@L}5 _$% l0$)$$Hȱ$ UhL" `e$$%`$%`  R@P!( L(1   Y I`  d  Ld M * @  $ % CC$$)%1 Udߥ$9%: !0 S$% DD˙`  }J)Lr d M * @  $ % CC$$)%1 Udߥ$9%: !0 S$%} DD˙`  }J)Lr J  ((  p L ()   J}L= ( L 0q A    IB JC;? D W } LL  ` W )LA!  ߰")-݆ p" } $G@LL 08`Q")<2Q0 -G$Ș݆ UL# ; p8(()(0ʥ)NQ` }$GȘ݆LU )L ݆ L GȘ ݆LL )W>Z   HH)H }p h  hyhy D L> L JJ    ! LA*` BF }7'8  M HN H` 8 Z  \LdJJ!"!GFE@F (!L }EE !E^ ^ E E7EȩEdE/EȩE  D } .L }  ;F d  ;?F7F? ( .   Z D LL d } . D  L    p  E` , d)  D L) 0BM݊L݉} ML  N݆ L NLML [ TEqEHȱEqEh 0Gȹ G} HLL GɛL  LFREE SECTORS G) *Gȩ GȽG GȌ*jj >G}}N 2 FORMAT. t* 5) 1L!`) 0NΞ 0 L1) 1 L!BAD LOAD FILELOAD FROM WHAT FILE?) 0 ?}0#B 1L!WHAT FILE TO LOCK?) 0 0$B 1L!WHAT FILE TO UNLOCK?DUP DISK-SOURCE,DEST DRIVES?TYPE "Y" IF OK TO US@}E PROGRAM AREACAUTION: A "Y" INVALIDATES MEM.SAV.FE! +L1   `*  70 2 2A} 0.* 1 y0 0)INSERT BOTH DISKS, TYPE RETURN^, 1 y038逍 N, 1L! ,B}C, t*  Lx+, 0 ^, 1 y0 , ,0,0 ,L+ ,I0 ,Vǭ0C}Ξ, 0 }, 1 y0C,ШC, 0K'!" H H 'h h Lx+!EF 5L1L!D,I,HhD}` NOT ENOUGH ROOMINSERT SOURCE DISK,TYPE RETURNINSERT DESTINATION DISK,TYPE RETURNE}`  `8 rL1`-* 1P* 1 y0Y`hhL!NAME OF FILE TO MOVE?- 0 0|DL% <.F},^ 1 70 0 .@L# .BJ 1  DEHIB V L1 ,} 1 70,L.  G}JB|,#P#DE 1 HI BDEHHII 1 B 1 ,^ 1 70,0La- B V,#PH},^ 1 70 0L#L!-* 1P* 1 y0Yj383}mm ݭI}}`8}``|* ? ɛ,`|:-)| / 1L!`DESTINATION CANT BE DOJ}S.SYS0 0H{ 24Δ 28/L!/) 2 Π 2 0 ξK}hAΞB,0 J 1 BDEHI,HÝDE 1HIHIDELSAVE-GIVE L}FILE,START,END(,INIT,RUN)O S0 1`BDEPHI V` S0H 1 L!M}0 0 1L~0`PLEASE TYPE 1 LETTER,0`hhL! 70 1L0L<1 ,;ɛ7,"ɛ:ݦ1ݥN}A"D|ݤD|ȩ:|ȩ|ɛ,,(/+.ީ1 1,ɛ`轤{NAMEO} TOO LONG B VL!` L1I H1EΝDL1|mDiE` V0`8d/8 i:222 1 LP}!ERROR- 130ɛ+,' 20*.. өr2 1``2TOO MANY DIGITSINVALID HEXAQ}DECIMAL PARAMETER800 0 8 00`,0'D800 H,ɛh`2L1NEED D1 THRU D8uR} ECIMAL PARAMETER800 0 8 00`,0'D800 H,ɛh`2L1NEED D1 THRU D8uPP PTU PSetting Up ATARI 130XE RAMDisk U PRAMDisk Not Formatted! U P   T} P@BDPEJK V@C08? PiLPhPhPPP PLPPHPH`HI BLV P}`@U} BLVDPQ8:DUP.SYSPK V@C08? PiLPhPhPPP PLPPHPH`HI BLV P}`@짠򠠠 W}Πռ Š X} ۱ Exit To Basic ۲ Exit To Dos ۳ Printer Config  Y}ϠSPACEBAR͠Ӡš READ/PRINT ALL Z} NOTE: This DISK J/S to read Scr may contain .BAS Disk Catalog & .COM files. BCALC Article [} **** BANKS Template Check Directory CREDIT Template for more .COM or INTEREST Temp. BASIC p \}rograms! Check 報 for more OHAUG news articles!! ]}  for more OHAUG news articles!! -|Vol: he ||Issue: || _}   || Put a   || little fun   ... try || in your `}   Assembler|| Atari 8...  !!! ||   || a} ||  ||--> <--|| b}  ||  || Atari User Group Inc.(c)1985 |*** Alan Sharkis, Edc}itor ****** 43 Rose Drive ****** East Meadow, N.Y. 11554 ***d}|Charter Member NEAR*US ATARI USER Gp.|| |e}|Charter Member NEAR*US ATARI USER Gp.|| |O) !"`3!3:,*2B:,"@A( A } / +@-/(@TURN DISK OVER( /-@/(@THEN PRESS ANY KEYZ 5AdAU) }& A'5% D:PROG.BAS o+A%A @7-@@Q(NO PROGRAM THIS MONTHc-@@ }oAR B'(FLIP DISK AGAIN AND PRESS A KEY1 A'8)B A 6 (}-@ @ 6( What's Your P }leasure?" _B7t@d'@@d9-@@X(enu rint ead: _)T 8"@w(( }.( Main Menu....8 A "@AT 8"@((.( Read File....8 AGP .-B: },6. D1:**.TXT.67<,.7<, F A2A )5@<(}F A4N   A 4 }F:A,"A6*@@@4 A7P **"@e*F:A,"ApA1P pA @4@e*F }:A,"Ap:(}L-@@p(Not In This Months News Letter ! AGP AGP! A1PH TA  }@'A@hT((} 짠򠠠z 00(( à aB }7t@d'@@d4@8(D@waF:Ad,"AFA7P F:@, @"A5E }(3(' 堒EAdAUB''F:Ad,"AU*T:,"A6Pt%AdAU }(}% A4PZAdAU(0(Z($Press a Key or Trigger for Next File''F:Ad,"A }U*T:,"A8 *@@@'AdAU*$<NA %6.D1:PRESSPRT.MNU*5G@ }@@N(}n((6-C:hhhhh Ȅԩ`,!A@h!A " AA(" A@P }A @6QB7t@d'@@d9-@@ J( Selection: Q)h!!"@i)"@e }AH"@xADP"@c' A@AAP0K AE(}3D1:PRESS }PRT.HLP= A4G A9KÛbC6-@f6-@V!6-'6-36-@96-C ARS6-F:A,"A6 }E(! Viewing Complete Press Any KeyL)O$SÛU (}-@@'"A8K(Your Printer is Not On Li }ne...U AGP<"Ap2(Printer Help File Not Found...< AGP*= (}-@@3(ERROR # F:A },= AGP\ A9-A $7@6-!"@e'6--6-7 AIPF (}-"(P }RINT STYLE?0( . DRAFTF(. DOUBLE STRIKE$0)@6-&@d0 )!AHPVU (}-3( PAGE CO }LUMNS & LINE SPACING?U(. 2 COLUMNS AT 6 LINES/INCHh%(. 2 COLUMNS AT 8 LINES/INCHG(. 3 COLUMNS AT 6 LINES/IN }CHh(. 3 COLUMNS AT 8 LINES/INCH( )( @e)!@hAIPg6-@f6-@V'6-@-6-C }"@f)"@hO6-@[6-@g6-@v!@f6-PI (}-!( PAPER TYPE?4(. CONTINUOU }SI(. SINGLE SHEETS( )( @e)!@fAR"@f6-&'Û$M@6-%6. } D1:**.TXT+6-16-=6-BC"M A9JY (}-,(ll, dd, ven, or8-@Y(irst Odd, t }hen Even Pages| )55@e*@y*@i*@pATPT6-+"@p,-@D( very Page } or artial Block?HT6-@y( )(@i*@AVPD"@iAYPv:( First Page?  A }WP,@: AWP 6-P:,:( Last Page?  AXP,@: AXP  6-P:,>0 A` }&@P:0 A`Pp<.(&Check your printer, then press .2< AYP 6. A }U (}-9(LOADING BUFFER with Page %...U(Use -P to Pause+(Use -C to Cancel+-@ }8^*("Every Page must be Loaded, even if6-@R(it isn't to be Printed.^-@j= 6. 67,.67,. }#6.)6.16-%=@w/ - A6-'6-@@/-"F:Ad,"A8" A,F:Ad },"AF", A2& &AeAePAfd67<,. AfP67<,. AfP67 }<,.! 6-%6-%@9 ! ,"F:Ad,"A8" A^,F:Ad,"AF", A }Ay..'@"P:'@,*"@yAy..'@P:'@,*"@iAy&9 A& }@P:,"9(@=X "(G6  '6-+",$%+",$+@&,6(=:,N ((( }":6-+",$@ %+",$@G*@'N*: 6-6-@@-$6.*":6.  "F }:Ad,"A8" AR,F:Ad,"AF", A<67B:,%,.7<,)67B:,%,.7<,<67B:,%,. }7<,"6-?:>>>>>>>>>>>>>>>END<<<<<<<<<<<<<<<<<< ELMON(w !FILEC B`;@,;@,0A@BA e( ( (,}e(TTo load the PREVIOUSLY saved file DISKFILE to the RAM DISK D8: use DOS OPTION C'('( ıŬĸ,} 2%(%( FILES ON RAM DISK D8:<""( ----- -- --- ---- ---F= @=@3@ D,}8:MEM.SAVP4 A@4@@D8:*.*Z@d++@:7@<@,,!@RA@n4,}7@<@,44*( 4 A@x(  @ BB( (B2Go to LOAD INFO or ,}QUICK CATALOGER (LOAD/QUICK)=37@<@,4L)7@<@,4l= AF37@<@,4Q)7,}@<@,4qF%D:QUICKCAT.TUR[` ([(LIf you have used the QUICK CATALOGER BEFORE then you must do the followi,}ng:dd([You MUST load the file DISKFILE into the RAM DISK D8 so that the new files can be appended[[(S to this file,}. Or you can load ALL files into the RAM Disk by using D1:*.*,D8:*.*$($( Please type DOSd(d(XWhen you,} are finished loading the filetype OPTION L and for the filename useAUTORUN.SYS c(c(WAt the END of your session with t,}he QUICK CATALOGER you must reverse this procedure. UU(MYou must save the files from the RAM DISK D8 to a floppy di,}sk.Use OPTION C( D8:*.*,D1:*.* D:CATMENU.ARBust save the files from the RAM DISK D8 to a floppy di,D6;;BFILEADISKFILEDNAMEPADDFILEEDARRAYFIL1ARRAYAADNUMBERNAMETEMPREVSORTYNNAMHGDLISTZKEREX0}TEERXXTSTBBYKKF1F2F3F4F5MPCINEMMENDIRECTORLOANEW_FILEERASE_FILESORSHOW_SORPRINT_SOREND_PROKSTART_L0}OADEESERROLFILE_NUM_SORREVERSE_STBICDALFA_NUNUM_PROMPRNEND_FILE_ERROSCROLKEPXPRINT_ALFA_NUX0}TITLTFL_PREEEEPAGPRWTTWTXYDRFILE_CNDISKFILDFILTZERW #)0}.CU U jB 0G EG ZGoGGGGGGGG1}GGHH*H 6H BH NH ZHoH zH !H"H#H$H%1}H&H'I (I)I*"?+@,A-2C.J/cL0R1X2^3n41}5YD6789:;<=>?HP@ABCDU1}EmFGHIJK [L0gMNO\P]QRS1}T`UVWgXYtbZ[\]^j_`ab@c@1}d@efIghpijklmno TQ6-6-@1}'6-@36-@EA@QA IINEEDS TURBO-BASIC XL/XE WITH RAM DISK D8 - RON FETZER 2/97. V1}ER 2.5mm;@,;@,;,;@,;@,;@,;@!,;@,;A$,;@!,(ss;B1}p,;@!,;@!,;@!,;@!,;@!,;@!,;@!,;@,;@%,2bb;,;@1 },;@,;@,;@,;@!,;@,;@,;@,<ss;@,;@!,;@,;@1 },;@!,;@!,;@!,;@!,;@!,;@!,FN+;@,;@,;,;@,<6. D:DISK.1 }CATB6-H6-N6-P6. D8:DISKFILEZ\dTn]x6. AR#`-@@#(ՠ1 }!( (!(1: Disk Directory( 2: Load Disks!!(3: Add Individual Files##(4: Erase Individual Files1 }( 5: Sort Files''(6: Display Sort on the Screen(7: Print the Sort(8: EndB A0-@ 1}@8Select a Number >>B Bg )!@)P:,(D("Error: Select a number from 1 to 8V-@'@1}]( g A0b\TOU 6. `(((((("(%(((+(U#DIRECTORY FOR W1}HICH DRIVE 1 OR 8 >>"@A"@A=()( ERROR SELECT EITHER 1 OR 83MA = A1}"@6.D1:*.* "@6.D8:*.*"#@ `#(, 6@:7<,,!@G1}A@@(J/ ( /@:7<,, @GAT^&(&( FILES ON DISK h;( (/D1}o you want to continue(Y/N) >>;ARr'7<,4Y A@ '$P'A|QTO6. `% A21}!@%\_l"Ap`((((_(< DATA FILE 'DISKFILE' NOT ON RAM DISK D8R1}l"Ap((6.H%SHALL I CREATE A NEW DATA FILE(Y/N)>>R B&7<,4Y&@7<1},4NA (] `6-% B(AR " P; B-@;(To go to the type 'MENU1}'A AP6.((A Is there a disk in drive #1(Y/N)7<,4MA7<,4NAP9 A1}#@- B49*7@<@,0 6.* AP-@$@(-----R-1}@R>4MENUAM6-6-B:,$1}@'(C( USE 5 CHARACTERSM A "@APB A1#@*(/B@1}5&B@D1:*.*$6-*6-6ARB6-0 :^^7<@,4 DOS SYS)71}<@,4 DUP SYS)7<@,4 RAMDISK COMA`DCC7<@,4 DISK CAT)7<@,4 MEM SAVA`1}Nq 6-%6-%6-B:,.-@@!A(MAX. FILES=810S-@ @"g( FILES LOADED=qM@SY!A1} `((((!(E( YOU REACHED MAX. FILE COUNT!OMARU'Y\X&"@6.  67,.&6.b))671}$@&@<$@,.7,l/"7@<@,4SECTORS%/ A@v"@A`` @ 1 }` ->4(7$@&@<$@, DISK --->>M@ )) 7$@&@<$@,1!} 3 6. 6. 6. !6-'6-3AR  \`PQTO* 6. 6. 6-1"}'6. *`6-@6("For type 'MENU' for file name--@-What is the file name>> 4MENU1#}ApE 6-B:,!@(;(Error: File name is too bigE Ap / 6.67,.6./6. *1$} 6-6-B:,67%,.4L( (L>>M6-6-B:1%},$@'(C( USE 5 CHARACTERSM A H@ R \ APfS`-@B(1&}+You must re-sort to include these filesLM@`OSPpQzTOI 6. 6. 6. #6. +6. 161'}-76-=6-C6-I6-b`6. 6. 26. D6. V6. b6. 1(}F 6. -@F(Does this file have an extension(Y/N) >>*7<,4Y A P@' A *AI()Fi1)}le name - LESS extension>>26-B:,> @I67%,.M(- Extension - LESS decimal point>>66-B:,B @1*}M67%,.!67@ ,.67,.!6. A H6-6.(H(What file do you want to erase 1+} >>2 6-B:, @#67%,.267@,. 6.B("What disk # or name>>+6-B:,7 @B671,}%,.9`AR$-@@9(ɠ͠Ǡ@? 6-% (6.7<@,1-}?6.7@<@!,$,7<@,4 "6-&, AP.&&67$@!&@ <$@!,.8L 4*4F67$1.}@!&@ <$@!,. L6-B APL]l"A6VP"`(>:AS,1-1/}@@F(ŠԠĠPMA `A " `(>:AS,+-@@7(šAM@o"A10}q:`-@@:(RE-SAVING D8:DISKFILE - WAIT!tSAVE DISKFILE~@6- -&11}'' 7$@!&@ <$@!, R`AR 6. 2-@@RErase another file(Y/N)>>12}*7<,4Y A @' A*AO`-@B(+You must re-sort to eliminate these filesLM@O13}PQTO 6-6. 6. A` ( (((A(*You must assign a file name for the sort8(8(-The14} filename should have an extender of Y( (M=Please enter the filename and extender(max. 8 lttrs + .SRT)>>YA15}RC4DISKFILE(9(Error: You cannot use this nameC Ap 1`-@ @1(Ǡŧ16}G 6-B:,67@<%,..67<,.D8:;6.7<%,GAR@( 6-% A`17}2+7<@,4 !6-&+ A <&&67$@!&@ <$@!,.F A Pl"A6Z.`-@18}@(( Ԡՠ+(.(d(1: Sort by File Namen(2: Sort by Disk NamexE( A"-@ @19};Select a number >>E B` )!)P:,(>("Error: Select a number from 1 to 2P-@'@V( `1:} A jT]3AR`$-@@3( ǡ " P# 6-6-6-6-#61;}.  6-$+&,A6-P:',"AP-+&,&6-S 6-%S7$@!&@ <$@!1<},/7$@!&@ <$@!,A@f&6.7$@!&@ <$@!,f67$@!&@ <$@!,.7$@!1=}&@ <$@!,B&67$@!&@ <$@!,..6-&B!A  A_`-@@1>}/(ԠӠŠ<(>:AS,I(>:AS,SM@`_ART":`-@@:(ǠԠϠ1?}͠ˠĸ,@6-6 -&@'' 7$@!&@ <$@!,J T6. AR1@}^QhTrO| P 6-+6-6. 6. +AP8( (8(What SORT file do you want to see 1A} >>B4DISKFILE(8(Error: This is not a SORT fileB AA 6-B:,67@<%,.467@<,.D8:A1B}6.7<%,6`-@ @3(Π٠պ6(.( (.(1: Files in alphabetical order##(2: D1C}isks in numeric orderA A@-@@7Select a number>>A B` )!)P:,(>("Error: Sele1D}ct a number from 1 to 2P-@(@V( ` A@ jT] " P8` @ 6-1E}&6-,6-8AR0`-@@0(ǠԠŠ 6-% @&+7<@,4 1F} !6-&+ A 0&&67$@!&@ <$@!,.: A D]l"A6N7`-@@4(TO 1G} PRESS ANY KEY7(X-+&,b&&6.7$@!&@ <$@!,l9 "9( 7<@, 7@,<--1H}v7 "7( -->7<@, 7@, 6-%"@"P *(*( You have &1I} disk files= 6. AR=Do you want to continue (Y/N)>>'7<,4Y Ap@ '$P'AQT1J}O 6-@K: )"@: ,A @  QT OP G 6-6-6-61K}-!6-)6. 16. 76-?6. G6. *8( (8(What SORT FILE do you want to print >>4B4DISKFILE(1L}8(Error: This is not a SORT fileB A >8( (8(Disk Library Name(Max. 25 letters) >>H; 6-B:,67@<1M}%,..67<,.D8:;6.7<%,R-`-@@*( Ԡպ-(\:(+(1: Print files in alphabetical:(1N} orderf(((2: Print in numeric disk orderpG( ( A!`%-@@=Select a number>>G Bz1O}` )!)P:,(>("Error: Select a number from 1 to 2P-@'@V( ` A!` jT] 6-1P}6-6-6- " PP)@#AR)6-1`-@@1(ǠԠ1Q} 6-% A"+7<@,4 !6-&+ A"P&&67$@!&@ <$@!,. A"P1R}l"A6%6. %6- <-+%,A867$@!&@ <$@!,.<  1S}@P: '`-@@'( Ǡ$  ")"P. AR8 QB TL OV K Aq6-@1T}T'6-@T36-A?6-AbK6-A` U!Ap* AA%6-A16-A=6-AI6-A$1U}U6-A2j U!A@* A%6-Ab16-Ab=6-A$I6-AU6-AHt -@~ 6-%1V}@ &&6.7$@!&@ <$@!, ..6.7+%,$@!&@ <+%,$@!, ..6.7+%,$@!&@ <+1W}%,$@!, ..6.7+%,$@!&@ <+%,$@!, ..6.7+%,$@!&@ <+%,$@!, "@(@1X}7@<@, 7@, 7@<@, 7@, 7@<@, 7@,1Y}  g"@g(@7@<@, 7@, 7@<@, 7@, "@1Z}(@7@<@, 7@, 7@<@, 7@, 7@<@, 7@1[},  g"@g(@7@<@, 7@, 7@<@, 7@, u"1\}@Tu(@@ You have &@ disk files "@T1]}P   (@ AR Q T( O2 K 6. `-@K(Did you do a à f1^}irst(Y/N) >>< '7<,4Y A&0@ '$P'AF QP TZ O3>:@, CONDENSEDd V`6. -@V1_}5Did you set the paper to the top of its form(Y/N)>>n *7<,4Y A&@' A&`*Ax @P1`}:( LG(: L( Q "Q( FILE NAME DISK 1a}  FILE NAME DISK   i "i( FILE NAME DISK   FILE NAME DISK   1b}FILE NAME DISK i "i(DISK FILE NAME   DISK FILE NAME   DISK FILE NAME 1c} O "O(  DISK FILENAME   DISK FILE NAME pp(d=====================================1d}=============================================================== ++( ================================ Q T O1e} 6- 6-% ( OO(> -- &( ((1f}((!(&( 5+"@T)"A*")"Ab*"5 A)" Q "Q( FILE NAME DISK   1g} FILE NAME DISK  , i "i( FILE NAME DISK   FILE NAME DISK   FILE NAME1q}B%DOS SYSB*)DUP SYSBSRAMDISK COMBVMAINMENUHLPB^WELCOME SCRBfAUTORUN COMBgAUTORUN SYSBiPRESSPRTMNUBDmNEWSLTR BASBBJOYSTCKTXTB:CCATALOGTXTB CATMENU ARBByQUICKCATTURBJ}BCALC COMB4INTERESTBC BBANKS BC BCREDIT BC B (DBCALC TXTB"HEBANKS TXTB1jFCREDIT TXTB5GNTERESTTXT DISK6 i "i(DISK FILE NAME   DISK FILE NAME   DISK FILE NAME @ O "O1r}(  DISK FILENAME   DISK FILE NAMEJ pp(d==============================================1s}======================================================T ++( ================================^ Qh Tr O| /6-1t}6. 6. '6. /6.  -+&, &&6.7$@!&@ <$@!, #6.7<@,#6.7@1u},  6.67@,. &&67$@!&@ <$@!,.   Q T O +`-@@+(End of P1v}rogram 7-@7(#Copy the RAM DISK to a FLOPPY DISK! ?-@@5(Use Option C 'D8:*.*,D1:*.*?MA@1w} + A0u+(3>:@',@+  B+ Q T [`AR(((E(%DISK FULL OR R1x}EMOVE WRITE PROTECT TABQAR[ B! /%( UNABLE TO SAVE DISK #/ B# 0 6. ((0 CATALO1y}G ANYWAY(Y/N)$ (7@<@,4Y(6-@% 27@<@,4N(6-2 A& A%0 T:1z} O6-AR? /` ( ((/( COUNTING DATA FILES!D # A1`#@I , A1P1{}"6-%@, A1EN Hl"A6(1( FILE COUNT = ;M@0>`H A1X Pl"Ap((71|}( LOAD 'DISKFILE' IN TO D8:DMAPARl  BARQD:QUICKCAT.TURl"Ap((70l@%q6ppPB B #A@%HHz%{% ԍz%hh@z%L_ ( , ) ( *%1@0 F 5~} ( *E ( h* * {/ .L? .L% *)}F  >L"&F&F& U0L%$ɛ 2L%5}H{$=ɽL& . 6¥΅i$i ݥi$ , .A$ < \.L&-$:/./ : .L5}&H , '- h* 0DG .DH &L%L`'?*HyK) HHhH曥 '- h* L`曩yK(L'Ȅ5} ) -ě yKěyKH? m LHL'D`ƛ '-H8KhHL'ƛ ) -yKHL'5}Z ` h*ƝƓƞLh* h*ƜƞЅ"" o(8('P  '- (Lh*`e?` h*Lh* 5}h*枩x P  o(i(i'"e '- (Lh*'` B V䦯` (L( ) ,`ɛ5}`澥 8 HHEEh h 摥`ةPE Ei(EiEd%5} %} \Ԡ?K L󅐩Kѕ0EGDGmKHyz y*z*JIIKʈ0_?_ʅ5}LJLșJLii?L HMHWHIHiHiH9`( '@5}KHJeƍhe)`!88HIhi!Iȑ拥L* *HIĒ L @`EE` #5}"#` *`ɂI@Ɂ IL*ɃɄɅ𽥸@a{ L*ݰFM5}`EE` 4L.H+e+H+i+jݭH8傅H僅HeHHiH +`Η++Θ+Κ++Λ+5}Ls+Ƙ ƙ8``+e++i+H8+H+H8嚍HHH +`++++L+J`5}e JLȹJL]i 8+ȥȩ‘ ;$i e,` L,JLeJLȹJLiJL`Ŗ ,5}8ei ;L!,Hi +h L,JL8嚙JLȹJLJL` ,`EE(`yK(`5} '-摥` JLȹJL`H , ,h -ŊKe报Ō` ;L<-iiEE5}L!.)[8eiL- .$$$ 6K ,捥ŕ .LJ- O. 4L5}- B. D آ$ ݩ ,`KƕFLJ-$`` O. ؠ0$)$Ȅ$05}$$` $`$ɛ){aI $` , . ) ( - U0Lh*yKH` *F"# GJ5}#8HԥjH ؠH) ,=#hFɛ ,'# >L* 22 s20 6=+ s2##ɛ# ,JHH`5} y0J#J#e -ͲH L/ ;L/) o0 ؠH) ,#h0! ; ,#İﭱH -5}Ŋ ` ;L/) o0 ؠH) ,#h0! ; ,#İ` E")L0 ;5}Lݠw #` JG '` ,1F 22 s2F ( BDFEJK V 4L. BDEI5}H V > (L. 41 ɛ ,L1摥е > ,𩤑EE` 22 s2 2 w6L0 6L.  22 s2 2 w65}ߩ ( JBǝDFEK VL0 BʝDKE HIH8ʝHHKI VL0 ( 5}}HHK}IHL. 22 s2+ 6=&/ 7 h* , .L.`r$#` .DL.H`e E` , h*5} '- h*`#ɛ  8`ȹ#ɛ  `#Fɛ` 22 s21 6=,日$! K , ) -yKH h*5}` E`ȱȱ) ;$ 0>` ; ؠH)$h08L3 2 >(`hhL"& *5} L0@H"#MHJ#ZHr#gH#Ll3L3`݈H0)L3: IL3 IL3 ݥH5}0H)h ){H3#)JJJyH[#)JJyH#)JJJJ~H#L3 `3 L` E` `3 '- LLh*5}DGIDG2GG`EGIEG8G,G` (ԩ ؠȱH) ,Fh y0F# j>`ȱ0$5}$$$H)JJJJHh) ȱLc5ȹ0.H)ʈ0 ίH,$ $ $ 5}$0)$q6ȹ$0.Eq6$ $ȹ$H)r60$hq6r6ȹ$)$ȩ.$L5.愳ȹ$)5}$mHH$q6r6$ɛ$-$,$$ɛȱɛ )$K8K8I5}JLB6Jȱɛ󩀅`v6=FDF:814`8`F:"# ($BFEǝD VCH (h`H5} 0E+#8` Dڢ$#ɛ#@Le:8V膋0# ;)#膋 5}8787#(8`ȹ#DA# = ذ 7#)L7,τ 6=Ȥ 8㤲 7ץi5}L7Ȅ =#ɛ =##Ù# `L7 =`8` -Ŗ 8` ;L8`) 85} ; ; `SQABSQRNEXLOINCNSUAV 8889998-9=99 9)Ԧ =`= 9 O. -:H h= 5}J `L8 9$> ޢJ (ې` ݰ =L8` 9 ޢJ ڐ` ݐ` 9J fڐ` -: O. L8 : : : 9L8` 5}: : : O9L8` #: Dڥ ݦ 8 fڐ8`橥Ũ櫥ŬՐ` : : : 9 I: O9 W: (۰L8` 9 ݐ` 9 ސ` #:5} 8橥Ũ櫥Ŭې Dڥԥ `hh8```ţ䥠ş``0.5}=`)HH `HH `#DAL:i 6= -Ŗ ` ;L:) 8 5}; ; ݩ :Lr: =8勅 =##ș#HH `#ɛ5( ) # L<;L; = ذ)򊅌8劅 5}:#ɛRI )8`L;#ɛ(,#ɛ )*%#@$ɛL{; <`ȹ#)ɛ8`Ј#(Ϣ5} #@$L;@$ <ե8̦ϭ@$#A$#ȹ##ɛLW; ;ei` <ɛ#` <^ = < =L<5}iL < <ɛ0` <* ڰ / (۰ < =L7<iL7< <ɛ'` <+ fڰ - `ڰ < =Lr<`@$#5}ɛ,8`ȹ@$ɛȹ@$ɛȹ@$ɛ#ȹ@$ɛօ` < ݦ < `HH`ii@$@$ɛL=` < ސ8` <5} ڰ ݰ` {= O=` {= =`ˢ8I0;I[A8`8Ae@`#ɛȹ#ɛ̄`8` = =5}e@`8` >I8`HI` < `##ɛ`##`#`=#> ݢ*> ݢ$> (ۢ*> fڢJ 5} `0>EEiEi$ ,I&拥`hh$K8` *` . 0> j>5}KٴH0HɛFHL>ɛL> j>ɛ.L> LF$膔rʆШ2F>?F> L>r$ ș$` .`5}ʩ $`ʆ`q膔`$$z`z$$ $2%`8&ir`i&r8rLm?&&LL` ?% L?5}` ?% >?ƍ`|%K >/ .YF$"oF?vF? * |%KL%襀iť80Hi5} hi 芢8 0Hi hi ` *PF:FFHHG 0E wE hE E hE808 4L. ( BFE5}DKJ V0զK E]LbA)LsA ;$0$L@$ 6 1A报Š𮐬 A棥Ť𝐛 (`5} WAL@ BHI V0"` BHIED V0`hhL0 ` WAFL@ ; 4L@ 5};8eiL~A 22 s2 2 w6LO1 6L. *H"LV@ *GFGHG 0E wE hE E hE C hEşL|@ţşţ륡ŠŤ5}ߥ8埅8壅8埅8壅 2C CBCB h* -Ů ;LOB , -WŭQ ;LwB5}#i#FG CȄ 8+ e, LJB .D - h*`ƫƬ8`5}`ƫƥƣLBƮƭƫåţ-şhhL|@8e@률Hh``8e@ɥHh`B5}$CCGL}E *FGGLA#=`ĕ#DAIG 6=IG㥖eʅ@ץeɅ@IG;IH8I#h8;I5}iAș#日 HIH>Iș#h8HI>Iș#LCEG oD斥@日@ -Lh* oD日@斥@ᥗ ELD5}0눱8$ ;0$LD 68ei ݥ` *GjHG 0E wE hE E hEşţL5}|@ E ,桥Š棥Ťܐ * , -Lh*EiEiɛ` *ɛ`8` &LSEHGHG`G5}Ơ 0E SE`hh *`GڠL}E -Ŗ 8` ;LE`EFG Hp####〈㉀5}倆쀛>Lcp,4+++?????????????}~DIRGOTSAVLOASETWIDLISAbB0111/2A   d5}DJŖD6+\t@>'('&.22DAC34444@2~}D1:*.*D1: %rrorError%rror0ressakey&ile&ree5}2ecalc/&&by2/7/&&/.2/7#/,5-.JGH􀀀򀀦$%,%4%0osition#ursor 2%452.#/5}090osition#ursor 2%452.-/6%0osition#ursor 2%452.5pperleftof"lock,owerrightof"lock5pperleftof$est02).45}0osition#ursor 2%452.,)340osition#ursor 2%452.&/2-!4*ustify,$ollar$ .#ommas .$ecplaces.9,2#5}(&ileexists 2eplace9.2350HH5IVI ABC40123456789 (2GVCgPanama City, FL FEB%=AB05+AC059}!=AB06*AE06@(A=(AC04/100/365)*AD06>B_________________ MAR%=AB06+AC06!=AB07*AE079}@1A=(AC04/100/365)*AD07>GVCgInt comp. monthly APR%=AB07+AC07!=AB08*AE08@09}A=(AC04/100/365)*AD08>Fsð-INT RATE/yr MAY%=AB08+AC08!=AB09*AE09@1A=(AC04/100/3659})*AD09>GVCgCOL -Find month JUN%=AB09+AC09!=AB10*AE10@0A=(AC04/100/365)*AD10>Fs9}and year of your JUL%=AB10+AC10!=AB11*AE11@1A=(AC04/100/365)*AD11>GVCg initial deposit.9} AUG%=AB11+AC11!=AB12*AE12@1A=(AC04/100/365)*AD12>GVCgEdit: add Day, Yr SEP%=AB19}2+AC12!=AB13*AE13@0A=(AC04/100/365)*AD13>Fsof init. deposit OCT%=AB13+AC13!=9}AB14*AE14@1A=(AC04/100/365)*AD14>GVCgMove right to NOV%=AB14+AC14!=AB15*AE159}@0A=(AC04/100/365)*AD15>Fsin same month and DEC%=AB15+AC15!=AB16*AE16@1A=(AC9}04/100/365)*AD16>GVCgEnter the Initial JAN, 1998%=AB16+AC16!=AB17*AE17@1A=(AC04/100/3659})*AD17>GVCgDeposit in your FEB%=AB17+AC17!=AB18*AE18@(A=(AC04/100/365)*AD18>Bac9}count. Be sure MAR%=AB18+AC18!=AB19*AE19@1A=(AC04/100/365)*AD19>GVCg shows zeros.9} APR%=AB19+AC19!=AB20*AE20@0A=(AC04/100/365)*AD20>FsCOL :Find month MAY%=AB20+9}AC20!=AB21*AE21@1A=(AC04/100/365)*AD21>GVCg & year of matur- JUN%=AB21+AC21!=A9}B22*AE22@0A=(AC04/100/365)*AD22>Fsity date, Edit to JUL%=AB22+AC22!=AB23*AE239}@1A=(AC04/100/365)*AD23>GVCgadd day and year. AUG%=AB23+AC23!=AB24*AE24@1A=(AC9}04/100/365)*AD24>GVCgCOL , next to SEP%=AB24+AC24!=AB25*AE25@0A=(AC04/100/365)*AD25>F9}smaturity date has OCT%=AB25+AC25!=AB26*AE26@1A=(AC04/100/365)*AD26>GVCgprojecte9}d balance NOV%=AB26+AC26!=AB27*AE27@0A=(AC04/100/365)*AD27>Fsat maturity... DEC%9}=AB27+AC27!=AB28*AE28@1A=(AC04/100/365)*AD28>GVCgAFTER HAS JAN, 1999%=AB28+AC29}8!=AB29*AE29@1A=(AC04/100/365)*AD29>GVCgBEEN HIT AT LEAST FEB%=AB29+AC29!=AB309}*AE30@(A=(AC04/100/365)*AD30>B TO RECALC MAR%=AB30+AC30!=AB31*AE31@9}1A=(AC04/100/365)*AD31>GVCgTHE SPREADSHEET. APR%=AB31+AC31!=AB32*AE32@0A=(AC04/19}00/365)*AD32>Fs MAY%=AB32+AC32!=AB33*AE33@1A=(AC04/100/365)*AD33>GVCgNOTE: If you sa9}ve JUN%=AB33+AC33!=AB34*AE34@0A=(AC04/100/365)*AD34>Fsyour new templateJUL%=A9}B34+AC34!=AB35*AE35@1A=(AC04/100/365)*AD35>GVCgdo NOT use same AUG%=AB35+AC35!9}=AB36*AE36@1A=(AC04/100/365)*AD36>GVCgfile name as the SEP%=AB36+AC36!=AB37*AE379}@0A=(AC04/100/365)*AD37>Fs master file. OCT%=AB37+AC37!=AB38*AE38@1A=(AC04/9}100/365)*AD38>GVCg_________________ NOV%=AB38+AC38!=AB39*AE39@0A=(AC04/100/365)*AD39>F9}s DEC%=AB39+AC39!=AB40*AE40@1A=(AC04/100/365)*AD40>GVCg JAN, 2000%=AB40+AC409}!=AB41*AE41@1A=(AC04/100/365)*AD41>GVCg FEB%=AB41+AC41!=AB42*AE42@)A=(A9}C04/100/365)*AD42>DI1PS MAR%=AB42+AC42!=AB43*AE43@1A=(AC04/100/365)*AD43>GVCg APR%=A9}B43+AC43!=AB44*AE44@0A=(AC04/100/365)*AD44>Fs MAY%=AB44+AC44!=AB45*AE459}@1A=(AC04/100/365)*AD45>GVCg JUN%=AB45+AC45!=AB46*AE46@0A=(AC04/100/365)*AD46>Fs9} JUL%=AB46+AC46!=AB47*AE47@1A=(AC04/100/365)*AD47>GVCg AUG%=AB47+AC47!=AB489}*AE48@1A=(AC04/100/365)*AD48>GVCgSEP%=AB48+AC48!=AB49*AE49@0A=(AC04/100/39}65)*AD49>Fs OCT%=AB49+AC49!=AB50*AE50@1A=(AC04/100/365)*AD50>GVCg NOV%=AB50+AC509}!=AB51*AE51@0A=(AC04/100/365)*AD51>Fs DEC%=AB51+AC51!=AB52*AE52@1A9}=(AC04/100/365)*AD52>GVCg JAN, 2001%=AB52+AC52!=AB53*AE53@1A=(AC04/100/365)*AD53>GVCg 9}FEB%=AB53+AC53!=AB54*AE54@(A=(AC04/100/365)*AD54>B MAR%=AB54+AC54!=AB55*AE9}55@1A=(AC04/100/365)*AD55>GVCg APR%=AB55+AC55!=AB56*AE56@0A=(AC04/100/365)9}*AD56>Fs MAY%=AB56+AC56!=AB57*AE57@1A=(AC04/100/365)*AD57>GVCg JUN%=AB57+AC579}!=AB58*AE58@0A=(AC04/100/365)*AD58>Fs JUL%=AB58+AC58!=AB59*AE59@1A=9}(AC04/100/365)*AD59>GVCg AUG%=AB59+AC59!=AB60*AE60@1A=(AC04/100/365)*AD60>GVCgSEP%9}=AB60+AC60!=AB61*AE61@0A=(AC04/100/365)*AD61>Fs OCT%=AB61+AC61!=AB62*AE629}@1A=(AC04/100/365)*AD62>GVCg NOV%=AB62+AC62!=AB63*AE63@0A=(AC04/100/365)*AD63>Fs9} DEC%=AB63+AC63!=AB64*AE64@1A=(AC04/100/365)*AD64>GVCg@0A=(AC04/100/365)*AD63>Fs8[    %!% =} LL M[MM-NNpOOPPPPPdQQLRRR\S]SS/TNTmT/U0UUUVVV V!V"V#V$V%V&V'V(V)V*V+V,V-V.V/V0V1V2V3V4V5V6V7V8V9V:V;VV?V MG BANK$ ACCOUNTS!UPDATE :08/09/97BANKS.BC ˠŠ% ! =}Int/year!Int/ MonthAcct. #%Balance!Rate!Maturity!TermTypeInterest%365 Days!30 Day %31 =}Day ---------! ---------!----!------------------------%--------!------ !------0000001%>}A !@Pnone!noneCHKcomp/mon%=AB06*(AC06/100)@pp!=(AC06/100/365*30)*AB06@u9 !=(AC06/100>}/365*31)*AB06@W00000002%BR !@`11/01/9818moC/Dcomp/mon%=AB07*(AC07/100)A2!=(AC>}07/100/365*30)*AB07A !=(AC07/100/365*31)*AB07Ae __________%________%______ %______Subtotal%=@S>}UM(AB06,AB07)Br %=@SUM(AH06,AH07)A2p%=@SUM(AI06,AI07)A!P %=@SUM(AJ06,AJ07)A%bd ========= =========>}== ====== ========= ===== ===== =========% =========!======= !======= ˠŠ% !>} 0000003%Ab3!@p!05/03/981 yrC/Dcomp/mon%=AB14*(AC14/100)ASA!=(AC>}14/100/365*30)*AB14@)!& !=(AC14/100/365*31)*AB14@0c0000004%!%=AB15*(AC15/100)!=(AC1>}5/100/365*30)*AB15 !=(AC15/100/365*31)*AB150000005%!!!=(AC16/100/365*30)*AB1>}6 !=(AC16/100/365*31)*AB160000006%!!!=(AC17/100/365*30)*AB17 !=(AC17> }/100/365*31)*AB17 __________%________%______ %______Subtotal%=@SUM(AB14,AB17)Ab3%=@SUM(AH14,A> }H17)ASA%=@SUM(AI14,AI17)@)!& %=@SUM(AJ14,AJ17)@0c ========= =========== ====== ========= =====> } ===== =========% =========!======= !======= !======= ˠŠ% !  > }In %t/Quart er90 day %91 day !92 day!------ !------ !------ 000000007%A U!@%"no> }ne!noneSAVcmp/quar%=AB25*(AC25/100)@!HP!=(AC25/100/365*90)*AB25@)BF !=(AC25/100/365*91)*AB25@5wI !>}=(AC25/100/365*92)*AB25@AeQ ========= =========== ====== ========= ===== ===== =========% ========>}=!======= !======= !=======% __________% _________-=AB09+AB19+24B4DS!)=AH0>}9+AH19+AH25AW#U`_________-=AB09+AB19+24B4DS!)=AH0<5   !!!!!!!!!!!! B} LLLMdN'OOPnQ/RR$SgSSSS`TT7UUU+VsVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVB}VVVGCREDIT CARD SUMMARY D:CREDIT.BCUpdated : 08/04/97! ! !!B}!!       B}򠠠! !  !!!    B}    0000 0000 0000 0000!=@SUM(AD05,AM05)A5V!!B}!@"!!! !AD ! ! ! !!=AC05-AN05A5V B}1111 1111 1111 1111!=@SUM(AD06,AM06)!!!!!! ! !B} ! ! !!=AC06-AN06  2 222 222 222 2!=@SUM(AD07,AM07)@!B}!!@!!! ! ! ! ! !!=AC07-AN07@B}  3 333 33333 33333!=@SUM(AD08,AM08)!!!!!! !B} ! ! ! !!=AC08-AN08 444 444 444 4 444!=@SUM(AD09,AM09)B}!!!!!! ! ! ! ! !!=AC09B}-AN09 555 555 555 5 5555!=@SUM(AD10,AM10)!!!!!B}! ! ! ! ! !!=AC10-AN10 !__B }______ *=@SUM(AC05,AC10)ATV)=@SUM(AC05,AC10)ATV  En ter amou nt paid and Reca B!}lculate.  Enter    New Bala !nce into  column 򠠠B"}     as Pr !evious B alance. 0000 0000 0000 0000 1-B#}! 813-886-5 000 Then zer !o intere st and 1111 1111 1111 1111 1-! 800-VISA- 91B$}1 items #1 !-7, incl uded in  2 222 222 222 2 1-! 800-344-4 355 current !stB%}atemen t.  3 333 33333 33333 1-! 713-666-1 050 444 444 444 4 444 B&}1-! 918-661-5 000 555 555 555 5 5555 1-! 800-CARD- FAX B'}!   D- FAX @] o=o=o=o=o= BCALC Analog Computing #63 ____________________ BCALC is a spreF)}adsheet using 8K of memory and approximately 24K for data. It comprises a 64 x 64 grid, columns AA to CL and rows 01F*} to 64 Three types of data can be entered in a cell: TEXT: anything not beginning with a number (0-9) or (=) or (-F+}). permits numbers to be entered as "forced text". NUMBERS: a number that begins with 0-9 or (-) or F,}(.) Do not type commas, they can be displayed using formatting commands. FUNCTIONS: (formulas) arithmetic or algebF-}raic expressions starting with (=). Five functions are: (^) (*) (/) (+) (-). CONSOLE KEYS: START: used to abort aF.}ny input in any mode. OPTION: displays status screen: Filename, free bytes, recalculation status and mode. SELF/}ECT: enters command mode (text window changes to gray). DIR n - disk directory for Dn:. WID ccnn - Width of columF0}n "cc" to "nn". Width must be greater than 01 but less than 32. i.e. WID AC04 sets column AC to 4 characters wide. SAVF1} Dn:filespec - SAVes the sheet to disk. LOA Dn:filespec - LOAds previously saved sheet. LIS Dn:filespec - LISts spF2}readsheet to disk in Ascii format for use with word processor. Use cursor to define block to be listed to disk. Do not F3}attempt to LOAd a listed format file. GOT ccrr - GOTo cell "cc" column and "rr" row. Range must be from AA-CB anF4}d 01-47. (puts cursor on top/left of screen, thus row 47 would put row 64 on bottom of screen). SET ccrr - sets "cc" coF5}lumn and "rr" row references to be displayed on bottom of text window. You can have a "heading" row displayed on bottoF6}m, corresponding to the column your cursor is located in. CONTROL KEYS: Control Arrows for cursor movement andF7} used in lieu of [RETURN]. i.e. You enter data in AA01 and want to move to AA02, hit Ctrl-* (right arrow) and tF8}he data is entered in AA01 and cursor moves right to AA02. Ctrl-H home to cell AA01. Ctrl-D deletes blocF9}k of cells (prompted). Ctrl-C copies block of cells. (Formula cells unchanged) Ctrl-M moves block of F:} cells. (Formula cells adjusted) Ctrl-T text is forced when entering numeric or "=" data in cells. Ctrl-G global F;} format of column cursor is positioned in: L,C,R justification Left, Center, Right. D dollar ($) sign toggled. F<} J commas on/off. 0,9 number of decimal places displayed to right of decimal point. ESC makes choice fiF=}nal and exits. Ctrl-F format individual cell. Escape reformats cell and exits. Ctrl-E edit current cell. CtF>}rl-P prints spreadsheet. (prompts for upper-left/lower-right cells) Ctrl-O recalculation mode on/off. Use it in ofF?}f mode when entering data or it will recalculate after every entry and slow things down. Ctrl-R recalculation ordeF@}r changed from rows to columns and vice-versa. Ctrl-A All cells recalculated now. Ctrl-K Kill (erase) cFA}urrent cell. [Caps] toggles upper/lower case. Both recognized in formulas. FUNCTIONS must be typed in format uFB}sing (@) symbol, followed by function, followed by parenthesis. (=) is used to make function entries in a cell. eFC}.g. =@ABS(AF12)+@SUM(AC03,AC08) SQU - squaring SQR - square root ABS - absolute value (- becomes +) RND - round vaFD}lue (closest integer) EXP - exponentation base 10 LOG - logarithm base 10 INT - greatest integer Following require 2 FE} cell entries separated by comma: @CNT(AA01,AA22) - counts number of cells in a block that have entries (number, tFF}ext or formula). @SUM(AC03,AC12) - adds the entries in a block. @AVE(AE12,AG12) - find the average of all entrieFG}s in a block. exits BCALC to DOS. o=o=o=o=o=(AE12,AG12) - find the average of all entrieDN o=o=o=o=o= BANK ACCOUNT SUMMARY FOR BCALC By Frank Walters BANKS.BC is a template fileJI} for BCALC spreadsheet. BCALC, by Barry Kolbe and Bryan Schappel, was published in ANALOG magazine, issue 63, AJJ}ugust 1988. PURPOSE OF BANKS.BC: Summarizes all your banking accounts, including savings, checking JK} and certificates of deposit, etc. You update the balances each month and it computes your projected intereJL}st for the next month and adds all your balances and projected annual interest income. Keep track of your money! SETJM}UP: Load BCALC.COM into any Atari 8-bit computer with BASIC disabled. Minimum of 48k required. From BCALC, presJN}s any key and then SELECT, which allows commands from the text window. Type LOAD D:BANKS.BC and press Return JO}to load the file from drive 1. AA01 includes printer codes to set Elite pitch [ESC+M] and double strike [ESC+GJP}] for Epson compatible printers. Edit these to set 96 columns for your printer, since the spreadsheet is too wiJQ}de for 80 columns. Edit AC01 to reflect the current date of update. AA02 has the filename. The tempJR}late has space for three different banks in rows 03, 12 and 22. It includes a place for phone numbers too. Since JS}the name and phone number covers a sequence of 4-cells (AA-AD) you have to be careful not to exceed the widthJT} of each cell. It is easiest to use inverse and CTRL-E to edit a cell at a time. Use CTRL-T to force "text" mode JU}if a number or (-) or (=) is the first character of a text entry. Enter your bank account numbers in column JV} AA for each bank and the current balance in column AB. AC is for the interest rate (not APY). Use text entries JW}for AD (maturity date or none), AE (Term), Type (CHK, C/D, SAV, etc.) Type interest in AF (compounded monthly, quartJX}erly, none, etc.) See the sample entries for examples of how to do this. Then type over them or CTRL-K the sample blocJY}k entirely if not used by you. This should complete your customization of the form since the remaining cellJZ}s are formulas which do not require customizing (normally). USING BANKS.BC: Once each month, after recJ[}eiving your statement of current balances and interest paid, load BANKS.BC into BCALC and update the date in AC0J\}1. Compare your interest received with monthly interest projections in columns AI, AJ and AK. Pick the column that fJ]}its the number of days in the interest period. You can estimate the interest difference for February or temporarily J^}edit one of the formulas, changing 30 to 28 temporarily to see what the actual amount is. Banks do make mistaJ_}kes, you know. I've caught several banks making errors in their favor which I had corrected after spottJ`}ing descrepancies on my computer. Imagine my great satisfaction the first time I called my bank and talkedJa} to a human, saying, "My computer found out that your computer made a mistake." Finally, update the bJb}alances in column AB. CTRL-A twice to recalculate the spreadsheet and it will update your balances andJc} projected interest rates for the next interest period. Press SELECT and type SAVE D:BANKS.BC to save yourJd} updated form to your working disk. DO NOT SAVE OVER THE ORIGINAL TEMPLATE. It is your backup copy. PRINTING YOURJe} BANK SUMMARY: Set up printer and place cursor on cell AA01. CTRL-P prompts to press Return at upper-left cell of bJf}lock. Press Return and move cursor to lower-right cell (AK29 or 30) and press Return again to print your formJg}. COMMENTS: Feel free to modify any portions of this template to make it more useful to you. Formulas caJh}n be viewed by placing cursor on cell which shows "formula" in status line at top of screen. CTRL-E will dispJi}lay actual formula in text window at bottom of screen. Frank Walters 08/10/97 o=o=o=o=o=ill dispHt o=o=o=o=o= CREDIT CARD SUMMARY FOR BCALC By Frank Walters CREDIT.BC is a template fileNk} for BCALC spreadsheet. BCALC, by Barry Kolbe and Bryan Schappel, was published in ANALOG magazine, issue 63, ANl}ugust 1988. PURPOSE OF CREDIT.BC: Used to summarize all your credit card information in one document. It provides Nm} useful information about current balances and phone numbers to report lost or stolen cards. When a statement is reNn}ceived, you can compare it to the data printed from this template. After entering any current interest charges aNo} new balance is computed. Recent charges not yet billed will also appear in this summary. When you decide the amouNp}nt to pay, you enter it in the "Paid" column and it computes the remaining balance for you. You may find other usefNq}ul features. DESCRIPTION: A full printout of this template requires the printer to be in condensed pitch. Nr}I have included the printer codes for Epson compatibles in cell AA01. You can change them for other type printers. Ns} AB02 displays filename. AB03 has the last date of entry, which you should update each time you add informationNt} and save to disk. The remainder of column AA and AB contains credit card name and number. Below the mNu}ain plate this information is repeated for information only and includes expiration date and phone numbersNv} to report lost or stolen cards. Column AC of the main template lists the current balances of all your cards.Nw} It is the SUM of all cells from AD through AM, Previous Balance to item #8. AD shows previous balances of Nx}cards where you did not pay the full amount due. AE is to enter interest or fees due, entered after you receive yoNy}ur credit card statement. It will update your current balance. AF-AM are individual entries for charges mNz}ade thoughout the month. AF-AI are formatted for charges under $100.00, AJ-AL accept up to 999.99 and AM is for N{}big items under $10,000.00. Larger cells will accept any entries under the maximum limit, even one cent. AN is whereN|} you enter amount paid each month. After recalc, it is subtracted from AC, Current Balance and remainder is displN}}ayed in AO, New Balance. AC13 shows total of all card balances and it is repeated in AB13 so it is displayeN~}d on 40 column screen with cursor in column AA. CUSTOMIZING TEMPLATE: Edit column AA to show names of all yourN} credit cards instead of the sample ones. Enter numbers in column AB. Do this in both blocks 05-10 and 17-22, which are duN}plicates. You can use CTRL-C, the copy command, to copy a block from AA05-AB10 to AA17, if you prefer. Finish witN}h the expiration dates and phone numbers in the lower section. Save to disk with SELECT and type D:FILENAME. DO NOTN} SAVE OVER ORIGINAL CREDIT.BC TEMPLATE. That is your backup copy. USING BANKS.BC: Column AC, Current Balance,N} is a formula. Do not enter numbers in this column. Enter zeros in those cells from AD to AM that have sample entrN}ies. Using your unpaid credit card receipts, enter the amount of each one in the appropriate row of colN}umns AF through AM. Amounts over $99 should be entered in AJ-AM. Use CTRL-A twice to recalculate all cells. ThN}at should reflect current balances except for any unpaid balances from previous statements. If you havN}e these amounts, enter them in column AD and recalc twice. Save your credit card receipts and update your templateN} periodically with new charges. When receiving your next statement, it is time to make use of CREDIT.BC for real. N} RECORDING PAYMENTS IN CREDIT.BC: First enter any interest or fees in column AE (Int). If you have both interest N}and fees, use AE for interest and any other empty cell from AF-AM for the fees. It doesn't matter since they aN}re all added together to make up the Current Balance. Recalculate twice and compare Current Balance with balaN}nce on statement. Now the balance in your spreadsheet should equal the balance on your statement, except for oN}utstanding recent charges that have not yet been billed to you. Your spreadsheet shows your actual debt, in this casN}e. The charges will show up next month. Enter amount of payment in column AN (Amount Paid) and recalculate twiceN}. Column AO reflects your new balance, after payment. Since AO includes the remainder of Current Balance, it thN}erefore includes all items from AD through AM. Cursor to column AD and enter the amount from AO, in Previous Balance.N} Then cursor right to enter zeros in AE (Int) and all items from AF-AM, since they are already included in the New N} Balance. Finally, enter a zero in AN, Amount Paid. Recalc twice to see updated Current Balance. It shouN}ld include the unpaid amount after a partial payment plus any recent un-billed credit card charges. Edit theN} date in AB03. Save changes to your working disk. PRINTING YOUR CREDIT CARD DATA: Remember to edit the printN}er codes in cell AA01 for condensed pitch if your printer does not use Epson codes. CTRL-H homes cursor toN} AA01. CTRL-P for print command. Return to enter upper-left cell of block. Cursor to lower-right cell of block anN}d press Return to print. If you want the entire template, including the information and phone numbers in the lowN}er section, use cell AO22 for the lower-right block. If you just want the recent update, use cell AO12 as lower-right. N} I hope you may find this BCALC template useful. Try it out. o=o=o=N}o=o= hope you may find this BCALC template useful. Try it out. o=o=o=L o=o=o=o=o= COMPOUND INTEREST FOR BCALC By Frank Walters INTEREST.BC is a template file fR}or BCALC spreadsheet. BCALC, by Barry Kolbe and Bryan Schappel, was published in ANALOG magazine, issue 63, AugR}ust 1988. PURPOSE OF INTEREST.BC: Used to compute monthly interest and balances for any bank account using fR}ixed interest, compounded monthly. It is not suitable for variable interest rate investments as the rates areR} unpredictable. INTEREST.BC covers a five year span and requires only a few, simple entries to produce a printoR}ut of your future investment prospects, month by month. Note that it uses all 64 available lines in BCALC, so moreR} than 5 years is not practical at one time. For longer terms you could print 4 years at a time, load a fresh template aR}nd update the years and leap year days and use the ending balance of the 4th year as the starting balance of the 5thR} year. SETUP: Load BCALC.COM into any Atari 8-bit computer with BASIC disabled. Minimum of 48k required. FromR} BCALC, press any key and then SELECT, which allows commands from the text window. Type LOAD D:INTEREST.BC and prR}ess Return to load the file from drive 1. AA01 shows the filename of the template. AA02,AB02 display a wR}raparound of the Balance that would appear on JAN, following AA64-AB64, completing a full 5 year cycle. AA05-AA64 laR}bel 60 months in 5 years. AB05-AB64 show computed balances for each month. Column AC has interest earned duringR} the month labeled on the same line. AD is the number of days per month. AE is the result of a formula that computesR} interest rate for that month, based on number of days and annual rate in AC04. =(AC04/100/365)*ADxx) AC04/100 R}converts annual percent to decimal, which is divided by 365 days to convert it to 1-day's interest. *ADxx multiplR}ies number of days in row xx to compute interest rate for the specific month on that row. It is unnecessary to print roR}ws AE and AF, which is on-screen help. ENTERING YOUR DATA: Refer to your bank statement or CD certificate to R}determine the starting date, Principal and actual interest rate. DO NOT USE ANNUAL PERCENTAGE YIELD (APY) RATE. R} Cell AC04 is where you enter your interest rate. Then scan cells AA05 thru AA16 to find the starting month of your inR}vestment. Edit AA cell to add day, year to that month. Move right to AB cell of same line and type amount of PrincipR}al in the 0.00 cell, replacing a formula in that cell: AA AB 09>MAY 1, 1997 5,200.75 DO NR}OT USE COMMA during entry, it will be added automatically by the program. Because you replaced a formula in columR}n AB, you cannot re-use this same template for more than one account. After printing, you must re-load INTEREST.R}BC from disk to enter a new Principal and interest rate. Move cursor down column AA until you reach the year andR} month of your maturity date. Edit date, adding day, year of your maturity date. This will mark your Balance R} at maturity in column AB. That's all your entries: two text and two numeric entires and you are ready to calculR}ate and print. RECALCULATE--CONTROL-A: You must now recalculate a minimum of three times to insure all formR}ulas are correctly applied in the proper sequence. Use CTRL-A each time. Screen will flicker and re-draw as eaR}ch recalculation is completed. Your cursor will return to cell AA01. Move cursor down to date of maturity R} and you will see your balance at that date. Each line shows the balance and interest earned during that mR}onth, which will be added to the balance to compute the next month's balance. All balances and interest prior to yoR}ur starting month should be 0.00. Balances below your maturity date are projected amounts, based on the same interestR} rates. PRINTING YOUR RESULT: The entire spreadsheet will fit on one 80 column printer page but that is unnecessarR}y. To selectively print the entire term of your investment, place cursor on cell AAnn (nn=line number of date of PrinciR}pal.) Home cursor to AA01 and Press CTRL-P. Press Return to mark upper/ left of block of cells to print. CuR}rsor down to line number (xx) containing your maturity date and cursor right to cell ADxx on that line and R}press Return. Printer should be turned on and ready to print. That's all there is to it. CHANGING YEAR DATES IN 19R}98: Once you print each of your savings, checking, or CD accounts, there is no need to use this tempR}late for them again unless you lose the printout. But for future deposits you may have to update the years in columR}n AA at the beginning of 1998, 1999, etc. Simply edit each cell in AA that contains a year and change them to theR} next higher year. Year 2000 is a leap year with 29 days in FEB. Be sure to change the 28 to 29 in FEB of the new R}year 2000, and also change the 29 to 28 in FEB of the new year 2001. The days are in column AD, across from R}the name of the appropriate month. Then re-save the updated template to disk. Be sure you edit the original templateR} and not one you have already entered dollars and interest rate. After saving the zeroed template then you can enteR}r new balance and interest rate, etc. BANK INTEREST DOES NOT AGREE: A very few banks use a dubious practice oR}f not paying interest on day of deposit but instead pay interest on day of maturity. That results in the fR}irst month's interest being 1 day less than the number of days in that month. Subsequent months will compR}ute interest based on the correct number of days but your balance on the second month would start out too small.R} To adjust for this sneaky practice you can subtract 1 day from the days of the month you opened the account in cell R}AD and add 1 day to cell AD in the month PRIOR to your month of maturity. This interest will be added to the priorR} month's balance to create the maturity month's balance. OR--you could go down to your bank and complain to theR} manager that you are being cheated out of one day's interest, compounded over the term of your account. That's whatP}