@L}5 _$% l0$)$$Hȱ$ UhL" `e$$%`$%`  R@P!( L(1   Y I`  d  Ld M * @  $ % CC$$)%1 Udߥ$9%: !0 S$% DD˙`  }J)Lr `!`H$-%.HH \hhh(`.HM)   !h(L`N) !"`3}!3Z   HH)H  }p h  hyhy D L> L JJ    ! LA*` BF }7'8  M HN H` 8 Z  \LdJJ!"!GFE@F (!L}EE !E^ ^ E E7EȩEdE/EȩE  D} .L }  ;F d  ;?F7F? ( .   Z D LL d } . D  L    p  E` , d)  D L) 0BM݊L݉} ML  N݆ L NLML [ TEqEHȱEqEh 0Gȹ G} HLL GɛL  LFREE SECTORS G) *Gȩ GȽG GȌ*jj >G}}') S)) 1 y0Yr( 1B*D)EJ 1 B 1 .{+)} 1 //3Hu ?}ξL/L!DRIVE TO WRITE DOS FILES TO?WRITING NEW DOS FILESTYPE "Y" TO WRITE DOS TO DRIVE 1.D1:DOS.SYSERROR - NOT VERSIO@}N 2 FORMAT. t* 5) 1L!`) 0NΞ 0 L1) 1 L!BAD LOAD FILELOAD FROM WHAT FILE?) 0 A}0#B 1L!WHAT FILE TO LOCK?) 0 0$B 1L!WHAT FILE TO UNLOCK?DUP DISK-SOURCE,DEST DRIVES?TYPE "Y" IF OK TO USB}E PROGRAM AREACAUTION: A "Y" INVALIDATES MEM.SAV.FE! +L1   `*  70 2 2C} 0.* 1 y0 0)INSERT BOTH DISKS, TYPE RETURN^, 1 y038逍 N, 1L! ,D}C, t*  Lx+, 0 ^, 1 y0 , ,0,0 ,L+ ,I0 ,Vǭ0E}Ξ, 0 }, 1 y0C,ШC, 0K'!" H H 'h h Lx+!EF 5L1L!D,I,HhF}` NOT ENOUGH ROOMINSERT SOURCE DISK,TYPE RETURNINSERT DESTINATION DISK,TYPE RETURNG}`  `8 rL1`-* 1P* 1 y0Y`hhL!NAME OF FILE TO MOVE?- 0 0|DL% <.H},^ 1 70 0 .@L# .BJ 1  DEHIB V L1 ,} 1 70,L.  I}JB|,#P#DE 1 HI BDEHHII 1 B 1 ,^ 1 70,0La- B V,#PJ},^ 1 70 0L#L!-* 1P* 1 y0Yj383}mm ݭK}}`8}``|* ? ɛ,`|:-)| / 1L!`DESTINATION CANT BE DOL}S.SYS0 0H{ 24Δ 28/L!/) 2 Π 2 0 ξM}hAΞB,0 J 1 BDEHI,HÝDE 1HIHIDELSAVE-GIVE N}FILE,START,END(,INIT,RUN)O S0 1`BDEPHI V` S0H 1 L!O}0 0 1L~0`PLEASE TYPE 1 LETTER,0`hhL! 70 1L0L<1 ,;ɛ7,"ɛ:ݦ1ݥP}A"D|ݤD|ȩ:|ȩ|ɛ,,(/+.ީ1 1,ɛ`轤{NAMEQ} TOO LONG B VL!` L1I H1EΝDL1|mDiE` V0`8d/8 i:222 1 LR}!BOO-BOO 129ɛ+,' 20*.. өr2 1``2TOO MANY DIGITSINVALID HEXAS}DECIMAL PARAMETER800 0 8 00`,0'D800 H,ɛh`2L1NEED D1 THRU D8uT} ECIMAL PARAMETER800 0 8 00`,0'D800 H,ɛh`2L1NEED D1 THRU D8uPP PTU PSetting Up ATARI 130XE RAMDisk U PRAMDisk Not Formatted! U P    V} P@BDPEJK V@C08? PiLPhPhPPP PLPPHPH`HI BLV P}`@ W} BLVDPQ8:DUP.SYSPK V@C08? PiLPhPhPPP PLPPHPH`HI BLV P}`@ O) !"`3!3:,*2B:,"@A` A0/ +@-/(@TURN DISK OVER/-@/(@}THEN PRESS ANY KEY5AdAU)& A05% D:PROG.BASo+A%A @7-@}@Q(NO PROGRAM THIS MONTHc-@@oARB'(FLIP DISK AGAIN AND PRESS A KEY1 A08)B A}6 (}-@ @ 6( What's Your Pleasure?_B7t@d'@@d9-@@X(en}u rint ead: _)8"@w((.( Main Menu....8 A"@AP8"@(}(.( Read File....8 AF.-B:,6. D1:**.TXT.67<,.7<,F A"@A )}5@<(}F A5p  A4F:A,"A6*@@@4 A5P**"@e*F:A,"}ApA!`pA @4@e*F:A,"Ap:(}L-@@p(Not In This Months News Lette}r! AF AF! A!` TA @'A@hT((} 짠򠠠 00(}( à aB7t@d'@@d4@8(D@waF:Ad,"}AFA5P F:@, @"A5  E(3(' 堒EAdAU ''F:A}d,"AU*T:,"A5@ %AdAU(}% A5 ZAdAU(0(Z($Press }a Key or Trigger for Next File ''F:Ad,"AU*T:,"A5` *@@@'AdAU*$NA }%6.D1:PRESSPRT.MNU*5G@@@N(}((6-C:hhhhh Ȅԩ`,!A@h}!A " A@`(" A@@A @QB7t@d'@@d9-@@ }J( Selection: Q)!!"@i)"@eAH"@xAC,"@c' A@@}A@TK AD(}3D1:PRESSPRT.HLP= A5G A@KÛC6-@f6-@V!6-'6-36-}@96-C AI0S6-F:A,"A6E(! Viewing Complete Press Any KeyL)O$SÛDU (}-@}@'"A8K(Your Printer is Not On Line...U AFX<"Ap2(Printer Help File Not Found...< AF}b= (}-@@3(ERROR # F:A,= AFl A@-A $7@6-!"}@e'6--6-7 AH@F (}-"(PRINT STYLE?0( . DRAFTF(. DOUBLE STRIKE0)@6-&@d}0 )!AH U (}-3( PAGE COLUMNS & LINE SPACING?U(. 2 COLUMNS AT 6 LINES/INCHh%(. 2 COLUM}NS AT 8 LINES/INCHG(. 3 COLUMNS AT 6 LINES/INCHh(. 3 COLUMNS AT 8 LINES/INCH( )( @e)!@hAH@}g6-@f6-@V'6-@-6-C"@f)"@hO6-@[6-@g6-@v!@f6-}$I (}-!( PAPER TYPE?4(. CONTINUOUSI(. SINGLE SHEETS8( )( @e)!@fAIB"@f}6-&'ÛL$/ 6-6. D1:**.TXT6-%"/ A@E (}-@@>(dd, ven, or ll} Pages?E)++@e*@y*@iAPU (}-9(%LOADING BUFFER before Printing.....U(Use }-P to Pause+(Use -C to Cancel+-@= 6. 67,.67,.#6.)6.16-%=@w/} - A`6-'6-@@/-"F:Ad,"A8" AU,F:Ad,"AF", A&} &APAQAQ 67<,. AQ@67<,. AQ@67<,.! 6-%6-%@9 }! "F:Ad,"A8" AU#,F:Ad,"AF", A$..'@"P:'@,*"@yASE}%..'@P:'@,*"@iASE(9 A&@P:,"9(@=2 "(G}F6  '6-+",$%+",$+@&,6(=:,PN (((":6-+",$@ %+",$@G*@'}N*Z: 6-6-@@-$6.*":6. _"F:Ad,"A8" AU`,F:Ad,"AF}", Ad<67B:,%,.7<,)67B:,%,.7<,<67B:,%,.7<,n"6-?: <--|| $}  ||  || Atari User Group Inc.(c)1985 |*** Alex Pignato, Pre$}sident ****** 3376 Ocean Harbor Drive ****** Oceanside, N.Y. 11572 ***$}|Charter Member NEAR*US ATARI USER Gp.|| 砱 |$}|Charter Member NEAR*US ATARI USER Gp.|| 砱 |$9:ATTFSPSCROLLTXTTOLONUCENTEDELADPOA(} (}SAVE "D:OHSCROL4.BAS ;@$, uA](C}THE FOLLOWING SCROLLING PROGRAM (}ԠŠ AS SIDE 1!q-@Au d!!6.heЭ Ѝ F@e*AF:A@,4+(}@#FAA2g @,@5@1/A%@C/A%@U/@5@gAe@(}=-@5@=@@S: LOGO 9 @6-@ %6-@v9-@(}@ / ,/,A`&+/A`&/  R-@A#!@R6-@C%M:A&&+A&,$+(}A&,, 226-@E%M:A b&+A&,$+A&,, Q ,/,A`&+/A`&/ C-@A(}G Q A 6-?:C:,,(#""****ATARI SCREEN SCROLLER***2#""****(c) 1984 Jeff Brenner***3#""MODIFIED BY GRANT RI(}CHARDSON4#""********OCTOBER, 1989*******5#VV**MIDWEST ATARI GROUP, IOWA CHAPTER CHAPTER** ADAPTED BY OL'HACKERS A.U.G., I(}NC.7#=A=(#} PLEASE WAIT- INITIALIZING!<#!!104,169,000,141,014,212,169F#!!022,141,036,002,169,00(}6,141P#!!037,002,169,064,141,014,212Z#!!096,008,216,165,206,230,206d#!!197,207,208,051,169,000,133n#!!206,024,165,203(},105,001,133x#!!203,201,016,176,005,141,005#!!212,208,031,169,000,141,005#!!212,133,203,024,165,088,105#!!020,133,(}204,165,089,105,000#!!133,205,160,000,177,204,145#!!088,200,192,220,208,247,040#104,168,104,170,104,064#!6-F:(}AH,!6-F:AI,#"@ AP#6-@#O;@ ,(67@,.>:@2,@67@ ,.>:@2(},O67@,.#;;A,;@ ,'6-;-@@#56-C:,%@"%6-P:'AV,56-&$AV(}#767@<@,.>:,767@<@,.>:,$"67<,.>:,$ 6-%% $5BP2 THERE IS (}AN ERROR IN THE DATA.5&"$6-@6-@,$;"6-@;67@A<@A,.>:@,6$EA(}&@)A;AE#A@$/ +@/6-F:A`,%AV$F:Aa,J$k0@@(}70@@@Q0@@ @k0@@@T$>0@>%@(}F:%@,%@2^$0-%@%@,F:,%@20 h$!6-?:C:,,!AdAUr$"F:Ad,"@3(}" A0|$"F:A,!" A0$#-@# @$("4REPEAT#A( A`$ (}4END A0$9"!-@/ @9 A$T6-+@ &B:,,'@* @<-(}@J @T A$/-@/ @7@<,$"F:A,"" A$ A@(}$?BB!AH-AI?BB@d$''Display data begins at line 9500.%EEHI 8 BIT'er,NO(}W THAT YOU,,,ŠΠ,̧ A.U.G.,%CC,ӠŬWHY NOT,join us? We are,, 8 BIT,atari%ddcomp(}uter users, since 1985!,,WE HAVE MEMBERS ,̠ҠŠ , dues are ,$24.00 ,,,%77,(},, %FFWE ARE ABOUT ,,ΠĠ,,,,!%??NEW PROG'S FROM ALL, over the(} ġ,,!,"%WWFOR MORE INFORMATION,WRITE TO: ,,̧ӠծǮ,ΠҠҮ#%,,(} ήٮ,516-$%,,MAKE CHECK ,,%% ,&% RON FETZER,,END'%CHAIN PROGRAM(}(%% D:NEWSLTR.BASD:OHSCROL4.BASKE CHECK ,,%% ,&% RON FETZER,,END'%CHAIN PROGRAM(, ===================================== Check the Basics First by Thomas J. Andrews, member of ACE of Syr,}acuse, and OL' HACKERS. (Reprinted from the ACE of Syracuse Newsletter with permission) 1050 DRIVE PROBLEMS? Rec,}ently, one of my disk drives started acting up. It would have trouble booting up disks known to be good, and so,}metimes would take a long time writing to a disk, an indication that errors were occuring. DONT JUMP TO CONCLUSIONS. ,} I began to assume that the head was dirty, or a track sensor was gone, or something even more devastating was happen,}ing. THINK BEFORE YOU LEAP. I was ready to pull the screws out and try to find out for myself what was wro,}ng, but I did something smarter than that first. I checked the basics. THE BASICS FIRST. I looked at the c,}able connections and found the power supply cable to be only halfway plugged in. Don't ask me how it got that way-it j,}ust did. I pushed it in all the way, and the drive problem disappeared. This sort of thing happens all the tim,}e, so don't assume all connections are good just because you haven't disturbed them lately. When something goe,}s wrong, check the basics first! It might just work....and save you a buck or more! (Editor. Just this past week m,}y 1050 refused to boot up when a disk was inserted. I remembered reading this article in preperation for t,}he newsletter, but I was sure that I had a $$ repair job on my hands. Then I remembered that just before the unit w,}ent down I had heard a funny sound as I inserted a disk. I didn't want to open the unit, although I do know how, but wh,}en opened I probably wouldn't know what was wrong anyway, if it was an electrical problem. Wait just a minute, be,}fore I turn the drive over to a repair person, I decided to grab a flashlight and I looked into the slot. Yep, there,} was the culprit, a small piece of paper had gotten in with the disk and was lodged under the head. I often ma,}ke printed or handwritten notes to myself and put them into the sleeve, and they have a tendency to slide into ,}the folds of the disk, and unless you look at both sides of the disk before putting it in, the paper can easily go in,}to the drive with the disk, and then gets free of the disk somehow and remains in the drive. A pair of teezers and-B} <<<>>> (A letter to RON from one of our new members, OCTAVIAN GRECU in Bucharest Romania, recently receiv0}d. Thanks OCTAVIAN for sharing your world with us!) ** Greetings to the whole OL' HACKERS USER GROUP0}!!! Dear Ron, Thank you very much for sending me the 12 disks of programs, and doubly so for making me a m0}ember of OL' HACKERS ATARI USER GROUP. I hope you don't mind too much, but I'm really not that old. I'm sorry if my0} postcard misled you in any way, but it was simpler to tell things that way than to go into all the details (there0} wasn't room on the postcard). I really hope you will let me remain a member of your club!! I'm a 24 year old e0}lectronics student here at our local university, nearing the end of my next to last year of study. My father was the o0}ne who actually purchased my ATARI 130XE w/1050 US-DOUBLER disk drive in '89 while he was on a short trip in the U.S.0} I obtained your address from one of the very few issues of ANTIC he purchased during that period. I learned my 0} English at Public School 116 in N.Y. City,where I attended for my 5th and 6th grades. At that time I had the excellent 0}luck to accompany my father while he was posted to the U.N.in New York City during 1981-1983, but I haven't 0} left the country since. In '83 a law was passed making it impossible for any- body working or living in foreig0}n countries to take their children with them (not even newborn babies!). When I first came to New York I had no knowl0}edge of English at all, and I've tried since to stop forgeting what I learned by reading a lot of books from the lo0}cal American and British Libraries (although there was a period when it was considered highly suspicious for anyo0}ne to associate with any foreigners). What else can I tell you about my day to day life, here in Romania? A bi0}g problem is the low quality of public utilities services (did I get that right?). Practically every time the outside 0} temperature drops below -10c (14F) the cooking gas pressure drops so low you couldn't boil an egg inthe flame and tap w1}ater gets turned off at night from 11pm to 5am. Hot water puts in an even rarer appearance, usually in the1} morning and late evening (never at the same hour). This causes temperatures in our apartment to frequently drop1} below 14c,(57F) as it is supposedly centrally 'heated' with non existent hot water. Since the Revolution that1} took place here in December '89 resulting in the overthrow of the Ceausescu dictatorship, my country has, like m1}ost other Eastern European countries, embarked in a plan to restructure the economy into a market driven on1}e. There is now an abundance of western goods to be found in the many small shops that have sprung up practically over1}night throughout the city. The only problem is that, due to inflation, only people engaging in black market activities1} can afford most of them. As the government relinquised all control over prices, the 'market economy' concept seem1}s to be interpreted (by most merchants) as meaning "get the highest price you can for your product - no matter what it1 }s quality". The concept of competition driving prices down, while highly publicised, has yet to be put i1 }nto practice (if at least prices were stationary, but they double every few months). In the past (before '89)1 }, it was highly risky to correspond with any foreigner, and all mail out of and into the country was routinely1 } opened. They don't do this anymore for letters, but they do open any large package (in front of the recipi1 }ent) to impose import duties on it. And it seems that everything is taxable! There is a tax-free limit of 5000 Lei, bu1}t these days that is worth nothing (a 5 1/4 floppy disk is valued at over 1000). I was very fortunate that they di1}dn't ask me for any duties for your package. It does'nt seem to matter what you actually paid for someth1}ing (I sometimes manage to obtain free samples of IC's), because there is a catalog according to which they1} estimate the prices (the latest discovery is estimating the value of an integrated circuit according to its n1}umber of pins). The inport duties are 20% for electronic products, plus 18% V.A.T. on the total of esti1}mated price + import duties (totalling about 42%). The fact that the government liberalised the exchange ra1}te of Lei to foreign currency has had an extremely detrimental effect on the average citizen's buying power. Th1}e exchange rate has gone through the roof (it is now officially over 2000 Lei to a $). The prices seem to be based1} not on manufacturing costs, but on the exchange rate, causing the average family (mine included) which earns around1} 150-200,000 Lei a month to try very hard to make ends meet. Our economy has also been hit very hard by first the G1}ulf War, and now the war in the former Yougoslavia. Iraq was a large trade partener of my country. And the former Y1}ougoslav republics, by their very nature of being neighbouring contries, are very important to our economy.1} Unfortunately, the fact that Romania (and other countries in the region such as Bulgaria) is strictly respec1}ting the U.N. embargo against its best interests is being ignored by the interrnational community, and no compensatio1}n (of any sort) will be forthcoming. About other equipment I own: just a Commodore CM-141 color monitor1}. Would you happen to know anybody willing to send a XEROX copy of the service manual for this monitor, as i1}t is starting to show its age? I wish I had a printer, but with prices being what they are this is not likely to happe1}n. A friend of mine was recently trying to purchase a 9-pin printer for his job, so he phoned every firm in the equi1 }valent of the Yellow Pages specializing in computer equipment, and the lowest price he found was $800!!! But, I can 1!}tell you that trying to programm while only having a screenful of program at your disposal at any one time is1"} an ordeal (and reading docs with a text editor stinks). Anyway, more important to my future career would be an IBM1#} compatible computer, since most good engineering software was written for this computer. But, prices being what the1$}y are (an IBM '386sx type with modest capabilities costs well over 3 million Lei - as a comparison, in '89 a new ca1%}r was 75,000 and a new apartment with 4 rooms was 200,000). As for owning a word processor, I'm afraid that I1&} only have TextPro, which satifies my needs for the time being since I have no printer. On this disk you will find 1'}some programs that I hope you will enjoy written by a friend (pen-pal) who lives in Prague that I very recently me1(}t last month. His favorite operating system for Ataris is SPARTADOS 3.2d (as is mine, besides MyDos 4.51)}), so most of his programs were made to run under that system. Some are quite excellent, as I'm sure you will n1*}otice! All of them are public domain (I noticed that you already have some of them in your disk library). The t1+}hird disk is from Austria, where a young computer science student wrote a program for IBM PCs to make them r1,}ead MyDos formatted disks (using it is the only way I managed to print out the MyDos documentation at our fac1-}ulty). As he told me he didn't have the similar program for reading SpartaDos disks that you have in your library (#1.}224), that will be one of my choices for the disks you so graciously offered to send. Two other choices would be1/} disk #242 (for TEXTPRO 5.0, as I'm writting this on version 4.0M which doesn't work perfectly with Sparta) if 10}it has the docs for Textpro, otherwise send disk #227, and disk #266 for UUE.ARC (I hope that soon I will be able to se11}nd and receive E-MAIL on the Internet using the only computer connected to this service in the whole faculty, so I wi12}ll need this). As for the rest of the disks, I will have to think about what to choose (there are so many I find interes13}ting!). I noticed that in your library is a disk for ANALOG #60 (disk #51). I want to point out that the14} DETOKEN.BAS program has some bugs in it that prevent it from operating properly (at least the one I have - the o15}nly issue of ANALOG with disk I own - does), so I included a fixed version of the program on this disk so you can 16}replace it if you wish. Also, while reading the docs for the Turbo Basic Compiler (for which I thank you once agai17}n) I noticed a small inaccuracy: it is possible to save a compiled file to a disk other than #1 by entering the drive18} number before beginning to type the file name. In case you are wondering how come I happened to send y19}ou this mailer from New York City, I asked my father to contact a colleague of his that works there so he could drop1:} this in the mailbox. The stamps are mine (re-cycled from old letters sent from the U.S.), as is the mailer and the 1;}disks (both obtained by requesting demo software). I hope you won't think I'm cheap, but mailing you these disks1<} from here in Romania, besides being very risky and taking a long time is also rather expensive. I wish you lots 1=}of happiness, and a long life to O.H.A.U.G.! Sincerely, Octavian Please excuse my lack of style in writting (1>}my sentences tend to become unbearably long), and be kind enough to attribute my probably numerous spelling error1?}s to typos. (Ed. Please note that RON FETZER, out of the kindness of his generous1@} heart sent OCTAVIAN the requested disks as well as th 12 disks mentioned in the beginning of this letter. RON proves 1A}that OL' HACKERS do their utmost to spread the 8 BIT word. Thanks RON you are a winner!) >>>>>>>>>>>>>>>END<<<<<<<<<<<<<2} I was back in business. So, as TOM says, check out the basics before concluding that you are stuck! A.P.) =============-C}=========================So, as TOM says, check out the basics before concluding that you are stuck! A.P.) =============,**P0P1P2P3MDLVDLPDDLTDLPDLBDLPOKCRSINNSAVMSSMENLMARGNFILPFNPSSPTITLEADNCHOICADZMP5E}INORCNVINOUTMODSPLITEMPHLPRTGNDNUFNULFCNDIRFNCHBAPMBASPTVVTSTARDLISNoEEoFe5F}FoK((K""KK""K## L Bsa Bsa AR @@BSB6@@5G}  * " (  66 k!A`"5H}AB#{00$%&@'(Z)B*+, qq-@v.@/@015I}23]4 56AD7L x8@ 9@:;B?SAVE "D5J}:PRNTTOOL.BAS Ԡ̠ƮӠ(}s;@,;5K}@,;@,;@,;@,;@,;@,;@,;@,;@,} A 2Πՠ5L}<@)6-?:<A`&):@:1,*@:2,='@$! (>:,6.D67,.>:,!$ŠӠ&6-F:B2y,5S}&"@A@AdAU$ҠԠƠΠ(6-?:<<%,(}%6-?:<<,($B"6-?:<<5T}%A <A<,((}?6-?:<<<A<,B$"ԠŠ,6-?:C:,:,>:,>:,!'6.-6-7 A^$hˠҠrH"(ˠ5W}٠H6-?:<A`:%A(,$ A@$% 6-@ Ap%- HF:@,"@ 5Y}-@!$+F:,",H-@!$+F:,"@!,1(1F:@, @ )F:, @!A p-@@ :(5Z} Press to finish directoryL-@@!p(Press à to enter filename )@'A 5[}6-A Ap Ap( -@ % A($ԠҠ""(Ԡ5\}٠V(  @6-+"@,$@%+",$%V6-?:<A`:@5a}4,A>:@4, to use the normal ATARI font.* )'>:,01*>:,02*>:,0A*$#>:,4A AVA$5b}#$" 6.D67,.>:,"67,.:E%(Enter character set filename.+4(>;B4E$v67@,5c}. 6-%@* Ap;@v6-?:<AP<@<AR<$AV<AV<A$,36-?:C:hhhLV,<5d}@,$0AV3$ŠŠ4"(ŠŠ4( E$(Enter a line to pr5e}int below.E((maximum - 3 physical lines)F-(%Press on a blank line to exit.0(F6-?:<A`o*("Press Ԡ to enter a new line.S($Press Ԡ to reprint this line.o(Press Π to exit.H 5s}A@"$R"@A\66-A@ Ap%-@,(6 APfԠŠpN(File5t}name to print? >7(( to exit)>E4K6-N$z! 6.!B:,")B:,"A  7<,4D:6.7,5u} 6-''7<,4D1:)7<,4D2:A 07 6.6.D67,.=:,(67,.:767@,. 6-6- !5v} $B6-?:<<<<,&-@@6( B-@$( !6-?:<<,$$ŬҬ5w}Š;( ҠŠ1(Enter your title below:4(;(> 4$5 6. 67A ,.#67,.,65x}.56-B:,Q -67%,.:67@@%,.>:@:7,,%A(,M67@x%,.Q ]67%,.#67@9,5y}.767@A%,.I67@w,.]67@y%,.$B( ҠŠ.(Enter the date below:1(8(>5z}?B$G(ҠҠ3(Enter author info below:6(=(>DG$$ԠŠ.' @ '-@5{} @8T(ԠԠź9(堠T(B9(5|}9(L*-@@*( V& )& @:1,)!@:4,Ap`6-&@H5}}j.>:,41"6. 40 Col. Large.6-@ut/>:,42#6.40 Col. Medium/6-@v~/>:,43#6.80 Col. Me5~}dium/6-@v/>:,44#6.160 Col. Small/6-A" A-@ @T(ԠŠǺ5}9(蠠T(蠠8(蠠8( ! ) @5}:1,)!@:3,!$%>:,416.1/6 in.%6.2%>:,426.1/8 in.%6.0&>:,436.1/9 in.&6.5}A$ԠŠ4 ((ԠŠ4A;6-?:<A`:AU,z 6-z6-?:<A <<A<AR5}<B2V<<B2W<<B2X<<B2H<@D<B2I<Av<AY<@F,*@A'B7tA*$5}C*6-?:<%<<%@<<%@<,26-%@6-%@C$̠ǠӠ40,34,29,34,35,9D4:PR5}NTTOOL.BAS4 +=+=+ PRINT TOOL 9.0 PRINT TOOL 9.0 --- a multi-purpose printer utility for Epson 9} or Gemini printers. Program and text by: Charles F. Johnson CIS # 75066,404 (File will be found on this disk.)9} PRINT TOOL is a BASIC program that will let you print out any ATASCII text file with its CTRL graph9}ics characters and all the other special ATARI characters just as they appear on screen. It lets you use any characte9}r set that you wish (as long as it is stored in the standard 9 sector form used by most character editor programs), and9} will also print the date, author, and a nice boxed title at the beginning of the printout. This program is es9}pecially good for printing files that have been printed to disk with PaperClip or SpeedScript. PRINT TOOL also lets9} you print out a directory listing in 2, 4, or 6 columns, or enter a line of text to be printed at any point. There 9} are three sizes of text available; all use the entire ATARI font or any alternate font you wish. You may also9} choose between three line spacing settings. PRINT TOOL is designed for the Epson or Star Micronics (Gemini) printers.9} Using PRINT TOOL. When you run PRINT TOOL, the first thing you see is the OPTION MENU. Below 9} the menu are several lines which will hold pertinent information as you use the program. The menu selections a9}re: 1...Disk Directory. This command will display the directory of drive one or two in a double column format9}, and then ask for a filename to print. If you want to print a text file from that disk just enter its name, wit9}h no D: specifier. If you're just looking at the directory or the file you want to print isn't on that disk, hit RETUR9}N and you will go back to the OPTION MENU. 2...Print Directory. This will print the directory of drive one or 9}two in the currently selected print mode (see change Print Mode). 3...Load Character Set. This command enables you 9} to load a character set file from drive one or two. The new character set will then be used during any printing9} as well as displayed on screen. This option also allows you to return to the default Atari font. 4...Typ9}e a Line. You may enter a line of text (up to three physical lines) to be printed in the current print mode an9}d character set. Any characters may be used. 5...Enter Filename. This option lets you enter the name of an ATASC9}II text file to be printed. If you want to print out a BASIC program with all of its special characters, you should 9}first LIST it to disk and then use PRINT TOOL to print the LISTed file. A SAVEd BASIC program is in a tokenized form,9} so if you try to print that, you're bound to have problems. Some word processors will allow you to print 9}text to a disk file, which can then be printed with PRINT TOOL (say, with a nice redefined font). (Ed. I beieve that thi9}s can be done with 1stXLENT & ATARIWRITER PLUS, maybe with others.) 6...Enter Title. Lets you enter a title for the fil9}e you wish to print. The title will be printed with a border around it, at the top of the listing. 7...Enter Author.9} Lets you give yourself (or whoever) credit at the top of your printout. 8...Enter Date. The date will be print9}ed on the same line as the filename and author information. 9...Change Print Mode. This option allows you to s9}et character size and line spacing. The character size will determine how many columns are used when you print a di9}rectory listing; 2, 4, or 6. 0...Print File. This is where you go after you have everything set up the way you want9} it. If you haven't already entered a filename to print, you will be asked for one. If you just press RETURN you will e9}xit to the OPTION MENU. The lines beneath the Option Menu display print size and line spacing, the name of the file 9}you have chosen to print, and whatever data you have entered for Title, Author, and Date. PRINT TOOL sets your 9}printer's "skip over perforation" feature so that you'll have nice, separate pages in a long listing. I've found th9}is program to be very useful --- I'm sure you will too. Address comments via Compuserve to Charles F. Johnson 750:}yz+8?8XN1NXNN1NHN10XN1NNNN50N52NNN25NNN1N3N4N25N76N200DELAACDEYAPICXXXX=}XKECP @ =}=} !"@#@$@%@&@'()*+,-=}./012SAVE "D:CRAZY8.BASM;@,MVERSION 1.1 REV.022483 1983 BY BR=}UCE RAMSEY, SEATTLEKKA(X,Y)52 CARDS;X,YCOUNT COMPUTER 'S PLAYABLE SUITS(X),NUMBERS(Y),ETCqqC(V)COMPUTER'S CARDS;D(V)=} C'S CARDS SUIT-PLAYABLE;E(V) & NUMBER- PLAYABLEH(V):HUMANS CARDS;X1=DISCRDppX2SUIT OF CARD YOU LAST DREW TO; X3==}#OF CARDS DEALT;X4=FLAGS WHICH 2S TO DRAW TO;X5=#OF HUMAN'S CARDSppX6=#OF C'S CARDS;X8=#OF C'S 8S; X9,Y PL.&DR.U,M,=}Z PRINTER;Z DISCARD VAR.Y(V)=C'S SUIT-COUNTER;SSTORESVsH(@}ٸ: The goal is to get rid of all your cards fir=}st!s(&Each player must follow suit on deck.rr(jAn 8 is a JOKER and can be made into ANY other suit-if a 2 is thrown=},then other player gets 2 cards.oD(<ĠàԠϠĠРŠ ŭӡY(Hit [P] tO play!=}]e4Po A  & $ 6-66-6-$ @0'"%*-&' @2 -   =}6-$&"# !6-$+&,&#6-@2(4 6-8,"6-A*6-@E06-4-*"*8,"A=}2=2A!-@)),%9/%@$%= 3) -2A  )2AY ,/&%=}'/&%@(5/%@)C,%@$Y,%@$%@)F !6-+&,$%dxx&$P:',AA A=}0A@APA`ApAAAAA A0n5 ,%%/%%!/%%+/%=}%5/%%p ,%%/%% xC ,%%/%%!/%%+/%%5/%%?/%%C 5 ,%%/%=}%!/%%+/%%5/%%9 ,%%/%%!/%%+/%%5/%%9 9 ,%%/%%!/%%=}+/%%5/%%9 ? ,%%/%%!/%%+/%%5/%%?/%%% ,%%/%%!/%%% =}? ,%%/%%!/%%+/%%5/%%?/%%/ ,%%/%%!/%%+/%%/ / ,%%/=}%%!/%%+/%%/ ? ,%%/%%!/%%+/%%5/%%?/%%C ,%%/%%!/%=}%+/%%5/%%?/%%C ? ,%%/%%!/%%+/%%5/%%?/%%% ,%%/%%!/=}%%%  ,%%/%%@? ,%%/%%!/%%+/%%5/%%?/%% ,%%/%%=}  ,%%/%%9 ,%%/%%!/%%+/%%5,%%9 ? ,%%/%%!/%%+/%=}%5/%%?/%% ,%%/%% ,%%/%% 5 ,%%/%%!,%%+/%%5/%%=},,P:',APAAAP,5-,&%%%1/%%@%%5 0 ,%%/%%2+=} -,%%%%'/&%%%+ 4+ -,&%%%'/%%%%+ 67 -,%%%%@3/&%%=}%@7 81 -,&%%%-/%%@%%1 :C -%,%%@%%@?/&%@%%@=}C <3 -,%%%@//%%%@%3 >K -,&%%%@$9/%%@%%@$= K"A=}J   ^/-,&%%%+/%%%%/ bK -,%%%%@9/&%@ %%@= K=}"Ar   5,%%/%%%,%%5/%@%7 ,%%/%%',%@%7/%@=}%7 ,%%/%%',%@%7/%@%9 -,%%%@5/%@%%@9 K =}-,%%%%@9/&%@%%@= K"A   /-,&%%%+/%%%%/ =}Y -,%%%@5/%@%%@9 I,%%@!Y/%%@!O,%@%@!//%@=}%@!?,%%@"O/%%@"I,%%@")/%@%@"9,%%@!I/%%@%W,%=}%@!#/%%@%3,%%@%I/%@%@%W"A "AM "-@=}0+,%@2?/@)%@2C M A?  -@)!,$%1/$%@)5 ? A=}G-@)',$+&,%%@2C/$+&,%@)%@2G  6- $X 6- $33"=}KK1,2,3,4,5,6,7,8,9,10,11,12,15,35,43,100,250,255,500,520,764,2000,3590009@<,9,9,9=},9,9,;,++000+ARJ,($CRAZY EIGHTS 1982 BY BRUCE RAMSEYJ(ATARI BASIC, REQU=}IRES 32K;(1(%TRIGGER=Y=YES STICK=N=NO S=SORT HAND; A p2 - A P"68,-$%& 26-A5@ -=} A P"68,-$%& ,6-6 A0<6-@ ) A P6-$%#")6- "6-%d 6-=}6-6->($} DISCARD PILED &J6-P6-Z @@d A Z6-P:@$H:,,%)6-P:$H:=},,%;68<,-8<,%N8<,!A PZPICK CARD 6-%"@RA($?-@-*68<,=}-. 2 5$?SHUFFLEQ 6-6-6-6-!6-'6-/-868,-< D-M68,-Q : -6=}8,-  -/8,"A:68,-%8,"A68,-%8,"A68,-%8,"A68=},-%  SORT= --8,!8,(6-8,468,-8,=68,-   A "%(8`=}$ "%(8>:@, $ "%(8>:,$ "%(8{$#&$P:',"(A# A &=}$P:',  (&$P:',&$P:',"(J&$P:',"(Q&$P:',"@(K,,P:',A=}AAA (` $(>:@,$ (>:,$ ({ $& -8,!6-%& A*=}8,!A 68,-8,%* A*8,!A 68,-8,%* A 8,!A 68,-8,% 8, A=} 68,-8,%  !6- A&$P:',"A"A0" 6-8,6-A=}"  6-%  6-= -)8,&$P:8,',"&$P:',16-%=68,-8,  6- -8,!=}Ap*P:8,',"P:',6-%*68,-8, 8,%8,%"A!8,%8,"A8,%"A=}%8,"A 8,"AP 8,"A AxPICK SUITMATCHz "6-8, =} -6- -!8,"8,6-%! A@778,&+$+P:8,',,,"8,&+$+P:8,',,,AP 6-%>} 6-8,  6-8, 8 ONLY PLAYABLE0-@&8,&$P:8,',"0 A0  A@>}H !-68P:8,',,-8P:8,'A,,%0$HEXTRA 'POINTS' FOR 2S(6-P:8,',$6-%$6-8,( 8,!8>},AP8,!8,A`8,!8,Ap  6-%6-A 8,!8,A`8,!8,A>}p 6-%6-A 8,!8,Ap 6-%6-A " 6-%6-A @ !A>} #-MATCH ONLYB9 --,8,"+$+P:8,',,,%56-8,9 H   J3 --&P:8,',"P:',/6>}-8,3 P  6-V( -6-8P:8,',," (6-\- - 8P:8,',,")6-8,- f >}r!")!A!SUITS & 8x( -(8,&$P:8,',"Ap|  Av#P:8,',"P:',6-8,# >} A`E - 8,&$P:8,',"06-$P:8,',86-%A6-8,E   A")!A#'S>}&88 6--&8,&$P:8,',".6-%8 A  "AE - 8,&$P:8,',"06-$P:8,'> },86-%A6-8,E  . -!P:8,',"P:8,',*6-8,.   A 6-SUITS & #S. -> }*8,&$P:8,'," 6-%* AP !)"A`( -(8,&$P:8,',A(! -",> }P:8,',"P:8,',6-(6-8,, # $ "A`&6-@ -* 8,&$P:8,',A8,> }%8P:8,',, %6-8P:8,',,.& -@&8,AH4U -8,"$%.(PLAY THE 8 AS A 66-$> }@ AH6-%Q6-8,U 6 8 :#P:8,',"P:',6-8,# ;$DP:',AF!) A>}PL'-@'P:8,',AvP< -/8,&$P:8,',"8,&$P:8,',86-8,< S T XK6>}-8P:',,-*8P:8,',,!;6-8P:8,',,KSWITCH SUITS?f "8P:',,APj Al8 6-->}8,!#6-8,8GAME STARTS W/AN 8t, -8,""6-$%, A`| %  6-%DISCARD,ADJUST >}HAND" !6-68,-" A &$P:',"6- -8,"68,- $ -&8,"$68>},-8%,#!*8,"8&,#68,-8%, 6-&" A)PI(}COMPUTER DISCARDS "6-, Ap2!>}I(, HAS  CARDS. "(. ONE CARD LEFT!1 A56-6-# @@' 1 A24"A#C D>}RAWS 1H" 6-% A P"68,-$%TZ-(}COMPUTER DRAWS, AND HAS  CARDS.>-@ 6L2$'P Z A>} A C DRAWS 2 6-6-%!A#3 A P68&,-$%& A P368,-$%+->}AP2! +2>,(}}COMPUTER DRAWS 2 CARDS, HAS .0 4 > A2K+0AR'>}-@A( COMPUTER GOES BUST! K A5 8-@8($THE MACHINE VIOLATED ITS OWN MAXIMUM >-@ 4( CAP>}ACITY BY DRAWING A 16TH CARD.> A) J!(} SHUFFLING DECK /-@7-B68<,-F J  6 ->}8, 6688,&$P:8,',},-  8,!68<8,&,- #  68&$P:',}@6-J ApP(. @-@`A!2% /2@(>:AS,} * -*(*******COMPUTER WINS!*****>}** U-@@ (HUMAN!,-@!U($ YOU HAVE BEEN HUMBLED BY A MACHINE. U-@#9($PLAY AGAIN? IF N0,>} BACK TO OHAUG N/L= C"U% D:NEWSLTR.BAS "A) A (}-@!3(Y OR N, TRIGGER OR STICK!7 A A)>} @-@-$68<,-( , /%@FULL RESHUFFLE N 6--&8,&$P:8,',"968,-P:8,',%>}NSORT HUMAN'S CARDS A --#8,!8,,6-8,868,-8,A68,- !  "AP6-!  $> } $ 6-6-$ID H'S SUITMATCHES &$P:',"A3`  -8,!A2 (P:8,',"P:',6-%( A>!}3   ID #-MATCHES A-@/8,&$P:8,',"&$P:',76-%A A30 * -8,! 6->"}%* A4   !A2`H DRAWS ' -2@B#-'  - -2@P # -2>#} "A5P A P" 68%,-%  68%,-$% *6-P:',6-%6- * A2 2 >$}(}WOULD YOU RATHER DRAW?$ 2"A2E "A2 -"@b A06-# - A2  A6 A>%}2` X 6-8,6--(}WANT TO DISCARD THE 7 Ap>(?B H"N6-X A2  "6- A5 ->&}"@b A06-# - A2  A6 A3 X 6-8,6--(}WANT TO DISCARD THE 7 Ap>(?B>'} H"N6-X A2%  "6- A5 -"@b A06-# - A2  A6 A30 C >(}DISCARDS A 2! A2" !@A5P$ M-@P#2%@P' 12M(}DRAW TWO CARDS, HU>)}MAN!& A P" 68%,-%'  68%,-$%(  6-%6- ) A P" 68%,-%*  6>*}8%,-$%,  6-%6- -  6- A H H DISCARDS 8J 4"(}DO YOU WANT TO USE AN 8?& 4"A4 M >+}"A2`N -"@b A06-# - A2O  A6 A4Q "A4PR e(} >>,}:,=(AS WHAT SUIT? {+>:@,S( `eAdAUS ''F:Ad,"AU*R:,"A4T Q6-F:>-}Ad,6-R:,% A5u;"@X)"@G6-AQ A4(W )"@)"6-A) A4(Z /"@W>.})"@%6-A/ A4(] )"@b)"6-A) A4(` J#(}WHAT SORT OF SUIT IS THAT?8(USE C,D,H, >/}OR S.< @ J A4d  6-6- @@f  -8,!A42g  h 3 68,-6--&%8,"368>0},-8%,j 8,"8&,68,-8%,l  6-&  A z <+0AR!-<( YOU BEAT THE MACH>1}INE! ? #A4-"#--21 5 ?2 ^-@@"L(2WANT TO PLAY AGAIN? IF NOT, BACK>2} TO OHAUG N/L! P ^"A4p  (} A4` +  A) &&121,2,96,2,81,2,60,10,81,2,60,30 >3}$"A4P$H DISCARDS NON-8 ! 6-8,&$P:',"!6- - 68,--&8,"-68,-8%, 8,"8>4}&,68,-8%, G 6-&&(}YOU DISCARD THE ,6-6 ApG( , & HAVE   "( CARD! A50 (>5} CARDS. ' 6-6- @@ ' A  =+0AR!-3( YOU GO BUST!= A5 2 -2>6}@) )2/6-2$ 2 -2A! )2/6-2$J-A2! )->7}92AC= G2J$-@P $   ""F:,"*R:,"*T:,"A5  T:,"6- A5u>8}$ R:,6- A5u$ 6-F:, A5u$E"(}Y OR N, TRIGGER OR STICK,:(OR S TO SORT CARDS.>}jCOCRLIBOLTOPPBSRBBLPSNAMESTDISPERRMSGSIDETRMDSPDNBLANKSDDDFNAMEFNSORTNDSORSRAB:}DBADLINENDTDELAER B;} B<} !"#$%&'()*B=}+,-./$$ԠРˠҠ$$éԭ$$B>}éέ$$򠠠$$塠$$B?}$$栤ﺠ$$堠 $$ᬠ <<B@}AdAU*@@<ARF6-@6-@'6-@#36-@?6-@ K6-@BA}W6-@c6-@o6-@{6-@6-@6-@6-@P;@U,;A(,;@@BB},;AT,;@,;@,;@5,;@",;@,;@,;@,;@,ZRR;@5,;@BC},;@,;@,;@,;A&,;@,dJJ67@,.7hhhh h hhhhR SʭBD}խ`nkk67@<@,.PhhhhhЩڅϢ؅֥مօe֥ׅͅiפ˥ Ԑ, Ԑ xRI67@BE}<A&,..ߩڤ͈HԑhЬЦА`R6-C:,R 6.N6.Y$67@,. ,6.A46.N>BF}6.OFFH6.D1:R6.D1:G-6.# 36.=6.1 G6.000 6-C:,6-C:,--BG}6-F:A`,%F:Aa,$AV%@!!6-F:,%F:%@,$AVq (}-@=(ԠРˠBH}ҠO-@@q(Š7-@@7((c) 10/12/91, by Steve Walker++(# BI}stats++(# |0 0 |,,($parameters,BJ},($| [Y] Tag Record D1:Source |RB:, @)B:, @H($| [N] Sort Records D1:Destination |R APBK}XB:,!$-@@@(| [N] Sort Records R-@7@X(|,,($| [N] Trim Record ON Screen PBL}rt |,,($| 1 Disk # A Disk Side |,,($-@@2(use: BM} RETURN toggles@6-%ARL@`%@@t%@@%@@"3-@@BN}3(Π = Index filename,/-@@/(Ԡ = Save Index65-@@5(Ԡ = Read PSICON BO}disk@(@#@&@((J B T-F:B2y,"@" A0-ś^' F:B2y,"@BP}A'śh,F:B2y,"@" A,Ǜr A0|06-AP6.Disk I/O0AR@lBQ} B&*6-?:<<Aa<<@,Q7@<@,4PRINT SHOP:CLK!b67A(,. l A)6.Not a PRINTBR} SHOP Disk) B&ԠśI-%@%@/(7@<@,E-%@%@IS#@:BS}7@<@,,"@29-%@%@I( DestinationS A  4Y A 0 6.6-@E7BT}<,4|67<,. ,67@,.>-@"@B(E$6-%@ ApB:, @BU} @`B:, @ A06. Saving IndexR+67@<@,.7@<@,5 B&R@BV}@&VK6-?:C:!hhh hhBhEhDhIhH V`,<@<@:AU,4/-@@('6-%@/B}YAFDUFREFQXNL@AA@% @F_}  SAVE "D:TOFORMAT.BAS" A""(} ԮF`}((BY A. PIGNATO - V.3-ԠĠϵQQ(I BY ALEX PIGNATO MEMBER OL' HACKERS A.U.G., N.Y.Fa}(GG;@,;@,;@,;@,;@,;@,2TK(CԮӧ WILL FORMAT ON DRIVE 1 or 2 - Fb} or Ԡ!N(Q(T(<nj(aǬϠ ԠϠŠŠ٠ ŠFc} (Y/N)nF 4Y A P6-@Z9A@f'AA(9A @do (}B(4Fd}ҡ by ALEX PIGNATO-V1-7/4/89, V3-04/2/94i("Member OL' HACKERS ATARI USER GRP.l(o(n+(( ӠΠŠFe}٠١+(xcS(K [F] TO Ԡ, TYPE [D] TO WITH Ӯ ONLY-ϠЮV(c@ 0F Ff}A`=( ((}FORMAT ONLY! (=( THIS IS DISK #5( (1("DO YOU WANT TO USE DRIVE #2 [Y/N]*5Fg}4YAs@.@@E:m(DISK #/ ǠĠΠ ٬ϠӡpFh}(s(9A@f'AA(9A @o@7AS@D1:oӠFi}ӠŠŠ٠ԠšҠŠ3( ((DISK # 0( has been ġ3(RN(EIF you want to contFj}inue (Y/N), put in a disk before you hit (Y)R# 4Y6-%@# A0YApG( ((DIFk}SK # 0( has been ġ3(6(9(G6-%@;(*(ϠՠԠϠԠˠ 7((Y/N) ;#4YFl}Ap#4NApL (} (((I(2 ӮL9A@f'Fm}AA(9A @"K(E(DISK #/ ǠĠΠ ٬ϠӡH(K(,s@7Fn}AS@D2:sӠӠŠ ٠ԠšҠŠ66( ((DISK # 0(Fo} has been ġ3(6(@RN(EIF you want to continue (Y/N), put in a disk before you hit (Y)RJ# 4Y6-Fp}%@# AT0YA^6-%@h (} ((((ra( (T(FType Y to FORMAT Drive 1 DISK with DFq}OS(No DUP),or N for DRIVE 2 DISK? a@| 0Y A0>( (8(DISK # is ǠĬ--ȠӡFr};(>(o@7AS@D1:oӠӠŠŠ٠ԠšҠŠU+@Fs}@ D1:DOS.SYS6@@ A`UӠӠıӮӛ/(/($DISK has been FORMATTED and has DOS!Ft}>( (8(DISK # is Ǡ--Ƞӡ;(>(o@7AS@D2:oӠFu}ŠŠ٠ԠšҠŠY+@@ D2:DOS.SYS6@YGOTO 515:REM ӠӠFv}ŠӛG(G(:A%,%̧Ҡ٭ˠӠ@@D1:*.*@(&H7Fz}@<@,4 06-%A:7@,,>6-%@H A@0@:6-A:7@<@,,D//  F{}䡠 N2) @*7@<@,4999+2 :ENDX<7@<@,4999+9 NO MORE FRF|}EE SECTORS!<b0  ŠӺ0(% g--(%̧Ҡ٭ˠӠl-@@F}} q&-@!@&( Ҡźv'-@ @'( Another DiskR-@ @+( [Y]F~}=-@!@R(BACK TO PROG [R]'-@!@'( ˠϠ .-@!@*(ϠĠǮ . F}+-@!@+(TO END PROG [E] (}4R@`4YA 4EA I (}F} =-=-=-=-= PSINDXER.DOC (Adapted by R.R.S. from the original "PSINDXER.DOC" as downloadN}ed and UN-ARCed from GENIE file #6649), and printed by OL' HACKERS A.U.G. (program is on this disk!) N} PRINT SHOP DISK INDEXER Version 2.0 12-OCT-91 Program and Documentation by Steve A. Walker N} 15629 East Asbury Place Aurora, Colorado 80013 FROM THE AUTHOR! This program is SHAREWARE. I have spent N}a great deal of time designing, coding, debugging, and modifying it. A minimum donation of $6 that I might receive for N}my time and effort will encourage me to continue supporting this program, as well as writing new software for AtN}ari 8-bit computers. Thank you. A UTILITY FOR ME! Release 1.0 was written as a utility program to index allN} of my PS ICON disks. The program was written for myself without much design and to be used only a few times (originalN}ly). MORE WORK, A NEW AND BETTER VERSION Release 2.0 is a complete re- write to allow more of a userN} interface. It was submitted to the Atari Club of Denver programming contest of October 1992, and took firN}st place; but that may be due more to the way I did the Demo (to avoid errors). Suggestions or comments about tN}he program can be posted via the Atari Club BBS:- (303) 343- 2956 PURPOSE: The main reason for this progN}ram was to save time searching for an ICON to use for my family newsletter. I had printed out all of the ICONS but N}with over some 2000 to go thru I ended up wasting more time paging through my notebook instead of writing the news- lettN}er. So I decided to write this program with the idea of pulling the PS ICON names from each disk and writing itN} to a file with a special identifier and disk side label and then sorting by the PS ICON name. I ended up withN} twenty files that identified each of my twenty PS ICON disks I gave up on sorting the files and uploaded all N}of them to the DEC /VAX at work and appended all twenty, sorted and printed out the listing, which is now in my noteboN}ok along with PS ICONs. I did download the single file which took up over 700 sectors. Now I have since acquired seveN}ral more PS ICON disks which I have not added to the main listing. I may in a future release allow combining N} of existing sorted files to be joined into one sorted file for print out. REQUIREMENTS: This routine is inN} Atari Basic and requires (naturally) a disk drive and PS ICON disks. Besides the PS ICON disks, you'll need a foN}rmatted Atari or Spartdos disk for saving your indexed files. HOW IT WORKS: Basically the routine performs a dirN}ectory of PS Icon names and saves them in memory, by the dimensioned variable name PSNAME$. Depending how often yoN}u want to save to disk, you may want to increase the size of the PSNAME$ (Line 80). This would allow you to indeN}x several PS ICON disks under one file name. Beware that you may receive Error-5 "string length error" when you N} try and index more names than PSNAME$ can hold. If you save the index, after the string length error, the lasN}t entry may not be indexed. You may press "ESC" and clear out the whole PSNAME$ variable and re-run. MENU: USE ARRON}W KEYS N Tag Record D1:Source N Sort Record D1:Destination Y Trim Record ON Screen Prt 1 N}Disk # A Disk Side To move around on the menu just use your arrow keys (without control). It allows for N}wrap around. To make your selection just move your arrow key to the desired option and press [RETURN]. Most optN}ions will toggle back and forth. The following identifies the settings: Y/N-Tag Record: Saves names witN}h disk ID (Index). When set to "N" only the name is saved (i.e. disk ID is not added). This option was allowed to N}create a data output file for another program. N- Sort Record: NOT AVAILABLE!!! N/Y-Trim Record: SettinN}g this option to "Y" will save disk space. The name will have the disk ID right after it. It may be a little harN}d to read the name ("FLOWER#001A") I prefer to set it to "N", this will pad blanks to the right of the name, when it N}is less than 15 characters ("FLOWER #001A"). When the name is 15 char. the disk ID will be right after it. 1 Disk #N}: Pressing RETURN will give you a "?". Enter your disk Identifier (ID) number. YOU MUST KEEP TRACK of your oN}wn numbering. The largest value is "999". If less then 3 or 2 char- acters the ID will be filled in with leadinN}g "0" (i.e. "001") DO NOT ENTER LEADING "0". D1:Source: Toggle 1-4 for source drive that contains your PS ICON}NS to read. D1:Destination: Toggle 1-4 for output drive. Press OPTION and enter your index filename afterN} the "?". ON/OFF Screen Prt: Prints PS ICON names at the bottom of the screen. A/B Disk Side: Part of the dN}isk Identifier (ID). YOU MUST KEEP TRACK of which side you Indexed. OPTION: Index filename. SELECT: SavN}e index. START: Read PSICON disk. RUNNING THE PROGRAM START: Insert your PRINT SHOP Graphics disk aN}nd Press [START] to read. Once the PSICON disk side has been read, you may elect to save or continue with another PSICN}ON disk. Be sure to change your disk #ID and side number before running again. SELECT: Pressing SELECT will cN}heck to ensure that you have a filename available for saving, if not you will be prompted for a filename. OPTION}N: This is used to enter your filename to save as. DO NOT include your drive number ("D?:"), the toggle N}is used to change drive assignment. STATS 0 0 The stats display to the left is thN}e running total of bytes saved in the PSNAME variable. The display to the right is the total number of PS ICON naN}me records read. NOTES: Pressing "ESC" will perform a CLR of memory. The machine language routine for readiN}ng the PS ICON disks does not perform any error trapping, so make sure you have PS ICON disk in the correct drive. TN}he cursor posit- ion is incorrect after you input the filename, it will display over the "Trim Record" toggle optionN}. This is misleading, it is still sensing over the last entry before the filename was entered. Haven't been able to N}ӛ>1-@2@('6-%@1ӛH$R\٠Πӛf ApAR AB} z?-@(0(7@<@&+&,,<"@#?$+6-%@6.#-@((+$B}ԠӤ @$-@AP KA'A@9A@KAB}6-?::%@H,,$~)6-%@!@)6-@~,()67@<@,.>:%@H,,$~ 4N6B}.Y($~ 6.N($~ 4FF6.N ($~ 6.FF($~ 4A6.B($~ 6.A($~B}~ԠˠқI6-6.$-&@+( 9-&@=I6-@(7<,4 6-&@B}( B%0C-@7@:7<,, @H)@:7<,,!@XC6-@&5 "@!-&@+( 5 B}B% 00-&@( ,-&+&@,0(:!-%@( Disk #!$DNҠŠśXcB}@@+@1A@QCAR@c(%ERROR-#F:A,, b>-@A %+B}/ B:@> D:PSINDXER.BAS@c(%ERROR-#F:A,, b>-@A %+@6figure out how to get the cursor display where it should be after the INPUT command. *+*+*e to Lx> B E$ D:CRAZY8.BAS$ 6-F:, A5u$E"(}Y OR N, TRIGGER OR STICK,:(OR S TO SORT CARDS.< <<<<<< HACKERS do their utmost to spread the 8 BIT word. Thanks RON you are a winner!) >>>>>>>>>>>>>>>END<<<<<<<<<<<<<066,404. <><>end<><>ure you will too. Address comments via Compuserve to Charles F. Johnson 7508( (((I(2 ӮD:TOFORMAT.BASYA 4EA I (}DVmy time and effort will encourage me to continue supporting this program, as well as writing new software for AtH}