL FROM YOUROILY HANDSA CHAIN HANGS FROM ABOVEYOU DIED!A HOLE IN THE FLOORHAS A HOOK ON ITA CHAIN ON A HOOKHANGS DOWNA DOOR IS MARKED,PrivateARMED GUARDS ARE HEREA GUARD SAYS,Who sent you?HE SAYS,What business have youwith Hitler?YOU ARE RUSHED INSIDEYOU WERE KILLED BY NAZISA PRIVATE DOOR IS SHITLER GRABS THE DISKSHOUTING WITH JOYHE PLACES IT ON A STATUEWHICH BEGINS TO GLOWHITLER SHOUTS,The power is mine!TURNS TO A GUARD AND SMILESA GUARD THREW YOUTHRU A SMALL DOORA BEAM OF LIGHT SHINES FROM THECRYSTAL,IT STRIKES HITLER!HIS GUARDS VANISH IN FLAMESA CROWN FALLSFROM HIS HEADHITLER LIES HEREA DOORWAY IS NA VENT IS IN THE WALLHE IS STONEBELOW THE FLOOR IS COVEREDWITH HUGE SPIDERSYOU WERE SWARMED BY SPIDERSTHE WAX BALL EXPLODED,YOU DIED!THE PILLAR IS SINKINGTHE SPIDERS ARE CLOSER!IT CAUGHT ON THE HOOKA PIECE OF CANVASIS ON A WALLAN OPENING LEADS SNOTHING CUTS ITA VENT OPENING IS STHE VENT STOPS YOUTHE VENT TILTS..A HUGE CLEAR STONE IS HERETHE STONE CRACKSA HUGE CURLED UP SNAKEIS HERETHE SNAKE STOPS YOU!NOTHING WORKSTHE SNAKE SAYS,Drop the crystalIt will destroy youTHE SNAKE SWALLOWS ITHE SMILESTHE SNAKE VANISHES ALONGWITH THE CRYSTALFIRE AND STEAM BLOCK YOUR WAY..THE FIRE IS OUTTHE WAX MELTEDJOE STALIN AND LEE OSWALD AREAT THE ALTAR,LEADING ABLACK MASS YOU SIT DOWNA TRAP DOOR IS HEREIT'S STUCKTHE TRAP DOOR SHUTSAN ANCIENT ALTAR IS COVEREDWITH CANDLESA CRYSTAL DOOR IS S A FORCE PULLS YOU IN A SIGN READS,Savegame siteNot responsible for lost articlesTHERE'S A WHITE MARKTHERE'S AN OPENING IN THE WALLSOMETHING WON'T FITA NEON SIGN BLINKSLeaving BLACK FOREST come back soonBack already?AN OLD MAN STOPS YOUAN OLD MAN IS HEREHE SAYS,Give me my bribeHE CRIESAN OLD MAN IS CRYINGFAR BELOW TWO ARMIES FIGHTYOU HEAR HUGE FOOTSTEPSSomething ADMITS YOUA LOVELY ANGEL FLOATSABOVE CALLING YOUR NAMESHE SAYS,Give me the crownI can save you,Please!THE ANGEL TURNS INTO ADEMON AND SCREAMS LAUGHTER! HE SAYS,I made the offerDrop the proof and you'll see heaven THE DOOR IS SHUTTHE DOOR JERKS...THE DOOR OPENS!THE DOOR IS OPENSTEPS LEADS UPHE SAYS,I am the Prince of Peace,and the WAYListen to the evil one againFrom me you'll gain the powerHE SAYS,You're saved..Go forward in My name!A HOT FORCE THREW YOU BACKA VOICE BOOMS,The book ofJames...1 John 1:9IT'S HEAVYIT'S MAGICIT GLOWSIT'S STEELIT'S FULLIT'S SHARPBLUE JEWELS ARE ON ITIT'S STRONGSOMETHING RATTLES INSIDEIT'S SHINESIT READS,DeeculaTHEY LOOK GOOD ON YOUIT'S HUGEIT'S 30 PIECES OF SILVERIT'S FULL OF FIERY PATTERNSAN OBJECT IS BELOWIT'S A CHAINA NOTICE IS POSTEDAN OPENING LEADS UNDER ITIT'S ADOLPH EICHMANNWRITING IS ON ITIT'S JOHN WILKES BOOTHAN IRON SPIKE IS HEREAN ARMY WITH SWASTIKASIS E, AN ARMY OF DEMONS IS WVERY EERIE..STRANGE VAPORS RISE FROM ITARE YOU CRAZY?A HOLE IN THE ROOFHAS A HOOK ON ITA BEAM OF LIGHT SHINES ON ITNO THANKSIT'S THICKYOU SEE HITLERS OFFICEA SLIT IN THE SIDEHAS BLUE JEWELS AROUND ITHE'S SMILINGYEECHH!A DOOR IS IN ITA SLOT IS IN THE DOORONE CLUTCHES A CLOTH SACKIT LEADS THRU..IT'S JUDAS ISCARIOTIT MUST WEIGH TONS V  DLt  778eeee波=mVŷLƹEƺƽEƾ ƲƳ  l f+ f+b+c+Ӎd+e+  BD+E+jiIH Vf+ `+ D Lt}E EMBEDDED IN THE WALL OF THE CAVE. THIS BABY SURE LOOKS TOUGH TO CRACK YOU'D BETTER HAVE THE COMBINATION+/ +L\vʩi.ϩSiЩƅǩ˅̅` "9 5qmmҍrmmL5 M0 wW©ý1 1éX 1%2 1M2 1u2 1ý2 1( ,1L2)? ?0` LLAMASOFT PRESENTS... JEFF MINTER'S MUSICAL ARRANGEMENT BY JAMES LISNEY GAME DESIGN BY P.K. AND J.C. MINTER ATARI CONVERSION BY AARON LIDDIMENT @ 1984 LLAMASOFT SOFTWARE zzzGzzݍ8!z`…8)`æ½3 3Y©` ?0 ?0 ?0L?0@DHLPTDHHLPͅ>z?zߍJzzzzzF >z?z 5 X3Hi X3hNиzz…zzz zz X3 X3 5bɩ 5\Fz X3 5 X3ͅNzzzzzF >z?z X3Hi X3h 5hи zzzzz zzzzzzzF >z?z X3Hi X3hH8 X3 X3h 5ɼЎ :`HHx       hh` 5)LQ1LP om` 6 wW 9 :j© ?0 ?0¥(©k 3 ©o 3© â6)?6)? ?0 ,1 Q1 6L*:PLAYER ONEPLAYER TWO `abHb` : wWd 6 JЩiݍ:zzzzé[ ?0¥ å f ߩZ ?0¥ å ?0¥ å驱( X3܅ 8½!8 3åi©܅ 3"8½#8é` 3åi©` 3&8© 788©âe ?0Z† ?0 ?0æ©d ?0 L7ié` 3Lv8      ?0 ?0 ?0 ?0 ?0 ?0 `bbb` X3 X3zzz zz Q1)о zz X3 X3Hi X3hzzz zz Q1ɼЮ`39oox`DOG LOYALTY: """"""""""""""" 0000000 DOG TOLERANCE: """"""""""""""" TOM'S MOWER OVERLOAD: MOWER pmmoé±)? E0¤xѩi :)?c`JIMTOMALFJCMzz` 6LG wW :sԩHөé ?0¥(å :L>ӥ`v¦ØHH ?0) o:hhÈ`¥ ?0 ?0 o:`¥ ?0 ?0 o:`Å;ʊ)|V~l` ; ; ; ; ; ; z: ĥ) z:Lh; ; ; ; : ;L&; ; ; ; ; :L&;`!||  ||          ~ ~   ! ! |||| | |%|"|||  ~~ !  v         $    $~~~~~   ||| |  $$|| | |    | || |    ! !  ""$| | ! ~~~~~~   ( | |   ||~ ~!  | | ||!~~ߍ:s :߅ܩ۩څ٩ةQݩͅީ >L?ؽ>z?ez݅ޅ X3?e?eLX3#  dF....?m#?m'?mmmmmݩʊ) L? C8)j 8`؅ׅ 1? J ? A [A JB QDL? Q1` D`>)L?( 4ߩ҅Ӆԩܩ>݅ 4 3 33 .L\+Lx+ `. . / +L\+܅ 4! . 3 .Lr+܅ 3L!2 n3שօم؊. A-$װN A-Q8 4L.L<-+ . 3ֹɠ ɍ o4L+ o4 o4` L-8 L-14L0L0L0LK1 "L1$&L2&L:2#L8')L28LQ99L9:L9;L:46L2<L:=L:giLh:H ٩L2-L8>@)+ L87L5jL8+,LJ6.L\6/1L66L[5@L6AL6BL}7,L+զ֩>ЩAѽ,ɠ% <.ɠɠ <.Lk-եk <.LO- <.ɠۤ`'(``҅ӢЩ= H.L-  L-L-L.ҨA;'A6٩'A K1$L. ` .L!2 .`aL. 3Dd .  .L!2`iА`i А`iڐ`Щ>ѩ܅ 4܅ 4҅Ԡ8Ԡ0 <.L.iАL.ɭ)I o4 o4` <.L. o4 <.L.ԩ4ЩEѠL.L/ .Щ= H.L. 3 / `L.T/ o4^/ɠ! o4h/ɠ o4r/ɠ o4|/ɠ o4 o4`ҠӠՠӠԠԠԠԠȠȠکC۩ ܅ 3 .נ2 T.L/ƒƒ8 3 o48 3L.FЩDѥׅԥ܅8 3 4 0L/ 3 .`8ԩ0 <.L!0iАL0',)I o4 o4 o4`ȥ%ե 4ܥ܅8 3L90(C' 2ȱ$ "ݩک L.L.bL.L.L.C 2ґݥ֩ L.L.L.کC۩ݩ .נ T.L 1 o4 .`FЩDѥׅݩ  3 .L1҈AL.L.C? 2 KL.DҍDD"D%D(D+D}L.EL.loL:2rL.L.ȱеL.2٨C% 2 [D L.LK1L.L.L.`   L.# . . 3LwL6*C 2* DL.%L.cLK1$L.%L.L.L.멱L.J . o4ֹɍ o4L2 o4 o4H`H .L-`&L. .L-҈EL.کCۈ T.L2`' .L!2  7 R@10?3L93Щ;Ѡ .iАLI3 4`܅ 3 o4 .  3 3 o4`L3L4H o4hɈ ɘ # 4L3 o4 3 o4 3ɍл %5Lo4@ /4Hɠ) h`h`L3ʻ˫ՍɭڴͯѹɠH 4h`ɇ `))8 撥ŏS`ɠɍGɊGɈƒ襏ƒœƓ 15e`H 4 '5hiőݥ擥őƓH 4hiő H 40 '5ď`Hi!ih8Hi(i`` j5L.L.DD D`7C4 221C*C#l@D,(L5wL.L.L.L.CCݩL. j5Ɇ@D `. . / ; .L 6L 6 `. . / ; .L!2@DL5 . `. . / ;L!2`aTL8L.bL.  .L- L.*L."C! 2 ~ .L!2L.L.L.L.- . 3L6L6D1:SAVEGAME . . 3@םD6EJKB VCLx7Ei8=I@H BD=E VCLx7@I H BНDE VCLx7@ B V L.0L./ . 3@םD6EJKB VCL 8Ei8=I@HBD=E VCL 8@I HBНDE VCL 8@ B V L.1L.0C>E8 2 D_i_D L.L.L.L._L.^L.`ۥH :d2 . :e$ . :f . .ҍD`⩐L.L.#C 2 _DL.L.L.L.CCB 2> #ҍDD EᩀEL.ґݩ L.L.L.  L.L.L.#C' 23DcL.L.L.L.eL.8L9؅LQ9L.L.9x :/C. 2*#.D#ҍ.D{L.L.zL.zL.L.yL.|L. n3שօم؊ A-``H/C6 2%D#DCݩCҍ@DL.L.L.L.L./H0C 2*@Dݥ@D L.C .L!2L.L.L.L0L.&L.3C( 2D!ȅߩEL. L.L.L. L.܅ 3 o4` BIRTH OF THE PHOENI COPYRIGHT 1982 PHOENIX SOFTWARE INC PROGRAMMED BY PAUL L. BERKEҠWELCOME TO ADVENTURINGYOU'RE ABOUT TO LEAVE THE ORDINARYEVERYDAY WORLD YOU INHABIT AND ENTER NEW WORLD...A WORLD WHERE MAGIC WORKAND THINGS AREN'T QUITE WHAT THEY SEEMI SUGGEST YOU READ THROUGH PAGE 6 OTHE MANUAL BEFORE STARTING THE GAMETYPE IN TWO WORD COMMANDS SUCH A"GET BRANCH" AND I'LL DO MY VERY BESTO DO WHAT YOU ASKREMEMBER, IN THE WORDS OF THAT FAMOUADVENTURER, Q. ELDON MUGWUMP AN ADVENTURER FRESH FROM MURMISK SAID, AS HE BOOTED A DISK YOU GIVE IT A TRY (I'M AFRAID I MIGHT DIE) PRESS RETURN NOW AT YOUR OWN RISK     YOU'RE IN A FOREST GLADEYOU'RE IN A FORESTYOU'RE AT THE WELL IN A CLEARINGYOU'RE AT A CLIFFYOU'RE IN A SHALLOW CAVEYOU'RE IN A TOOLSHEDYOU'RE AT A CLIFFYOU'RE IN A MOST CONFUSING MAZEYOU'RE IN A MOST CONFUSING MAZEYOU'RE IN A MOST CONFUSING MAZEYOU'RE IN THE HALL OF THE PHOENIXYOU'RE IN A MOST CONFUSING MAZEYOU'RE IN A MOST CONFUSING MAZEYOU'RE ON A ROAD TO THE MOUNTAINSYOU'RE IN THE MOUNTAINSYOU'RE AT A MOUNTAIN PASSYOU'RE ON A ROCKY ROADYOU'RE ON THE ROAD TO HELIOPOLISYOU'RE IN THE TREASURYYOU'RE IN THE TEMPLE OF THE SUNYOU'RE AT THE BOTTOM OF A WELLYOU'RE HIGH UP IN A TREE TOPYOU'RE BY THE GUARDHOUSE3579;=>ACDEFGHIKL?ΠŠŠŠӠנננՠĠȠԠԠԠȠԠԠԠРΠϠˠŠԠŠРԠРԠӠȠŠΠΠΠŠРРĠ٠Ҡ̠ˠĠǠŠ ˠԠɠΠ٠РԠŠ ΠԠǠȠŠĠˠԠԠŠŠŠՠŠˠȠؠȠӠөӠөӠө̠٠ӠԠΠˠҠĠΠŠנŠŠǠԠˠ̠ĠŠ̠ŠŠŠҠ  _STICBRANCPHOENIMYRR(DIAMONDS(RUBIES(SAPPHIRESSHOVEKENEPOTIOBOORED PAPEGREEN PAPEORANGE PAPEYELLOW PAPEBLUE PAPEPURPLE PAPEBAFLASHLIGHCLOCDIAGUARTREPHOENIX IN NESAFMNOPQRSTUZVVVVVVWXYohifijjflllgllgfmfgpgnfkI'M SORRY BUT I DON'T UNDERSTAND THATTHAT CANNOT BE DONETHAT CANNOT BE DONE AT THIS TIMEI CAN'T GO IN THAT DIRECTIONPLEASE TELL ME WHICH COLOR TO INSERTPLEASE TELL ME WHICH DIAL TO READPRESS RESET TO TRY AGAINYOU MUST DROP SOMETHING FIRSTOKYOU CAN'T GO ANY FURTHERYOU HAVE NOTHING TO WIND IT WITHPLEASE USE THE FORM "GIVE (OBJECT)"THERE ARE EXITS IN ALL DIRECTIONEXITS**>COMMANDOBJECTS: !! <- OZ 2200 KM. !!--------------------------------------WOW! YOU'VE COME TO THE TREASURY IT'S THE SAFEST PLACE I KNOW TO STORE TREASURESLIGHT STREAMS FROM THE CRYSTAL CEILING AND REFLECTS OFF THE GOLDEN ALTAR IN THE CENTER OF THE ROOM. THREE STEPS LEAD UP TO THIS MAGNIFICENT PLATFORM. AS YOU APPROACH, YOU SEE THAT A PHOENIXHAS BEEN CARVED INTO THE MARBLE BASE. FRESH ROSE PETALS ARE SCATTERED OVER THE FLOOR AND THE AIR IS FILLED WITH THEIR SCENT. YOU FEEL A SENSE OF SERENITY AND ACCOMPLISHMENT HEREI DON'T LIKE THIS PLACE. LET'S GET OUT OF HERE. I THINK THERE ARE SNAKES HERE. I HATE SNAKES....YOU HAVE CLIMBED THE TREE AS FAR AS YOU CAN GO. THE ONLY WAY LEFT TO GO IS DOWN.YOU HAVE A WONDERFUL VIEW FROM UP HEREIT'S AN UGLY STICKTHERE ARE A FEW TWIGS GROWING OUT OF THEBRANCH. IT IS EXTREMELY DRY AND BRITTLEIT HISSES AND SPITS AT YOU AND JUST WON'T STAND STILL LONG ENOUGH FOR ME TO EXAMINE IT FOR YOUTHEY ARE VERY BEAUTIFUL. THEY HAVE BEEN POLISHED AND CUT SO THAT THEIR BRILLANCEMAKES IT DIFFICULT TO LOOK AT THEMTHEY ARE SAPPHIRES, ALRIGHTIT APPEARS TO BE A GAY BLADEIF THIS KEY OPENS A DOOR, WHAT A STRANGEDOOR IT MUST BETHE NET IS WOVEN OUT OF A VERY SOFT MATERIAL....ALMOST AS IF WHATEVER IT ENMESHES IS TO BE TREATED GENTLYI DON'T KNOW IF I'D TASTE IT IF I WERE YOU BUT IT CERTAINLY SMELLS GOODYES, IT IS A COLORED PIECE OF PAPER... CONSTRUCTION PAPER I BELIEVETHE BAG IS EMPTY. A LABEL ON THE BAG SAYS 'MAZE MAPPER (PAT. PEND.)'THE FLASHLIGHT IS OLD AND CORRODED. SOME YUCKY BROWN STUFF IS LEAKING OUT OFTHE BOTTOMTHE GUARD PUNCHES YOU IN THE NOSE FOR TRYING TO EXAMINE HIMTHE COVER SAYS,"OPEN AND READ.THE PHOENIX IS REBORN EVERY 500 YEARS BYBURNING THE OLD PHOENIXBE SURE TO VISIT YOUR COMPUTER STORE FORAN "ADVENTURE IN TIME.THE MAGIC WORD IS "PHOENIX"THERE ARE NO MORE PAGESTHE BOOK IS CLOSED"OH NO, YOU HAVE KNOCKED OVER THE TIMBERS SUPPORTING THE SIDES OF THE WELLAND THE WELL HAS JUST FALLEN IN AND KILLED YOU. BETTER LUCK NEXT TIME."THE GUARD WON'T LET YOU."IT LOOKS IN PRETTY BAD SHAPE. IT MIGHT WORK, BUT NOT FOR VERY LONG."THE LIGHT IS ON, BUT ITE EMBEDDED IN THE WALL OF THE CAVE. THIS BABY SURE LOOKS TOUGH TO CRACK YOU'D BETTER HAVE THE COMBINATION+/ +L\v "THE POOR FLASHLIGHT GIVES UP THE GHOST,AND WITHOUT FURTHER ADO...GOES OUT." "THE DEAD FLASHLIGHT CANNOT BE RELIT.ALL THE HELP YOU NEED IS IN THE MANUALCONSULT YOUR MANUAL FOR HELP"SEE PAGE 7 OF YOUR MANUAL."SEE PAGE 9 OF YOUR MANUAL."SEE PAGE 11 OF YOUR MANUAL."SEE PAGES 11 AND 12 OF YOUR MANUAL."SEE PAGE 13 OF YOUR MANUAL."SEE PAGE 15 OF YOUR MANUAL."SEE PAGE 12 OF YOUR MANUAL.THE TREE APPEARS TO BE CLIMBABLE"SEE PAGE 15 OF YOUR MANUAL. IF YOU WANTTO STORE A TREASURE TYPE "STORE (NAME OF TREASURE)"XXXXXXI WAS CHILLY BUT I FEEL WARMER NOWWITH WHAT THE GROUND IS TOO HARD TO DIGYOU CAN'T DIG WITH THAT"MY, MY, LOOK WHAT YOU'VE DUG UP.SOMEONE HAS ALREADY DUG SOMETHING UP HERE, THERE IS NOTHING LEFT FOR YOU TO FINDTHE BAG IS FULL OF FUNNY LITTLE PIECES OF PAPER. A LABEL ON THE BAG SAYS 'MAZE MAPPER (PAT. PEND.)'"YOU FALL INTO A DEEP SLEEP........ PERMANENTLY!!!.THE GUARD GRINS AT YOU AND TAKES A DEEP SWIG OF THE POTION. HE GRUNTS AND FALLS TO THE FLOOR IN A DEEP SLEEP WITH A HAPPY LOOK ON HIS FACETHIS GUY IS OUT LIKE A LIGHT. YOU CAN SEE HIS HAND STILL CLUTCHING A BOTTLE. I BET HE'LL LOSE HIS JOB WHEN HIS BOSS FINDS HIM IN THE MORNING. "YOU SHOULD BEASHAMED OF YOURSELF!IT IS BEING HELD IN A VISE LIKE GRIP BY THE UNCONSCIOUS GUARDWOOOSSSH!!! YOU FIND YOURSELF ON THE OTHER SIDE OF THE CLIFF. YOU HAVE ACHIEVED 0 POINTS OUT OF 100YOU HAVE ACHIEVED 30 POINTS OUT OF 100YOU HAVE ACHIEVED 60 POINTS OUT OF 100YOU HAVE ACHIEVED 90 POINTS OUT OF 100I DON'T SEE A PLACE TO STORE ANYTHINGIT LOOKS VERY WOUND DOWN...IN FACT IF ITISN'T WOUND UP QUICKLY THIS GAME WILL BEWOUND UPWHEW..THAT WAS HARD WORKTOO BAD, YOUR TIME HAS RUN OUT BECAUSE YOU'RE RUN DOWNTHE CLOCK IS NOW WOUND UP AND TICKING BRISKLYTO WHAT #"CLICK"CLANK..CLUNK.. THE SAFE OPENS AND YOU SEE A PILE OF DIAMONDS.THE SAFE IS ALREADY OPENA VOICE FROM SOMEWHERE SAYS,"WRONG SEQUENCE", AND YOU HEAR SOMETHING THAT SOUNDS LIKE, 'BOING.THE PHOENIX IS BADLY FRIGHTENED AND FEEBLY HOPS AND FLAPS AWAYTHE NET SETTLES AROUND THE PHOENIXTHE PHOENIX STIRS AND LOOKS AROUND. IT RUNS AND HOPS AWAY AND WITH DIFFICULTY LAUNCHES ITSELF INTO THE AIR. IT IS SOONOUT OF SIGHT, NEVER TO BE SEEN AGAIN BY YOU. YOU HAVE LOSTA FIRE BLAZES UP MOMENTARILY CONSUMING THE STICK AND BRANCH. IT DIES DOWN LEAVING A PILE OF ASHES WHICH QUICKLY BLOW AWAY IN THE WINDTHE PHOENIX BURSTS FROM THE NET AND PLUNGES INTO #<ө\P  `` / - x   LL L LLLLLLLLL LLLLLLLLLLLLLLL4L+LLLLLLL7L.L:L1LLLL"LCLFL=L@LIL%L(LLOLRLULXL[L^L` zL+ L LVL+ | V   E Z   Z  - ; I [  o0 &/   ` u08 hh  LV h  e` h 0 Y` ` h0 e` h   h  Hh0 e0` h  e`0`L 0 00` 0  ` h00`0000`L h    0 0H0hȱH0h0` h  0 00` h80000` 0 ` 0  ` h0` h0H00h0` h0`  s000 e` I'M DEAD! h   h H0 eh0 e` ^  3/YL} e` This ADVENTURE is over. Hit Y to try this ADVENTURE again I'm carrying yoo much. try: "TAKE INVENTORY" Ho0  &/   (/   * ~0    { H      d    y0 q  hy0h`  LE I stored treasures. on a scale of 0-100 thats: áէŠŠԡ _`L L {01|01 &/0 e` h   h  0 eH0h00 e`  00000.0&.0.0 80000800 й0000  `L L.00000 0 `    m0#0  >0  ~0 `   / 0 / 000ӭ000O0п0000 0.,L 0;0}0      000 /ȱ         q        ]ȱHȱh  PȱQ &/  H 0 *-00h  0L L }0      g0h0 /  ȱ    e040f0*82 $/  Hȱh  L"84 {Hȱh   ȱ!  L0L 0L I must be stupid, but I just don't understand what you mean I can't do that... YET! DID: PSBL: 0 `00 $ L0 H u0=  L I'm carrying too much! try: "TAKE INVENTORY" 1  (/Hh  0L/  L  0 i00/и   &/     0  L80L0ߩ +  e0`  /  H  ` ϭ0 u L HUH? OK I'M NOT CARRYING IT! I DON'T SEE IT HERE! I ALREADY HAVE IT ITS BEYOND MY POWER TO DO THAT. m ԅd8di` 0 &/0 u 08  LO    / ȱ 0 0)  LO P 0s00 eLO0 +  e` I FELL & BROKE MY NECK! I'M DEAD! ITS DANGEROUS TO MOVE IN THE DARK! I also need a direction. I can't go in that direction. on. LeLLLLL LLDLyLLLLLLLLL9L(LMLtL_L#LL3L+L;i  zȥ `ȱii`hhhHHH(lhhhhhH(lЯПлЏЫe(`ahbhchdbHa(      cdlchahb      abla(`LL8hh(`HHHHHH֥hh(`HHHH 8  h8(`h  zL  zȱLHeeh(`  zȱ `  zLpLfLL2LLL*LL.*AUp%1FZw` &/o0`  I````` 0 0` 0 0``   */  Ф``   */  `0`0I` 0 Ж`    o0ȩ30 &/  (/30 b    30      ` I'M CARRYING THE FOLLOWING: Not a thing!  Hȱh / .    ` Y0R Y0R0! &/0  L /0m0ȱ *      30o0 &/  (/030      b30     30   / ȱ0m030  30       з30  S8Rʩ  Y0R `ӠϠˠϠš I'm in a North South East West Up Down . Visible items: Some exits are:     /g0mg0g0ȱ       ȱ  qй   `   Z kW03/X04/<05/ V &/3/o0 V R V ` Saving Game C: D:SAVE. Disk or Tape? Ready tape then hit: RETURN RUT[    V/U3T` RYX V`L LpLiLLLOLOLL.!L$L}$L\!L!L  :  ! % :  eL/ " S Q"0 SL%  ^  S0     `* ADAMS ADVENTURE * (VERSION 3.9/) (C)'81 A.I. BX 3435 LONGWOOD FL 32750 This program will allow you to have an ADVENTURE without ever leaving your armchair! You'll find yourself in a strange new world. You'll be able to examine, get and otherwise manipulate the objects you find there. You'll also be able to travel from location to location! I'll be your puppet in this ADVENTURE. You command me with 2 word English sentences. I do have over 120 word vocabulary, so if a word doesn't work try another! Some words I usually know are: HELP, QUIT, SCORE, INVENTORY, SAVE GAME. The Author has worked over a year on this program so Now hit return  L(   8H    hL(  `    LZ    `   RLw  i@`8 ɀɠ _bY0 (('RLw XY (   `e`Rˤɀ y y Xɀ yL S`R`RS` X yɀH  y yLR hLw  @ 2/ 3/  y0 V~ 3/  ɛ    `   A/Ш Rrb V0 V Vrb/eu3dtkhi{xyS3/:4/ 5/ j VK3/z0 VrR'S   ! Rᩞ S᩟  3/S X`LRXRаSL X,L,R move margins and S to stop Y0 '( R `hhhHHHHH(lhhhhh(l o0    &/  */   w00x00{01|01}0 0`k00 0 0 i0"*i0 Ν0i0`i0 0Ξ0` &/& 1  11100 " ` "  1  " ` ԠӠԠ LIGHT HAS RUN OUT! #   3/  G$0j0X}0`A ੒`BXPTIN0V0E0NSEWUD ;# 00` 0/ ! $  0  $ L"00 G$00+ ./ ! *$  0  ?$ L"00` # L" Use 1 or 2 words only! ɠ I don't know how to "" something. I don't know what "" is.  0   `  ⎝0     &/  0` 00 00-080000 0  0   q 00 0  ` %  3/YN`Z k % W0 3/ ~%  s%L%<5/0 % s% &/3/o0` R V` ĠŠŠġ Want to restore previously saved game? RYX V`JJYKLLWMNUOPQQSTT-UqUUU=VVyHHIxH81P2950 0 4050 404 0 0 0 0 17700 0 900 0 0 0 0 0 9450 0 4212 82 0 0 0 0 10611 10959 0 440 0 0 0 0 1613 8212 2737 404 148 0 0 0 265 16500 2737 404 /S1 W=EAK! }S"#%iqŪm?4166}aANYNORSOUEASWESUPDOWNETFISAWAMIRAXE*AXWATBOT*CONHOLLAMSPIWINDOOMUD*MEDBEEROCGASFLIEGGOIL*SLIKEYHELBUNINVLEDTHRCROBRIBEADRARUGRUBHONFRUOXRINCHI*BITBRASIGBLAWEB*WRISWALAV*DAMHALTRE*STUFIRSHO*BANADVGLAAROGAMBOOCHALAKYOHAUTGO*ENT*RUN*WAL*CLIJUMATCHO*CUTGET*TAK*PIC*CATLIG*.*IGN*BURDRO*REL*SPI*LEA*GIV*POUTHR*TOSQUISWIRUBLOO*EXA*DESSTOSCOINVSAVWAKUNLREAATT*SLA*KILDRI*EAT.FIN*LOCHELSAY*SPE*CALSCR*YEL*HOL.FILCRODAMMAK*BUIWAV*TIC*KIC*KIS*TOU*FEE*FUC*HIT*POKOPE dismal swamptop of a tall cypress treedamp hollow stump in the swamproot chamber under the stump"semi-dark hole by the root chamberlong down sloping hall large cavernlarge 8 sided roomroyal anteroom*I'm on the shore of a lakeforest maze of pits maze of pits maze of pits maze of pits maze of pits maze of pits*I'm at the bottom of a very deep chasm. High above me is a pair of ledges. One has a bricked up window across its face the other faces a Throne-roomF*I'm on a narrow ledge by a chasm. Across the chasm is the Throne-room royal chamberI*I'm on a narrow ledge by a Throne-room Across the chasm is another ledge throne room sunny meadowf*I think I'm in real trouble now. There's a fellow here with a pitchfork and pointed tail. ...Oh Hell! hidden grovequick-sand bog/Memory chip of a COMPUTER! I took a wrong turn!>top of an oak. To the East I see a meadow, beyond that a lake.%*I'm at the edge of a BOTTOMLESS holeZ*I'm on a ledge just below the rim of the BOTTOMLESS hole. I don't think I want to go down!long tunnel. I hear buzzing ahead*I'm in an endless corridorDlarge misty room with strange unreadable letters over all the exits.Nothing happensChop 'er down!BOY that really hit the spot!.Dragon smells something. Awakens & attacks me! Lock shattersI can't its locked@TIMBER. Something fell from the tree top & vanished in the swampTIMBER! Lamp is off+Lamp burns with a cold flameless blue glow.I'm bit by a spider$ My chigger bites are now INFECTED! #My bites have rotted my whole body!%Bear eats the honey and falls asleep. Bees sting me First I need an empty container.'The bees all suffocated and disappeared%Something I'm holding vibrates and...nothing to light it withGas bladder blew up in my hands!-gas needs to be contained before it will burn%Gas dissipates. (I think you blew it)That won't igniteHow?Bear won't let me0"Don't waste honey, get mad instead! Dam lava!?"'Bees madden bear, bear then attacks me!It soaks into the ground*In 2 words tell me at what...like: AT TREEOH NO... Bear dodges... CRASH! Its heavy!Somethings too heavy. I fall.To stop game say QUIT4Mirror hits floor and shatters into a MILLION pieces/Mirror lands softly on rug, lights up and says:You lost *ALL* treasures.$I'm not carrying ax, take inventory!%It doesn't seem to bother him at all!The mud dried up and fell off./Bear is so startled that he FELL off the ledge!:" DRAGON STING " and fades. I don't get it, I hope you do.LThe bees attack the dragon which gets so annoyed it gets up and flys away...Lamp is now full & lit I'm bitten by chiggers. ;There's something there all right! Maybe I should go there?Maybe if I threw something?...Too dry, the fish died.8A glowing Genie appears, drops somehting, then vanishes._A glowing Genie appears, says "Boy you're selfish", takes something and then makes "ME" vanish!No, its too hot. Not here. Try the swamp Sizzle...bTry --> "LOOK, JUMP, SWIM, CLIMB, FIND, TAKE, SCORE, DROP" and any other verbs you can think of...)There are only 3 ways to wake the Dragon!"Remember you can always say "HELP"Read the sign in the meadow!$You may need to say magic words hereA voice BOOOOMS out:please leave it aloneSorry, I can only throw the ax.Medicine is good for bites.I don't know where it is Welcome to Adventure number: 1 "ADVENTURELAND". In this Adventure you're to find *TREASURES* & store them away. To see how well you're doing say: "SCORE" Blow it up!#Fish have escaped back to the lake.OKHuh? I don't think so!!You might try examining things...What?OK, I threw it. Check with your favorite computer dealer for the next Adventure program: PIRATE ADVENTURE. If they don't carry "ADVENTURE" have them call: 1-305-862-6917 today! The ax vibrated!I see nothing specialGlowing *FIRESTONE* Dark hole*Pot of RUBIES*/RUB/Spider web with writing on it+-HOLLOW- stump and remains of a felled tree Cypress treeWaterEvil smelling mud/MUD/*GOLDEN FISH*/FIS/Lit brass lamp/LAM/ Old fashioned brass lamp/LAM/ *Rusty axe (Magic word "BUNYON" on it)/AXE/ Water in bottle/BOT/ Empty bottle/BOT/ Ring of skeleton keys/KEY/.Sign "Leave *TREASURES* here, then say: SCORE" Locked doorOpen door with a hallway beyond Swamp gas*GOLDEN NET*/NET/ Chigger bitesInfected chigger bitesPatches of "OILY" slime/OIL/*ROYAL HONEY*/HON/Large african beesVery thin black bearBees in a bottle/BOT/Large sleeping dragonFlint & steel/FLI/*Thick PERSIAN RUG*/RUG/@Sign: "magic word's AWAY! Look la..." (Rest of sign is missing!)Distended gas bladder/BLA/Bricked up window8Sign here says "In many cases mud is good. In others..."Stream of lava#Bricked up window with a hole in itLoose fire bricks/BRI/$*GOLD CROWN*/CRO/%*MAGIC MIRROR* Sleeping bearEmpty wine bladder/BLA/(Broken glass/GLA/) Chiggers/CHI/*Slightly woozy bear*DRAGON EGGS* (very rare)/EGG/,Lava stream with brick dam*JEWELED FRUIT*/FRU/.*Small statue of a BLUE OX*/OX//*DIAMOND RING*/RIN/0*DIAMOND BRACELET*/BRA/13Strange scratchings on rock says: "ALADIN was here"2Sign says "LIMBO. Find right exit and live again!"(Smoking hole. pieces of dragon and gore.$Sign says "No swimming allowed here"Arrow pointing downDead fish/FIS/7*FIRESTONE* (cold now)/FIR/8Sign says "Paul's place"Trees-Sign here says "Opposite of LIGHT is UNLIGHT"Empty lamp/LAM/<Muddy worthless old rug/RUG/= Large outdoor Advertisement/ADV/>Hole    !  B+B5BKBiBBBBBBBC4CJC]CyCCCCCCCD4DHD[DpDDDDD E(E:EsEEEEEEEFF)F=F]FxFFFFFGDGmGGGGGGG H1HOHqHvHwH    !    8"0: - * : &7E%E89  !// 3E-$''***00 33<0---/////////%%  30//0 /#0* -&''K ddd2d2ddddddddd69***!6 "5# + ##66 39 9 6% &'"6& 99&' *  9<9831 *A ;;>u 7%(J90=JH>?>-=L;>-77<<<:56:r/F5//;;5Fv5::5 UH>Fiiijmmmil78 v=FoitUFvx/zGUI4{}L;<4B=5:=s>:==:H=|vv@mFL @8g@HL@k7@;:E<ii+k<<:B;;@L@ lhI  @ RlE6m nmjzl z>(dhhBDDl DVDRfzB   D X0V>1ETDbH410HGX1T1&!l1| ffBB<I<\<|<D <0Bxm[d<l``X4D ll|  F$@4<hdd@ TT]JL(( loPTpPPT@d<h3i3v3333344'464R4Y4f4s44444=555555\6i6x666 7h777        !             777 8)8X8f8y88888939W9}99999:':4:b:::::: ;#;N;m;x;;;;<+>>>>> ?J?m??????@/@@@@@A7A=AMAABfffffff>`<|fl0fF68of;p88pf< 80 0 ~~`0 0`7ggo;3s~s3``p?cccccs6<gn||lopp``cccwkc|vvvvw6cc633>006cco><66>333`>?ll 3333c>ccc6<cckwccf<6ccc6 ?f 3~@`0 xx6c6>8pp8?** TTwwT*TUU]x`x`~<~~<0~0 ~ <~~<6vv``|ffff6680>{2rއ<```|f~6<3|fffff~`~ff3c ? s333c66cck3~n۱6f[ۃ><~~<8x8#<ө\P  `` / - x   LL L LLLLLLLLL LLLLLLLLLLLLLLL4L+LLLLLLL7L.L:L1LLLL"LCLFL=L@LIL%L(LLOLRLULXL[L^L` zL+ L LVL+ | V   E Z   Z  - ; I [  o0 &/   ` u08 hh  LV h  e` h 0 Y` ` h0 e` h   h  Hh0 e0` h  e`0`L 0 00` 0  ` h00`0000`L h    0 0H0hȱH0h0` h  0 00` h80000` 0 ` 0  ` h0` h0H00h0` h0`  s000 e` I'M DEAD! h   h H0 eh0 e` ^  3/YL} e` This ADVENTURE is over. Hit Y to try this ADVENTURE again I'm carrying yoo much. try: "TAKE INVENTORY" Ho0  &/   (/   * ~0    { H      d    y0 q  hy0h`  LE I stored treasures. on a scale of 0-100 thats: áէŠŠԡ _`L L {01|01 &/0 e` h   h  0 eH0h00 e`  00000.0&.0.0 80000800 й0000  `L L.00000 0 `    m0#0  >0  ~0 `   / 0 / 000ӭ000O0п0000 0.,L 0;0}0      000 /ȱ         q        ]ȱHȱh  PȱQ &/  H 0 -00h  0L L }0      g0h0 /  ȱ    e040f0*82 $/  Hȱh  L"84 {Hȱh   ȱ! [  L0L 0L I must be stupid, but I just don't understand what you mean I can't do that... YET! DID: PSBL: 0 `00 $ L0 H u0=  L I'm carrying too much! try: "TAKE INVENTORY" 1  (/Hh  0L/  L  0 i00/и   &/     0  L80L0ߩ +  e0`  /  H  ` ϭ0 u L HUH? OK I'M NOT CARRYING IT! I DON'T SEE IT HERE! I ALREADY HAVE IT ITS BEYOND MY POWER TO DO THAT. m ԅd8di` 0 &/0 u 08  LO    / ȱ 0 0)  LO P 0s00 eLO0 +  e` I FELL & BROKE MY NECK! I'M DEAD! ITS DANGEROUS TO MOVE IN THE DARK! I also need a direction. I can't go in that direction. on. LeLLLLL LLDLyLLLLLLLLL9L(LMLtL_L#LL3L+L;i  zȥ `ȱii`hhhHHH(lhhhhhH(lЯПлЏЫe(`ahbhchdbHa(      cdlchahb      abla(`LL8hh(`HHHHHH֥hh(`HHHH 8  h8(`h  zL  zȱLHeeh(`  zȱ `  zLpLfLL2LLL*LL.*AUp%1FZw` &/o0`  I````` 0 0` 0 0``   */  Ф``   */  `0`0I` 0 Ж`    o0ȩ30 &/  (/30 b    30      ` I'M CARRYING THE FOLLOWING: Not a thing!  Hȱh / .    ` Y0R Y0R0! &/0  L /0m0ȱ *      30o0 &/  (/030      b30     30   / ȱ0m030  30       з30  S8Rʩ  Y0R `ӠϠˠϠš I'm in a North South East West Up Down . Visible items: Some exits are:     /g0mg0g0ȱ       ȱ  qй   `   Z kW03/X04/<05/ V &/3/o0 V R V ` Saving Game C: D:SAVE. Disk or Tape? Ready tape then hit: RETURN RUT[    V/U3T` RYX V`L LpLiLLLOLOLL.!L$L}$L\!L!L  :  ! % :  eL/ " S Q"0 SL%  ^  S0     `* ADAMS ADVENTURE * (VERSION 3.9/) (C)'81 A.I. BX 3435 LONGWOOD FL 32750 This program will allow you to have an ADVENTURE without ever leaving your armchair! You'll find yourself in a strange new world. You'll be able to examine, get and otherwise manipulate the objects you find there. You'll also be able to travel from location to location! I'll be your puppet in this ADVENTURE. You command me with 2 word English sentences. I do have over 120 word vocabulary, so if a word doesn't work try another! Some words I usually know are: HELP, QUIT, SCORE, INVENTORY, SAVE GAME. The Author has worked over a year on this program so Now hit return  L(   8H    hL(  `    LZ    `   RLw  i@`8 ɀɠ _bY0 (('RLw XY (   `e`Rˤɀ y y Xɀ yL S`R`RS` X yɀH  y yLR hLw  @ 2/ 3/  y0 V~ 3/  ɛ    `   A/Ш Rrb V0 V Vrb/eu3dtkhi{xyS3/:4/ 5/ j VK3/z0 VrR'S   ! Rᩞ S᩟  3/S X`LRXRаSL X,L,R move margins and S to stop Y0 '( R `hhhHHHHH(lhhhhh(l o0    &/  */   w00x00{01|01}0 0`k00 0 0 i0"*i0 Ν0i0`i0 0Ξ0` &/& 1  11100 " ` "  1  " ` ԠӠԠ LIGHT HAS RUN OUT! #   3/  G$0j0X}0`A ੒`BXPTIN0V0E0NSEWUD ;# 00` 0/ ! $  0  $ L"00 G$00+ ./ ! *$  0  ?$ L"00` # L" Use 1 or 2 words only! ɠ I don't know how to "" something. I don't know what "" is.  0   `  ⎝0     &/  0` 00 00-080000 0  0   q 00 0  ` %  3/YN`Z k % W0 3/ ~%  s%L%<5/0 % s% &/3/o0` R V` ĠŠŠġ Want to restore previously saved game? RYX V`&IIJBurnt out torch/TOR/?     _BpB|BBBBBC/CACQC_CzCCCCCCCDD1DD"+>hhuoHHhD9 |}~hHFHH46 4 ),,67BBAG6?4:FF466s 77#$666FF(*(4566 46:>:ijo=HCwLH}K<Frr Fr7 55. F5.-8////56r95,44==7!FFF%&''rrFFhF33055rF FFrqrFr5Uw<FFr5,//? Hr; :H7?C;;=CD>L6L=@5::@CFut7@68F:r!7>H@5@:<@@p@50=0@k@@H2@@@.=r7f7;@@r@r@@@4y>>@@@@ 00 hhVHkhB12ggVj~~VYwBPBZmoh gD"I"I6>?hh,G,..1KbmV|R?3?V(4(vNxE1>4dD22ED@jjZG=xThHH4XYYX<Xh,(<Hw<d0??4P4>$$?=?ml/=ExPPt((,.$$T(P,Y@dhY<HP,,L0|XxUL333333.4M4[4b4n44444445 5z5555!646^6|6        666}7777708=8~88888889%939O9_999999::3:I:]::::;b;r;;; < <4<<=)=8=A=K=^=u===== >>7>L>[>x>>>>>>YoX]YhYYYY`<|fl0fF68of;p88pf< 80 0 ~~`0 0`7ggo;3s~s3``p?cccccs6<gn||lopp``cccwkc|vvvvw6cc633>006cco><66>333`>?ll 3333c>ccc6<cckwccf<6ccc6 ?f 3~@`0 xx6c6>8pp8?** TTwwT*TUU]x`x`~<~~<0~0 ~ <~~<6vv``|ffff6680>{2rއ<```|f~6<3|fffff~`~ff3c ? s333c66cck3~n۱6f[ۃ><~~<8x8#J6J[/ Lŀ[ŁU8Ƅƅ8ȱ݈֠ȱLƂƃƄƅL#<ө\P  `` / - x   LL L LLLLLLLLL LLLLLLLLLLLLLLL4L+LLLLLLL7L.L:L1LLLL"LCLFL=L@LIL%L(LLOLRLULXL[L^L` zL+ L LVL+ | V   E Z   Z  - ; I [  o0 &/   ` u08 hh  LV h  e` h 0 Y` ` h0 e` h   h  Hh0 e0` h  e`0`L 0 00` 0  ` h00`0000`L h    0 0H0hȱH0h0` h  0 00` h80000` 0 ` 0  ` h0` h0H00h0` h0`  s000 e` I'M DEAD! h   h H0 eh0 e` ^  3/YL} e` This ADVENTURE is over. Hit Y to try this ADVENTURE again I'm carrying yoo much. try: "TAKE INVENTORY" Ho0  &/   (/   * ~0    { H      d    y0 q  hy0h`  LE I stored treasures. on a scale of 0-100 thats: áէŠŠԡ _`L L {01|01 &/0 e` h   h  0 eH0h00 e`  00000.0&.0.0 80000800 й0000  `L L.00000 0 `    m0#0  >0  ~0 `   / 0 / 000ӭ000O0п0000 0.,L 0;0}0      000 /ȱ         q        ]ȱHȱh  PȱQ &/  H 0 -00h  0L L }0      g0h0 /  ȱ    e040f0*82 $/  Hȱh  L"84 {Hȱh   ȱ! [  L0L 0L I must be stupid, but I just don't understand what you mean I can't do that... YET! DID: PSBL: 0 `00 $ L0 H u0=  L I'm carrying too much! try: "TAKE INVENTORY" 1  (/Hh  0L/  L  0 i00/и   &/     0  L80L0ߩ +  e0`  /  H  ` ϭ0 u L HUH? OK I'M NOT CARRYING IT! I DON'T SEE IT HERE! I ALREADY HAVE IT ITS BEYOND MY POWER TO DO THAT. m ԅd8di` 0 &/0 u 08  LO    / ȱ 0 0)  LO P 0s00 eLO0 +  e` I FELL & BROKE MY NECK! I'M DEAD! ITS DANGEROUS TO MOVE IN THE DARK! I also need a direction. I can't go in that direction. on. 1LeLLLLL LLDLyLLLLLLLLL9L(LMLtL_L#LL3L+L;i  zȥ `ȱii`hhhHHH(lhhhhhH(lЯПлЏЫe(`ahbhchdbHa(      cdlchahb      abla(`LL8hh(`HHHHHH֥hh(`HHHH 8  h8(`h  zL  zȱLHeeh(`  zȱ `  zLp LfLL2LLL*LL.*AUp%1FZw` &/o0`  I````` 0 0` 0 0``   */  Ф``   */  `0`0I` 0 Ж`    o0ȩ30 &/  (/30 b    30      ` I'M CARRYING THE FOLLOWING: Not a thing!  Hȱh / .    ` Y0R Y0R0! &/0  L /0m0ȱ *      30o0 &/  (/030      b30     30   / ȱ0m030  30       з30  S8Rʩ  Y0R `ӠϠˠϠš I'm in a North South East West Up Down . Visible items: Some exits are:     /g0mg0g0ȱ       ȱ  qй   `   Z kW03/X04/<05/ V &/3/o0 V R V ` Saving Game C: D:SAVE. Disk or Tape? Ready tape then hit: RETURN RUT[    V/U3T` RYX V`ttL LpLiLLLOLOLL.!L$L}$L\!L!L  :  ! % :  eL/ " S Q"0 SL%  ^  S0     `* ADAMS ADVENTURE * (VERSION 3.9/) (C)'81 A.I. BX 3435 LONGWOOD FL 32750 This program will allow you to have an ADVENTURE without ever leaving your armchair! You'll find yourself in a strange new world. You'll be able to examine, get and otherwise manipulate the objects you find there. You'll also be able to travel from location to location! I'll be your puppet in this ADVENTURE. You command me with 2 word English sentences. I do have over 120 word vocabulary, so if a word doesn't work try another! Some words I usually know are: HELP, QUIT, SCORE, INVENTORY, SAVE GAME. The Author has worked over a year on this program so Now hit return  L(   8H    hL(  `    LZ    `   RLw  i@`8 ɀɠ _bY0 (('RLw XY (   `e`Rˤɀ y y Xɀ yL S`R`RS` X yɀH  y yLR hLw  @ 2/ 3/  y0 V~ 3/  ɛ    `   A/Ш Rrb V0 V Vrb/eu3dtkhi{xyS3/:4/ 5/ j VK3/z0 VrR'S   ! Rᩞ S᩟  3/S X`LRXRаSL X,L,R move margins and S to stop Y0 '( R `hhhHHHHH(lhhhhh(l o0    &/  */   w00x00{01|01}0 0`k00 0 0 i0"*i0 Ν0i0`i0 0Ξ0` &/& 1  11100 " ` "  1  " ` ԠӠԠ LIGHT HAS RUN OUT! #   3/  G$0j0X}0`A ੒`BXPTIN0V0E0NSEWUD ;# 00` 0/ ! $  0  $ L"00 G$00+ ./ ! *$  0  ?$ L"00` # L" Use 1 or 2 words only! ɠ I don't know how to "" something. I don't know what "" is.  0   `  ⎝0     &/  0` 00 00-080000 0  0   q 00 0  ` %  3/YN`Z k % W0 3/ ~%  s%L%<5/0 % s% &/3/o0` R V` ĠŠŠġ Want to restore previously saved game? RYX V`T+ IiJ KKOLLMNP_QRSTGTwTTTU7UHH[IH81<2NM# "FRISKING SABOTEUR" "RETURN STOLEN TAPE TOO" "" "" "" "" "" "" "" "" "." "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" 306 3 681 RS'"U*5)"'ZERO DISK SECTORS'"s*+5)"'COPY DISK SECTORS'"\+5)"'DISK BACKUPS/S3 # 2U=v$ @5Q'$GwGϬ?30622,$ $$'$ $(ANYNORSOUEASWESUPDOWTAP*RECREDWHIBLUYELGAMPIC*PAS*BAD*AUTAROBUTDOOWIN*GLAYARFIL*CARPROCASWATBOMDETWIRCUTCHAKEYENV*MANCAM*BOXSAB*HIM*THEMOPMAPPAI*PLAGREINVSUI*ANT*RADHARLEAHAN*FIS*FOO*FEEFLO*WALVATDIA*GAUDEB$AUTGO*ENT*WAL*RUNINVPOU*SPI*EMPHELGET*TAK*MOVCLE*MOPWITUNA*DISDRO*PUT*LEA*REMCHA*FOLREAPRE*TOU*PUSWAILOA*INSKICJUMSUISHOPULSITUNLFIN*LOCLOO*EXACLOOPE.BRE*SMA*CUT*UNBSAVQUISCOWEAKNOFRI*SEA*SHAACT*STA*PLA% briefing roomlong sloping grey corridor grey room9*I'm sitting in a grey chair there's a box pointing at metwisting white hallwaytwisting yellow hallwaytwisting blue hallway white room yellow room blue roommaintenance room 1large white visitors roomyellow corridor blue anteroom?*I'm on a ledge outside of a window high above the reactor coremaintenance room 2projectionist room(Control room surronding the reactor core break room reactor coresmall viewing room storage roomGood morning Mr. Phelps. Your Mission (should you decide to accept it) is to prevent this automated nuclear reactor from being destroyed by a saboteur's TIME BOMB! Nothing happenedMy bomb detectorwails ALARMINGLY!CLICK!I can't do thatIt appears lockedbutton is now unlockedBlueYellowfThere's a Bright flash & I hear something fall to the floor. I can't see what it is from here though. '* B O O O O O O O O O M ! * * * * * *The saboteur (who also rewired the security system) is a heart patient. He plans to SUICIDE with the reactor! He is still loosein the building. You'll find Security keys & a map in the manila envelope lying next to the tape player.politely beeps... angrily buzzes... Strange...:Most doors & windows are under automated security control.Metallic voice says:"Show authorization please" ("Authorization INSUFFICIENT for access" 9The door opens just long enough for me to scurry through.{I'm on the 2nd floor. Below I see the control room surronding the reactor core. There's a wide ledge just under the window.>In this Adventure there's NO score. Either you make it or ... 'Tell me with what? Example: "WITH FIST"Be sure I'm carrying it!QRecorder goes flying thru the glass landing in the control room.Boy what a MESS! ^Click! Room lights dim and a screen drops from the ceiling. You hear a hidden projector start.1The screen illuminates for awhile, but no movie!?=The projector stops, the screen rises, and the lights return.A movie runs telling about the reactor and its construction interesting highlights: 1) Plastic DEFORMS strangely in radiation 2) Even short exposure to HIGH radiation is LETHAL, so suit up 'The radiation did something to my pail!Holding a Radiation Suit^doesn't provide much protection for me as I fall down retching I hear/FEEL THE BOMB explode! _Welcome to Adventure number 3 "MISSION IMPOSSIBLE" by Scott Adams, Dedicated to Maegen Adams. A business suit#I'm WEARING an anti-radiation suit.It won't budge!"Something won't fit thru the door.I turn the knob and pushgently on the doorhard on the doorit opens slightly its closed the water spills on the bomb andBthe control panel which immediately shorts out triggering the bomb;defuses it! FANTASTIC, You completed an IMPOSSIBLE mission!the water soaks into the floorsay again & use a color!UI'm looking into the control room. I notice that the door is blocked by some debris.UIn the distance you hear a dull thud; as if someone fell or dropped something heavy.Something fell to the floor.its unreadableits still connected#Oh Boy...I think I did something...It made an odd sound."TV deactivated" I don't know where to look Tell me how?Try starting it.Maybe I should FRISK him?6Its a seamless box with 1 small hole for the red wire.+TV camera is slow scanning the window area.TV camera is powered down. It seems safe. Shall I sit down?>Only help I can think of is to: "Examine everything closely!" I see nothing special.HUH?WA minute ago someone ran out of this room! By the way I seem to be carrying something! 0Someone came in the room, he saw me and ran out!I see no one here. "Owner of badge is not present!"tHi! Look for Adventure number 4: "VOODOO CASTLE" at your favorite computer store! (Now back to our current program.)Final countdown starts inturns!Some time passes... There is something written thereOW! That HURT! Anyway "ACCEPTED"Torn up map/MAP/%Picture of me stamped -security-/PIC/1Bomb detector flashing yellow (bomb is now armed)Large tape recorder/TAP/$Box with apparatus pointing at chairChair bolted to floor(Row of 4 buttons -red white blue yellow-%Picture of me stamped: -visitor-/PIC/(Picture of me stamped -maintenance-/PIC/>Surgically implanted bomb detector glows green (bomb's -safe-)2Bomb detector glowing red (final countdown active) Blue key/KEY/ Yellow key/KEY/ 0Closed white door with tv camera mounted over it)Plate glass window with embeded red wiresPanel of buttons -white green-Old fashioned yarn mop/MOP/Empty window frameTv camera mounted over windowBroken glass/WIN/Empty movie projector#Movie projector with film cartridgeMovie film cartridge/FIL/Empty plastic pail/PAI/Water filled plastic pail/PAI/Vat of heavy waterWire cutters/CUT/Anti-radiation suit/SUI/Very large time bomb"Red wire going from bomb into wall$Strange lump of glowing plastic/PAI/+Sign "No beverages, Please use Break Room.""Yellow door with tv camera over it>Metal door jammed partially open by remains of a tape recorder Blue door with tv camera over it)Plain metal door with sign -control room-The door is partially openEmpty pill case/CAS/% 6 inch windowEmpty manila envelope/ENV/'Piece of yarn/YAR/(3Picture of saboteur stamped -window maintance-/PIC/)Dead saboteur/SAB/*Loose red wire going into wall(Steps leading down into the reactor core Yellow button Blue buttonKeyholes under buttons#Exposed dials and gauges everywhereA leaflet/LEA/1&     !< o< mBBBBBC-CVC}CCCD(D9DjDDDDDEE*ENEiEEEEEEEF@FlFFFFG4GJGXGtGGGGGH'H3HJHnH~HHHH     }< ;=#"6+ (%I=9 (12(9%% %-  -"""_=" - (3$+-%"(((( 4 ++*!"%65 #5556"&-9((((dd ddP(ddddPPPd4* =*    '..//  **=!* !!00033'*> 5V> 4%%;;;MF{">>>wpq<<H #;F5:>>>6uhi:0>0>646FFmG tFF::FFF;66FH4<4xiF,HH5FFFhI<FF:5:%6:3\>1%%6'')'F+*55fk:}w?L |:? /??yI ?? @@$ $F@@FF;gh-?F5:FH@<j? @((*)@553 @&@ J?O,@ <<7@ >@D@6@6@@h5?@666666:K@;>>>??'?K?a?s??????)@E@f@@@@AJA]A~AA BB(BIB_BjBkBlBEL[L|WLWL[WX7XoXXX>YoX]YhYYYY`<|fl0fF68of;p88pf< 80 0 ~~`0 0`7ggo;3s~s3``p?cccccs6<gn||lopp``cccwkc|vvvvw6cc633>006cco><66>333`>?ll 3333c>ccc6<cckwccf<6ccc6 ?f 3~@`0 xx6cF6>HH8pp8?** TT_H wwT*TUU]HHHx`x`~<~~<0~0 ~ <~~<6vv``|ffff6680>{2rއ<```|f~6<3|fffff~`~ff3c ? s333c66cck3~n۱6f[ۃ><~~< I8x8P.>J>J`|/ L-ŀ[ŁU8Ƅƅ8ȱ݈֠ȱLƂƃƄƅL-P.<ө D  l ..<ө|``Lf- B V,A#P, 1 <0 0L#L ߢ) 1*LPjL0\L3\L eL eLeLeLeLeLeL.LyWL.L.LsWLwjLSjLVjL_jLejLhjL\jLYjLnjLkjLbjLbLbLbLqjLtjLbLbLbLbLbLbLbLbLbLbLbLbLbLbLbLbLbLbLbLbLbLbLbLbLvW`ͿmIIJMK LLMOPQwST'U[UUUU+V_VG HHG812N "SHARPEN KNIFE" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "." "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" "" 119 4 562 7 4 560 "*I'm in the Armory" 11 0 12 0 0 0 "S/S4  w'W=w YAc :˰3gsk?119//,: (ANYNORSOUEASWESUPDOWKNICOFIDOINVKETHOLSWOPATWINCLODOOCHULABGRAWALBALMEDCHIWRI*PLASHISAFBREARMGLARINTUBFIRFLU*CHI38SOO33HEA*ANICHESTABAGPINSAWFOO*RABGAMSHOPAPSWEMAN*CRIDOLBOAHAMGRABUTPUPSTISTABOOCHAZAPPOTCELBARLOCLEDWOOVOISIGFLONAIMUMCRASAPROCAROCRY*RAV34353637LEAMOAPAGAUTGO*ENT*WAL*CLI*RUN.GET*TAK*PIC*REM*PULHEL*RES.DRO*PUT*LEA*THRDIGONWAVDUS*CLEPRE*PUSMOV*SHO*KICBRE*SMASAVREA.q OPECLOTUR*DIALOO*EXAINVCIR.QUIDRI*EATSAWMIXHAM.SHR.LIS*HEASTASHASLIDANYEL*SCR*SUM*SAY*CRYCUT*STARUBSMO.HUG 8chapelDingy Looking Stairwellroom in the castleTunnelroom in the castle *I'm in Medium Maegen's Mad Roomroom in the castleroom in the castleroom in the castleBallroomdungeon*I'm in the Armorytorture chamberChimneylarge fireplaceroom in the castleLabnarrow part of the chimney Graveyardparlor Jail Cell*I'm on a ledgehidden VOODOO roomroom in the castlelot of TROUBLE!XCount Cristo's been CURSED! There's one way for him to flee! Find it, and he'll go FREE!It belongs to the medium%Spirit vibrations drive me from room.%Prints too small for the unaided eye.I can't do thatNothing happened Windows openWindow just slAmmed shut1For a reading just "SUMMON MEDIUM MAEGEN" today!!I see nothing very special.=Phosphorescent letters are very hard to read in bright light!)Amongst the GRAVES is a four leaf clover.Raven crys something outsideOne of the test tubes EXPLODED!This glass can't be broken.They appear to be mixable.There's something written thereA sepulchral voice says:OK2Safe's combination lock is numbered from 33 to 38."Ring glows briefly & door vanishesOUCHA sign here says:There's a man hereWearing a sapphire ringI slide back downA beam of light shines on gravePins fall out of dollPlaque says: "safe --> 38 33"This grAve reserved for you!There's a CLAP OF THUNDER!RJu-Ju man says:"My bag is now yours! Its magic will help you -CRACK- the curse!". HURRAH! Look who is in the room!I'm now 4 feet tall!It's much to heavy to LIFT! I'm too big"You startled medium & she vanishedOn what?XMaid chased me with broom for tracking soot through the Ball- room. I wonder where I am?CSweep pops out, thanks me, hands me a piece of paper then vanishes!(As I dust of the Idol it begins to glow!He's wearing a rabbit's foot.HELP ME, I'm stuck!Luck wasn't with me!2Doll looks like Count Cristo. There're pins in it!.pBird says: "ask for ADVENTURE 5, -THE COUNT- at your favorite computer dealer. It will be LOVE AT FIRST BYTE!" There's some soup here.I see a hole under it!%Nails were rusted but I got them out..It's hArd work but it seems to be coming loose2I hear strange sounds, as if someone were moaning. I've got it!.Heavy duty exhaust fan comes on & sucks me up!.6says: "SAY ZAP to restore someone changed to stone!"Statue is made of stoneI hear nothing. won't budge!+I'll need something to pry it off the wall!It's a book on removing curses. Says: "With knife in hand you take a stand. Circle coffin and..." The rest of the page is missing!!!/Its very dark, the only light is from the idol.That's illegal!@Double bubble toil & trouble the encAntAtions Are About to peAk!There's an antique hammer hereThere's a Clap of Thunder & then suddenly the stone statue begins to crack. I may be in trouble now, there's someone in the room with me!"Looks almost like lemonade. Yummy!@You've been turned into a broomstick & a witch rides off on you!There's witch's brew thereCell door slams shutYou've been sprungw...wave the stick and hold the lamp and don't forget to yell "CHANT"! Oh yes, to help it succeed, a doll you'll need...OWelcome to ADVENTURE:4, "VOODOO CASTLE" by Alexis ADAMS. Dedicated to all MOMS!how?It appears stuck to the floor! There's no room in there for me!My idol acted strangeI've no container.,Some dust fell off it and it glowed briefly.Its very faint.Its much louder up here.There's a book there.There's a stick there.Boy it looks dusty. Its glowing.Strange hobby you haveCheck out the fireplace. Its empty.I hear someone mumbling.. Saw grating!I haven't got a knife!$Inscription on ring says: "WAVE ME!"Medium appears, says: "Keep a good luck charm on you & your friend. I also see a -moving- bag helping you through a tight squeeze!"6It will take some strong magic to get me through that! Use a number!Knife made no impression on it!Bloody Knife/KNI/Ledge Plaque/WRI/Animal heads/HEA/Broken glass/GLA/ Big kettle Dark hole Shield/SHI/StairsBrightly glowing idol/IDO/ Open Window Dark Chimney Closed Flue Open FlueFour leaf clover/CLO/GrAvesCast iron pot/POT/ Closed Coffin Crystal Ball Closed WindowLarge fireplace Soot/SOO/Tiny open door Spirit Medium.Massive stone door with a SAPPHIRE set into itSapphire ring/RIN/Ju-Ju bag/BAG/ Open CoffinSlick chute leading downward Ju-Ju manSlippery chute leading upWide crack in the wallRabbit's foot/FOO/ Dull & broken sword/SWO/! Open SAfeStuck Chimney SweepChem tubes/TUB/$ Closed SAfeLabeled chemicals/CHE/&Pocket Shovel/SHO/'Mixed Chemicals/CHE/(Wide open door Nails/NAI/*Dusty Idol/IDO/+ Doll/DOL/,Wooden boards/BOA/-"Wood boards nailed to chimney wallAntique hammer/HAM//GrAtingRusting SAW/SAW/1Button in the wall Paper/PAP/3Voodoo book/BOO/4Ju-Ju man statue/STA/5 Stick/STI/6 Open wallOpen jail cellKnight's Suit of ArmorClosed cell doorBroken grating/GRA/;Advertising leaflet/LEA/<Crack in the wallHole in the wallPieces of rock/ROC/?Page torn from a book/PAG/@Smiling Count Cristo    {   3K CC C-C@CSC^ChCuC|CCCCCCCCCDD"D2D=DLDZDDDDDDDDE%E?EIE]EnEzEEEEEEEEF*F?FGFYFlFxFFFFFFFFGG/G@GUGqG    ]  5M _ &*  * ***&'**& 0&' & #*-* &* ((*#@#0@" ,  #**@ ** *'02/*8 #6#&* #88 *EE* <**28&>8?@  3H*E8 I 2#& ((((#&HH(((Kdd-d2dd##dd#4,CC  +## #W"  ,,*((%',?*A1 (/5-437@KB*B// =;M+99Y,C,F ,??== QKJ88*4 B!WM+STUV  E'%7 H69(9hhh.}o FB54 4F5HH68 6H4 HH=46I:w44:Hq6 ;;vGBo')l/+I5y446*;oIXg5j?m!44|~ 1hh644446{16-f544H~Ln4s6<<<i'8so'wHv'>4 44(4;4B4U4v444444444455-575>5H5X5k5~5 ' '' ' ' ' ' ( ( ((.(04(.:(@( 5556'6M6]6n6{6666 7J7g77777777.8Q8V8h8{88888891999999::g:::::;;O;Q;;;;>U>t>>!?b?}???@m@r@@@@@AA1AGA^ArAAAAAAAAABBBBJ(HL[L|WLWL[WX7XoXXX>YoX]YhYYYY`<|fl0fF68of;p88pf< 80 0 ~~`0 0`7ggo;3s~s3``p?cccccs6<gn||lopp``cccwkc|vvvvw6cc633>006cco><66>333`>?ll 3333c>ccc6<cckwccf<6ccc6 ?f 3~@`0 xx6cF6>LH8pp8?** TTcH wwT*TUU]HHIx`x`~<~~<0~0 ~ <~~<6vv``|ffff6680>{2rއ<```|f~6<3|fffff~`~ff3c ? s333c66cck3~n۱6f[ۃ><~~< I8x8"Ja