@L}5 _$% l0$)$$Hȱ$ UhL" `e$$%`$%`  R@W!( L(1   Y I`  d  Ld M * @  $ % CC$$)%1 Udߥ$9%: !0 S$% DD˙`  }J)Lr d M * @  $ % CC$$)%1 Udߥ$9%: !0 S$%} DD˙`  }J)Lr J  ((  p L ()   J}L= ( L 0q A    IB JC;? D W } LL  ` W )LA!  ߰")-݆ p" } $G@LL 08`Q")<2Q0 -G$Ș݆ UL# ; p8(()(0ʥ)NQ` }$GȘ݆LU )L ݆ L GȘ ݆LL )W>Z   HH)H  }p h  hyhy D L> L JJ    ! LA*` BF }7'8  M HN H` 8 Z  \LdJJ!"! GFE@F (!L }EE !E^ ^ E E7EȩEdE/EȩE  D } .L }  ;F d  ;?F7F? ( .   Z D LL d } . D  L    p  E` , d)  D L) 0BM݊L݉} ML  N݆ L NLML [ TEqEHȱEqEh 0Gȹ G} HLL GɛL  LFREE SECTORS G) *Gȩ GȽG GȌ*jj >G} C8jJ3j2CD( C202C ԠBX` N 1? l LlD:RAMDISK}.COMLu L1 L ;LHL  T`  `8  ɐ     `TU  } L ? .  t`GBJ ~DEHI B V0dV!}QDEHI VF9 ,0 ,0 s0hhL  L` H hDHEh"}DEL8HI4 0 HI,0 0  9 .G VLO#},0 L4*IJ`llD1:AUTORUN.SYSNEED MEM.SAV TO LOAD THIS FILE.D8:MEM.SAV J y08 B|DEHI$} V0 0`B;DEL`?<0LV`@ʆ v s? F0Ξ05: [ BDEHI%} VY8 B V  @  /DE `E:D8:DUP.SYSERROR-SAVING USER MEMORY ON DISKTYPE Y TO &}STILL RUN DOS B;DE J  (` 9 V⪍ ઍ  -'}LLu ÝDEHILV 9 .l 9 .l  `` s$B BH(}I|DE V BLV nB,DE JLV B V BLVDEIʩ BꭝLu }KEA@##@@K: +@AA(1A@ *}CA UA@EgA@(yAR@@@""(@ page 6 lib +}rary(@ 렣""(@ 1-@@1(@1. DEADLY GAME(1- ,}@@1(@2. NIGHTSHADE 21-@@1(@3. PUZZLER 7O(O(DThe picture files to us -}e with PUZZLER are SNOWMAN.MIC and ESCHER.MIC<<)@6-&@H< @)!@@`F*@* .}AAA d%D:DEADLYn% D:NIGHTSHDx% D:PUZZLERD:MENU============= GG;@ /},;@,;@,;A ,;@,;A ,W9@,$-@@("168,-5 W40,255,7,0 0},255,39,6,0,15,14edge all//(' 5 @PLEAW9@,$-@@("168,-5 W40,255,7,0 ;   0 030<?330 2} 00 000 0300000 7 0p 0 03}3<0""""00 70 000 0 0&fff 00sp 4}@00 << bff&`00 7@ 0 335}0 ¦bff&`00 70tt3200 fbff& 00 30@6}32000 0 bbff& 0 30 @< 0 0"3 bbf7}ff0  30 00"2#bbfff<00  H™38}0 00021212 bffff000@D@?HHH  0 00021212? fff&f3309} D@HHHɉ0 0030<=21212ff&&&00 0ȄHH90 ?:}1213 f&&&&00 p@0HO 0 ?0<*f&&f& ;})0 ?0<&f&&ff0 ( 0? 0<}ffffb000 7@ 陙003 0<?&ffff`0 700=}<)00""""" 00 sp 3w)0<?=?>}&bf&f` 0 73@)??0 0 "bf&f` 0 730Cw?)?}0 ?"bf&&00 ttw?)tw 0 ?"bff&?@}0 0@?  0  "fbbf ?0 0@ 0A}  &"&` ?00 03 0??0 &"&?00  B}3000 0   "" ?03? 0C} ? ?033  000<  0 03D}??0 00   0pt0* >0 00E} "  0p t 0w ?D@0 03¢!" !007G wF}D@0 0?""-"  00pw3 Ȉ 0??03""""" "G}00pw3 0 0 ?03"""""""000  w0 <H}0 0?3""""*""""000 w~0 0033 """*""+0"00I} w 033"""*"""300 7 0 J}00""*"+"000 w興 0 00""**"000 K}w 0 0""*"30 0w0 0 000L}"""<00 0w 0 00 """00 @w興M} 00 0 00 """0 @ w興 00 30 ""N}" @ ꪪ0 0 "*" 0 ww@ 0O}?? 0 0 ? "*" @ t 7p 0 ? "*"P} @? t0 ?0"*"03 @0G@ 0Q} ?0"0 t? ?t 0  ?0""""? 0 R}t w?t 0  ?""""  0 t@ w 0 `}) !"`3!3MDFLASDISKADBh@@@&Pd=;@,=6.& DISK #79 V}fS +@1AR@S6-F:A`,%AV$F:Aa,iAY'AW}AA9A A@KA@]AAoAAD{6-A@n;%@X}@p+-@@&/"7%; s116,6,6,7,6,6,6,6,6,6,6,2,2,2,2,2,2,2,2,112,2xE%@'@e.%Y}@(F:A`,E%@)F:Aa,((( (( THE PAGE 6 LIBRARY(******Z}**************((********************A-@A('The PAGE 6 Library consists of programs..(& [}collected from Users and User Groups//(' in the U.S.A, Australia and Gt.Britain//(& and to the best of our knowledge\} all//(' programs are in the public domain.-@ @.(ӠԠҠAY@45]}B2y!AU5-@@P#F:B2y,"@#%D:MENU 6-@& AD:TI^}TLE DISK #79 " ## @P@"""I 1 h_}0ߢ 0.  0?詛 1 y0YЛ 1 ;#L" ;#L! B 1Lhy """?00 t@7  0 30"""/ 0 t 0w@?a} 0 30 "*" 3wp tw 0 """b} 0 3wȃww 0 < """0 0 3wc}Ȱ 0 0 ""< 33000 7ȼ 0 +< d} 300 07ȿ?? 0 0+? 0 7ȿ e}0 +? 0 wp0 "0f} w? p0 0"0 w 3s g}"" 0 @ wꪸ3s0 """ 330 @h}w p0  """"0 77??w p0 0 i}"""#0 @ww?0 00 33꪿#0 @ww뫫j}D@00 33# 0 ww뫺DC30 00k}# 0 ww뫺??30 30# 0  ww뻺l}0030#0 ?7w껺030 3< /m}0 <꺻00 ????</-@ @/(DEADLY GAME ADVENTUREF-@A$~} d An ( (RR(J Well, your uncle Henry has passed on, and now you're rich. But, firstQQ(Iyou have$} to attend the reading of the will. When you get there, you findRR(Jthat the will requires you and your five greedy co$}usins to spend a nightUU(Lin Henry's booby-trapped mansion and survive. You discover that one of theee(]five is ou$}t to make sure that he is the only survivor. And the evening isjust beginning... A A(//(& In $}this adventure I will become your,,($eyes, ears and hands. You will tell**("me what to do with simple two word--$}(%commands such as GET AXE or PUT BALL.UU(LTo move, type the first letter of the direction you wish to travel in, N, E,$}OO(GS, or W, short for NORTH, EAST, SOUTH and WEST, respectively. U is theUU(Labbreviation for UP, and D is used for$}Down. It may also be possible to move::(2diagonally, NORTHEAST (abbreviated NE)for example.TT(L To obtain a list o$}f what you are carrying, type I, short for INVENTORY."(, A1 A3(6//(&My vocabulary is limite$}d, so I may not@,,($understand everything you tell me toJ,,($do. If one way of wording somethingT++(#does not work$}, try another. People^,,($having trouble are usually trying toh))(!do something beyond their (or my)r( capability$}.~((Some useful commands:(LL(Dˠ..looks closely at the specified object.))($}!.........Redraws current room%%(GET, DROP, GO, many others...( ( AdA$}U-@@# A B  A -@@#!! $}AdAU F:Ad,"AUA0$L +V%%( ٠Š[**(" (c) 1982 S$}oftSide Publications`..(&j$'}) (})@@K: }4 $}B -@@4(1. Run Adventure}=-@@+(2. Return to MENU=AdAU}H-@@ $}-(Enter your choice :)@H6-&@H(}!! @)!@B 02}!"@!% D:DEADLY1.ADV<}&} 1AAD ;@P, +@'0@A0@(}[0@@m-@@(@THE DEADLY GAME%-@A@ %+(}d0@@70@@(D You're sitting at home relaxing on asweltering summer evenin(}g whennqq(ithere's a knock on your front door. You slowly rise, wiping the sweat off your brow, and open the door.xlE((} >:@4,Special delivery,>:@4, the man says,l("and you take the envelope from hisKK(Cgrasp. As you s(}ettle back down in yourchair, you examine the stamp.GG( >:@4, Burmesia,>:@4, you mutter to yourself.(}]](>:@4,?Who do I know that lives on an islandas far and remote as that?>:@4,bb( Then you reflect, >:@4(},7unless it's from Uncle Henry. Why, I haven't heard fromQQ(Ihim in years. He always was an eccen- tric old man, h(}e and all his money,NN(Fliving isolated on an island that he purchased for himself just so heUU(Lwouldn't have to bo(}ther with anyone else. Uncle Henry! My, what could thatT4(!old geezer possibly want from me?>:@4,7(P(HIT (} FOR MORETt (}$0@t(K Then you open the envelope and read the note as shocking news awa(}its you.d(( DEAR SIR,(d(HIT IS WITH GREAT REGRET THAT I MUST INFORM YOU OF THE MOST UNFORTUNATESS(KPASSING O(}F YOUR UNCLE, SIR HENRY VAN- DERBILT. IT IS ALSO MY DUTY TO INFORMQQ(IYOU AT THIS TIME THAT THERE WILL BE A READING OF TH(}E WILL OF YOUR UNCLE'SOO(GESTATE IN THE ISLAND PROVINCE OF BUR- MESIA A WEEK FROM TODAY AND IT ISm$(REQUESTED THAT Y(}OU BE THERE.6-@@G( S. HYSTER IIY-@@m(ATTORNEY AT LAW#((HIT FOR MORE#v (}(}$0@@v(L You quickly make your travel plans, and you arrive on the remote island of"RR(JBurm(}esia by helicopter in exactly one week. You are then taken by carriage,UU(Lby Jelope, a servant of your late un- cle, to t(}he mansion, which stands tall6RR(Jon a hill, towering above the small village below. The doors slowly open@n(and y(}ou are led inside.n(J You are in a living room, and sit- ting alongside an oversized table isJUU(Lan ensemble of relat(}ives that you never thought you'd see again and wishTQQ(Iyou hadn't. Their snobby faces show just as much respect f(}or you as you^@@(8for them. You take your place at the last vacant chair.hiI(A Then a tall man, holding a long pa(}rchment, enters the room.L(e(HIT FOR MOREir__(} >:@4,FI am Stanley Hyster II, Sir Henry's (}attorney. I will get to the|;8(%point and read the will without delay>:@4,;(bb( >:@4,II, Sir Henry Dr(}ysdale Vanderbilt, being of sound mind declare this to beX#(my last will and testament.X( >:@4, Let it not(} be said that I do notRR(Jenjoy good sport. I hereby bequeath the sum of one million dollars to beRR(Jdivided equal(}ly among you with the following condition: all of you mustUU(Lspend one night in my mansion to collect your inher(}itance. In the eventQQ(Ithat one or more of you should pass onduring the night, the money will beSS(Kdivided among t(}he survivors. All of you are greedy and undeserving of anyQQ(Iof my money. We shall see who can passthe test of surviva(}l tonight. I bid44(!you farewell and pleasant dreams.>:@4,#((HIT FOR MORE#``(} The lawyer (}then says, >:@4,1That is all. I am here to see that this conditiongg(Tis met. If you will please all retire to yo(}ur rooms. The maid will show you the way.>:@4,% D:DEADLY2.ADV D:DEADLY1.ADVu will please all retire to yo(_ebbSAABBCDSZDEA9XMXXSMBBGKMOFPFPHPKKKHJ1E1RJ2RRRRD1LSVM,}RSLSSIIGGGEQGXXRMDPSBDMZLNAMOTAYDGDBPXII1MDMWFLLTLAXJER,}@@ @ @ ,} ,}!"#$%&'()*+,-./0,}123456789:;<=>?@,}ABCDEFGHI@JKLMNO,}PQRSTUVWXYZ[\]^_,}`abcdefghijklmno,}p%6-6-@0% A  %@Y(QIN THE EASTERN END OF THE LIVING ROOM. A short ,}red carpet lies on the floore6-@q6-@}6-@ A e+(#IN THE CENTER OF THE LIVING ROOM76-@,}C6-@O6-@[6-@e A W(OIN THE WESTERN END OF THE LIVING ROOM. There is an old elevat,}or shaft herec6-@o6-@{6-@  A mK(CIN THE SOUTHWESTERN END OF THE LIVING ROOM. The cellar doo,}r is hereW6-@c6-@m A dN(EINSIDE THE CELLAR DOOR. A set of chipped stone stairs leads downwardZ6,}-@ d A `2(*IN THE SOUTHERN END OF THE LIVING ROOM>6-@ J6-@V6-@` A T2(*IN ,}THE SOUTHEASTERN END OF THE LIVING ROOM>6-@J6-@T A W5(-IN A LONG HALL. There is a telephone her,}eA6-@M6-@W A I'(IN THE NORTHERN END OF THE HALL36-@?6-@I A w (IN A KITC,}HEN. There is aU(.cabinet and stove here. On the stove is a pota6-@m6-@w A eC(;IN A DINING ROO,}M. There is a table and set of chairs hereO6-@[6-@e A V(NIN THE NORTHWESTERN END OF THE LIVING R,}OOM. To the west is a spiral staircaseb6-@ n6-@z6-@6-@ A l2(*IN THE NORTHERN END ,}OF THE LIVING ROOM>6-@J6-@V6-@b6-@l A T2(*IN THE NORTHEASTERN END OF THE LIVING,} ROOM>6-@J6-@T A C(AT THE BASE OF A SPIRAL-( STAIRCASE96-@C A A+(#IN AN ATTIC,}. The stairway goes down76-@"A A  ^<(2IN AN ATTIC. There is an old elevator shaft hereH6-@!T6-@,}$^ A !8.(&IN AN ELEVATOR. There are push buttons8 A")( IN AN ATTIC6-@") A #J@(8IN TH,}E MAID'S ROOM. The door isopen. There is a bed hereJ A $G1()ON A BALCONY. The staircase leads down=6-@'G ,}A %6( ON A BALCONY 6-@&,6-@)6 A &A+(#IN A GUEST ROOM. The door is open76-@A A ,}'6( ON A BALCONY 6-@',6-@16 A (bL(BIN A GUEST ROOM. The door is open. A light switch is on the ,}wallX6-@b A )6( ON A BALCONY 6-@2,6-@)6 A *6( ON A BALCONY 6-@4,6-@1,}6 A +A+(#IN A GUEST ROOM. The door is open76-@A A ,6( ON A BALCONY 6-@6,6-@26 A,} -A+(#IN A GUEST ROOM. The door is open76-@A A .6( ON A BALCONY 6-@7,6-@46 A ,}/6( ON A BALCONY 6-@8,6-@66 A 06( ON A BALCONY 6-@@,6-@76 A 1A+(#IN A GUEST,} ROOM. The door is open76-@A A 26( ON A BALCONY 6-@B,6-@86 A 3WM(IN A GUEST ROOM.,} The door is  . There is also a window in hereW A4?)(!ON A BALCONY. A staircase goes up56-@@? A ,}5D.(&IN A DAMP, DUSTY CELLAR. Steps lead up:6-@DD A 6[9(1IN A DAMP, DUSTY CELLAR. There is a fuse box her,}eE6-@CQ6-@E[ A 7A(IN A DAMP, DUSTY CELLAR+6-@D76-@FA A 85(IN A DAMP, DUSTY ,}CELLAR+6-@E5 A dT(T(I You follow the maid to your room andshe leaves. After a few minutes you+(( hear ,}the door to your room lock.+(;@B$,9@B,9@,;A,9@,9@7,;@#,;@,,};@,;@,;@,;@,00;,;@ ,;@ ,;@P,;,((6. ,} Q-@@&68,-* >-@@BM68,-Q Z-@@B067$&%@,}<$,.4"M67$&%@<$,.Q"Z68,- @" "67B:,%@,.3-@@77"@68,-,}r 6-@A16.. An elevator is hereK6.. The room is darkX6.lockedr6.. The pot has a lid( HIT ,},c 22@#6-)6-/6-56-W"@ *+"@)"@,c6-@-"@,}6-@/O 6-6-6-6-+-0@A0@@O0@1"AR@"(YOU'RE ,}6 @@O-"*8@#,"6@*"@96-@O68@,-6@ B!68@3,-6D,}H68@4,-8"@$*8@0,"6@H68@4,-6F/"#%%%%"@/6-@H%",}@!*"%6-@l&%%%!(& m*-@@&68,-* q# !  W,}est#68@,-s$ !  North$68@,-u# !  East#68@,-w$ !  South$68@,-,} ( (!!"@0*"A;-@@B#O:8,,"16-%@; A   A,}""@" )( 7$&%@<$,) AR"@*"@ %6-@R((Now I know ,}someone's trying to do you in7"@()"@0)"@3)"@5)"@9A#A! v-@+'@&P:'@,},,$@%@z"~ 6-@="@((There's the body of =(he's been shot6"@6("Yo,}u hear a knock on the front door"@3*"'6-%@*(66-@B @\(Ġȡ THE WALLS!,}s(THEY'RE CAVING IN!6-@G"@/(THEY'RE MOVING TOWARDS YOU!G(YOU'LL BE SQUASHED!>#"@*!@,}* @>(THEY'RE MOVING CLOSER!"@*!@--@@?A@dK(SQUASH!m2,}@@@AU@6-@-@@"@ %AU@7A,}Y2m-@@q u  Ag5"@6-%@)"56-,}@Z"@*"@Z(:@4, You need a permit to carry a gun>:@4,_#"@*"@A*"@_(>:@4,!Diamonds,} are a girl's best friend>:@4,C#"@*"@A*"C(>:@4,>:@4,`!6-%,}@=(Elevator is out of control,T(dropping at 90 MPH`6-@1"@*"@1(ˡ Do something,}."@*"@$(ȡ. Ag 26-6-6- A0%%2@,}`AR(4(8JAR@M(`4LOOKA4JUMPA,}4HELPAW-@@WB:,"@*47$@&@<$@&@,Au  AJ,}8@4,"6*4W@("Lawyer won't let you leave with itJ APS#!*"*!@14W)4SI(You,} can't outrun itS AP%8,6-8,% A)(You can't move that way) AP0IA1,}N(--@@@88,,"6@N( WEARING8,"A$$( 78,$&%@,}<8,$,  APS-@@7S7@<@,47$@&@<$@,A c;,}(I don't know what >:@4,>:@4, meansc!)"@)"@3AQ! APXI-@B:,},!7<,0 % ?(I don't understand...I AP]6.7%@:@4,>:@4, here= APY!"@3*"*4GOLM(&The key's in the far corner and you'-}llY6-@ ="@ 3(be squashed before you reach it= AP?#"@A*"*"@368@,--}6?6-@D"@3*4BRO#(ȡ:(THE WALLS CAVE IN!D Ag;8, 1(That's impossible to-} carry; API-@@&8,"/68,-?68,-6@I APP 8,@AP-}4KEYAP`-@@B:47$&%@<$&%@,`8,"6@)8,"6@A (-}(You're not carrying it( AP(-@@(8,"A  AU68,-!68,--}5"@!*4CRAK68@!,-6@AU AQ%"@6-@% AQf#"@ *"@*"@-}/6-@;6-@N(GOOD THINKING!f(Snake falls in loveY"@+((It looks like him too)D(and takes -}it away inY(some dark cornerO"@$68@,-968@,-E6-O AP}"@3-}*"@A6(Broom handle stops wallsI(from shrinkingq67A<A,.HORIZANTAL BROOM}6-@ 68,--} (OK! AQ8,@A`58@!,"6@"6.IN+6.In5 AW 6.ON6.On-#(-} what? (EX.  DRAWER)- AP8,@A`+4CRA*"*8@!,"6@T67A<A(-},.WEDGED UNDER DOOR`6-@|"@6-@D($Ok. That stops the gas from enteringP6-@!r2@-}| A 8,@A%i&8@,")8@,"6@:4CHA*"_( Th-}ere's a wad of gum stuck therei AP'J!"@A*"*4BED@(There's a bronze key thereJ AP([!"@%-}*"*4BED-6-@9!@Q(There's a gun there[ AP*b#(There's nothing under there/"@-}J(now, but it looks likeb(a good hiding place+ AP.8,@A0;.$(There's nothing behind th- }ere. AP>8,@A3?H!8@","6@*4GLO768@",-6@>(OKH APA8,@-!}A@CK!8@),"6@*4ROCA(There's an inscription: K APDF8@7,"6@+4PAP)4-"}NOT<( It says: F APEi 4POR08@,")8@,"6@<6-@H"@_(Large writing: -#}i APH8,@ A PJB"@A*4SAF8(Dial the correct combinationB APLI!4DOO*"@-$}*"@7(Door opens now...I% D:DEADLY3.ADVN:4DOO*"@0(Front door is locked: APP`"@A-%}!4DRA)4DRE8(Open which drawer?T((OPEN TOP, OPEN MIDDLE`6-@R/"@%( OR OPEN BOTTOM)/ AP-&}TY5"@A*4BOT*"*8@&,"6@A6-@O( It's openY APU;!"@A*4BOT*"-'}1( It's locked; APVY5"@A*4MID*"*8@8,"6@C( It's openO6-@Y APW;!"@-(}A*4MID*"1( It's locked; APXY5"@A*4TOP*"*8@',"6@C( It's openO6-@-)}Y APY;!"@A*4TOP*"1( It's locked; APZg!"@ *4DOO*"-6-@C8@#-*},"6@Q( It's open]6-@g API"@)(Cellar door's locked.?(Get the right keyI AP-+}=!4DOO*"@'*"3( Door's locked= AP!4DOO*"@4*"-6-@C8@%,"6@-,}Q( It's open]6-@~67A$<A2,. OPEN DOOR AQ<"@2(It's locked. Get the right key< A--}P8,@A 7 4UND-(Under what? (Ex. UNDER CAT)7 AP9 4BEH/(Behind what? (Ex. BEH-.}IND BED)9 APH!"@*4CAB*"4(There's an axeH"@APB!"@*4CAB*"8-/}(You see some nailsB APD+4GUN*"*8@0,"6@:( One bulletD APQ)4ROC)4NOT)+4-0}POR*"@,G(Something's written on itQ AP? 4POR5(#It's a portrait of Henry Vanderbilt? APX-1}"@A*4DRA'( Look which?N("LOOK TOP, LOOK MIDDLE, LOOK BOTTOMX APr"@A*4DREf(JThere are 3 draw-2}ers. The top has a bronze lock, the middle a gold lock,r6-@ 6"@ ,(the bottom a silver lock6 AP-3}]!"@A*4TOP*"@-6-@!9"I( A bobby pin]"@AP:"@!*"0(The-4}re's a zinc key: APE+"@A*"@*4MID*";( A brass keyE APJ+"@A*"@*4B-5}OT*"@(A pair of glovesJ APK!"@A*4SAF*"A(It's got a combination lockK AP9!-6}"@A*4SAF*"@/( A diamond9 APP"@A*4BED#6-@0/"<(A pillowP"@A-7}P^+"@A* @*"@*4WIN76-@T(A gypsy woman down below^ AP1"@0*"-8}'( A blanket1 AP. 4ACI$(It dissolves glass. APb"@E*4BEN#6-@1/"N(A ca-9}n of hydrofluoric acidb"@AP;"@1*"1(A jar of turpentine; AP@"@D*4BOX-:}4(You see two broken wires@6-@2e"@2*";(You try to tie and twist them[(but they keep falling-;} aparte AP6"@2,(mended with a wad of gum6 APv"@!)"@B-"@*4STAK(A woo-<}den step is missing.`(Looks dangerous!l6-@v @E)(You see nothing special) AP8,@A-=} j!"*"@#*4BUT-6-@B68@,-I6.`(Elevator goes downj AQM'"@A->}*"@*4 31R76L33R7( Safe's openC6-@M APW"@0!4SWI)4LIG-6-@49"M(-?}Nothing happensW AP#"@4*8@",6@E2@@@@g2@@@-@}{-@@ A@dAU@ A A-@@ -AU@-A}?A@S-@@W [ u(You were electrocuted Ag6"@46-@%(,6-B}.6 AQ8,@A@u 4DOO]"@@)"@8)"@2)"@))"@$)+"@4*,)+"@ -C}*,k6-%@u A7!4DOO*"@'*"@-6-@(7 A} 4DOOY+"@A*,)"@(-D})"@0)"@3)"@5)"@9)"@%g6-&@s6-} A-4STA*"@C#6-@- -E}A-4STA*"@#6-@C- A-4STA*"@&#6-@ - AG%4STA*"@ *8@-F},"6=(Snake won't let youG AP-4STA*"@ #6-@&- A e4STA*"@-"@B)"-G}@!96-@5e(&You tripped on something on the stairs "@5)"@65-@eA@Q2-H}@@e-@@i m "@6Ag M"@512C( and -I}fell downM Ag -4STA*"@B#6-@!- A -4STA*"@!#6-@B- Ah 4ELE#-J}"@")"@44)"@B( šR( NO ELEVATOR^6-@6h A4-4ELE*"@"#6-@#--K} A8,@APN!"@*4POL*"@B(VOICE ON THE OTHER END SAYS,N6-@7]"@7-L}G(>:@4,We'll send someone right over>:@4,S6-@] AP"@#-@@E2-M}@@@Y-@@] 2-@@ ."@ -N}$( It's busy.... AP8,@A`4POR*"@:8@,"6@)8@,"F6-@8\-O}8@,"6@h6-@t6-@6-@9="@93(It was a painting on a painting= AQ."-P}@8$(With your hands?. AP$8,@Ap&"@B)"@!-4STA*"@96-@@w-Q}8@,"6@*8@B,"6@*8@6,"6@6-@A'+"@@!( You can't yet+ AP(o"@A-R}.67A4<A@,.2 NAILS:6-@F6-@R6-@^6-@e(OKo A.8,@A-S}0w4WOO)4PLAI"@'*"*"@*8@5,"6@X68@,-d6-@k(OKw6-@D1t-T}"@D#-@@07-@@S2@@@W t-@@6@2_"@D-U}+2@@@/ 3 U2@_ AQ88,@A:W-8@@,"6-V}@)8@2,"6@M(On what? (Ex. ON ALLIGATOR)W APB8,@ ACt+8@@,"6@*"@A-W}*4WINH-@p6@d2@@h t6-@ED"@E12-X}K(Acid dissolves glass.f(You throw the can awayr6-@@~6-@6-@ AE!4POR*8-Y}@2,"6@D8@,")8@,"6@P6-@q(You toss the empty vial away}6-@26-@6--Z}@QF`+"@D*8@ ,"6@*4WIR76-@C6-@ O6-@V(Ok` AG"@QA-[}V8,@!A XK!4PIL*"@A*"A(With what? (Ex. WITH STICK)K APY74DOO*"@4-\}-(It's a steel door7 APZ~54DOO*8@9,"6@*"@'*"?(K6-@P~67@4<@c-]},.BROKEN DOOR, PLANKS OF WOOD[{"@P#-@APa2P:H:,$@0,P:H:,$@-^},e q6-@{ AQ`8,@"A0b_5"@A*"@*8@(,"6@*4DIAS(You toss d-_}iamond to gypsy_6-@Rc"@R6("and she tosses something up to youB6-@(N6-@Z6-@p68@&-`},-6@68@,-@& Ad Aj8,@#A@ke+"@A*4LOC*8@$,"6@-a}76-@SC"O6-@[6-@ e A&l<"@S*"%6-@26.opened< APPt-b}8,@%AvW5"@A*4POR*"*8@,"6@A6-@'M6-@W Auxo"@A*-c}"%6-@c+4CHA*8@,"6@,)+4HAM*8@6,"6@,o6-@`yi7"@`)+4ROC*8@)-d},"6@*"@,B(](You killed a tarantulai6-@g{;"@g%(under your pillow16-@;-e} APH (Sorry, you can't do thatH!)"@3)"@AQ AP`!(ȡ7(J-f}umping saved your life.`($You are thrown out, shaken but alive!#-@A?2@-g}C O6-@[6-}2 AP(Wheeeee AP3!@* @-q} bŠbb렣bb%DOS SYSb>1SNOWMAN MICbSAUTORUN SYSb UTITLE b)MENU bzDEADLY bDEADLY1 ADVbDEADLY2 ADVbEDEADLY3 ADVbeNIGHTSHD bW+PUZZLER b>ESCHER MIC)( CALL POLICE3 APB"@!)"@B%"@8(FIX THE STAIRSB AP."@$(YOU NEED TO WI-r}PE. APF(Examine things.<( Look under things, behind thingsF APT)(!Say again & use type of key metal4-s}6.DROPJ"@)"@T6.GET'((Ex.  PLATINIUM)' AP4A 6-@" A -t}M"C(/made of unbreakable glass and it can'tbe openedM A "(and has no glass" A PPDOOFRONT D-u}OOR,-6,DOODOOR,-27,DOOOPEN DOOR,-29,DOOOPEN DOOR,-32,DOODOOR,-34^^PORLONG OIL PORTRAIT (ON WALL),41,DREDRESSER,-41,CHACHA-v}IR,41,BEDBED,-41,DOOOPEN DOOR,-38ffBENWORKBENCH,-45,HOSGARDEN HOSE,46,LIDPOT LID,0,SNARATTLESNAKE,0,DOOOPEN DOOR,-40,SAFW-w}ALL SAFE,0ccSTEWOODEN STEP,0,DOOOPEN DOOR,-24,PILPILLOW,0,GUMWAD OF STICKY GUM,0,BLABLANKET,0,GLOGLOVES,0^^ZINZINC KE-x}Y,0,PINBOBBY PIN,0,BRABRASS KEY,0,SILSILVER KEY,0,BROBRONZE KEY,0,DIADIAMOND,0jjROCJAGGED ROCK,0,GUNGUN,0,BULBULLET,0,TUR-y}JAR OF TURPENTINE,0,MAIMAID,0,LAWUNCLE'S LAWYER,0,SAWSAW,28nnHAMHAMMER,30,NOTPAPER NOTE,35,GOLGOLD KEY,33,AXEAXE,0,ACIHYD-z}ROFLUORIC ACID,0,BROLONG BROOM,25,NAINAILS,04]]W N E S GETTAKDROPUTSTISTUIN UNDBEHWEAREAOPELOOPUSPRETURDIAGO ENTCALWIP-{}FIXHAMSAWPOU9ON BREHITSMATHRGIVPICWIT>\\1,1,2,3,3,3,4,5,6,7,8,9,10,11,11,11,11,12,12,15,16,17,17,18,19,20,21,21,21,22-|},22,23,25HYYcousin Rachael; s,,,cousin Phil; ,,cousin Marilyn; s,,,cousin Alex; ,cousin Fred; , -#(I don't know what y-}}ou mean!- AP3(%(HIT TO CONTINUE...)3 A (Ok%-@AP % A,7--~}@@p32@@7 .-@@92@@@M-@@%Q-} k0@@2@@@-@@% 010@! 1( Y-}ou're dead67(This adventure"(is over4AR7 D:DEADLY2.ADV010@! 1( Y,W@"U"SAABBCDSZDEA9XMXXSMBBGKMOFPFPHPKKKHJ1E1RJ2RRRRD1LSVM1}RSLSSIIGGGEQGXXRMDPSBDMZLNAMOTAYDGDBPXII1MDMWFLLTLAXJERXVVGZR1}@@ @ @ 1}1} !"#$%&'()*+,-.1}/0123456789:;<=>1}?@ABCDEFGHI@JKLM1}NOPQRSTUVWXYZ[\]1}^_`abcdefghijklm1}nopqrstuvwxy6-@6 A1}II;@$,9@,9@,;@6,9@,9@,00;,;@ ,;@ ,;@P,;,.1}.6.$ Q-@@&68,-* >-@@M68,-Q 1}Z-@@067$&%@<$,.4"M67$&%@<$,.Q"Z68,- ("-@@"1}(68,-C 6-@6-@+6-@76-@C6-@,I%216-1}=6-I6-/O +!0@;0@@O0@1rAR@1}r(XYOU'RE IN THE EASTERN END OF THE LIVING ROOM. A short red carpet lies on the floorl,%%%!(, 1}m*-@@&68,-* q)!  West)68@,-s*!  North*61}8@,-u)!  East)68@,-w*!  South*68@,- ( (;-@@1}#O:8,,"16-%@; A   A""@" )( 7$&%@<$,)1} A"@A`_"_(KAs you open the front door, in steps apolice sgt. of the IPD (Island Polic1}e]"](IDepartment), and walks quietly onto the smooth red carpet, adorning the8""(entrance ha1}ll..6-@8 APU"@U( >:@4,Thank you, dahling,>:@4, says the maid.f"@1}f(>:@4,GHe didn't suspect a thing. It worked well. Now you and I will share theo"@Y(:fortune. No one ev1}er suspected that you and I are lovers>:@4,e6-@o AP_"@_( >:@4,Yes,>:@4,1} the sgt. answers. >:@4,It was aa"@a(Lfoolproof scheme, you taking care of the dying old geezer in 1}his last days.J"@4(Now we'll have it all>:@4,@6-@J APh"@h( And to you the1} sgt. says, >:@4,*I regret your upcoming passing, but I must_"@_(Kadmire your valiant success at sur- 1} viving all the attempts on your life.d"@d(EIn a way it's a pity. But with you dead, no one will stop us. 1}>:@4,P"@:67@<A,.WITH DRAWN REVOLVERF6-@P APj"@T(@The sgt. dra1}ws his service revolver and points it at your head`6-@j AP"@6-%@p"@Z( 1}>:@4,+I am going to count to 5 and then kill you>:@4,f6-@p APo!A(The sgt. counts1}, >:@4,>:@4,.M!@Y6-@c Ao6-@36"@3,(YOU HAVE JUST BEEN SHOT!6 A1}gt"*"@h(JThe sgt. outraces you for the fallen gun, picks it up, and squeezes off at6-@4D1}"@4$(couple of rounds06-@: AD Ag%"*"@%6-@!6-%@1}x#8@,"6@*"l(DSuddenly you see the sgt. reaching forsomething in his jacket pocketx6-@1}?"@5(!He threw a dagger into your heart? AgI%216-=6-1}I6- A0%%2@`AR(4(8JAR1}@M(`4LOOKA4JUMPA4HELPAW-@@WB:,"@*47$@1}&@<$@&@,Au  Aq0E* @e(KYou haven't a chance to escape. The gun is1} pointed at your head and wouldq6-@DC"@D9(%kill you before you could move a stepC AP; 0E1(1}!You'd better not...they'll escape; AP1 4E'(You can't move that way1 AP0IA1N(1}--@@@88,,"6@N( WEARING8,"A$$( 78,$&%@<8,$1},D :(.You must have lost all else you were carryingD APS-@@S7@<@,47$@1}&@<$@,A E;(I don't know what >:@4,>:@4, meansE AQ! APXI-1}@B:,!7<,0 % ?(I don't understand...I AP]6.7%@:@4,>:@4, here= AP"@6-@;8, 1(That's impossible to carry;1} API-@@&8,"/68,-?68,-6@I APP 8,@APR-@1}@:47$&%@<$&%@,R8,"6@A 0&(You're not carrying it anymore0 AP1}(-@@(8,"A  A!68,-!68,- 68,- (OK! AQ1}8,@A`K"!4CAR)4RUG-6-@w?AK6-8"@w8($You s1}wiftly pull the red carpet from]"@w](Iunder their feet. Both of them go flying and fall momentarily stunned1}"@wM67@v<A,.&FALLEN SGT. PETE ZAH b68@,-@o6-6@{6-@61}-@<"@w267@@<@P,. FALLEN MAID< AP8,@A!!8@,6@A1}l(You pull the trigger(6-@2 AM(and, with quick shots,`(kill them bothl6-@#"@#1}267@@<@P,. DEAD MAID ^67@v<@,.DEAD SGT. s68@,-@6-@ AP 1}8,@A%& 4DOO( Not now...& AP.8,@A;)(You see nothing special) A1}P* (Sorry, you can't do that* AQ>4(,You just wouldn't be nimble and quick enough> AP&(I can't h1}elp you now& AP]]DOOFRONT DOOR,-6,MAIMAID,-6,SGTSGT. PETE ZAH,-6,REVSERVICE REVOLVER,0,DAGSMALL DAGGER,04**W N 1} E S GETTAKGRADROPULSHOGO LOO>1,1,1,2,3,4,5,6 -#(I don't know what you mean!- AP?6-(1(HIT 1} TO CONTINUE...5? A (Ok%-@AP % ApRR(JAs you look down, a smile comes to 1} your face. You gently blow the smokez]](3from the muzzle of the gun and say to the corpses, >:@4,you didn't su1}spect aSS(Kthing either. Now I am truly the lone survivor and heir to his fortune. YouV6(#see, I am the one 1} uncle!>:@4,9(S( FINISV,H( YOU'RE DEAD!(-@@pD2@@H .1}-@@92@@@M-@@%Q k0@@2@1}@@-@@% 0!0@! 67(This adventure"(is over4AR71}(#k-@.-@p6@J2@@N k-@6@2#*2@1}# ' *$ D:DEADLY3.ADVJ2@@N k-@6@2#*2@0/2*2NNNNNNNNNN1NNSN95N1N1N1N1N1N1N1N1N1N2N676DANFAISAVATARCCELVIU5}ROIININVNNNVBSGFCOZCHSEDMVCHBASBYT5} 5} !"#$@%&'5}()*+,-@./012345675}89:;<=>?@ABCDEF5}GHggREVISED 2/16/85 | ANALOG COMPUT- ING ISSUE #36 [IF STUCK, REFER TO HINTS IN MAGAZINE]A7"5}A APJJ1,2,3,4,5,6,7,8,9,10,19,39,13,950,11,12,13,14,15,16,17,18,195},20,6760'6-?:C:,6.Cz!uif!npvoubjotjef%6-%-6-%35}6-;6-%>$$ 6.6-%6-%!6-%$$ 6.6-%6-%$$ 6.6-%6-%!6-%$$ 6.5}6-%6-%$ 6.6-%6-%$6. Jo!b!usff6-$"6. Jo!b!cpbu6-$, 6.6-%$5}/ #AX!-@r"+67,.>:,/ %-@5"!67,.>:,% %-@w"!67,.>:,% %5}-@5"!67,.>:,%  -"68,- H -"6-&B:,167$&%<$&,.:68,-> H A5} B:,  "%6-"*8,6AH(A!6-?:C:,<<<%,! @EA6-?:C:,<5}<<%,-.(+))))),7(NoneA A p(N (S (E (W (U 5}(D K6-?:C:,<<<,'6-?:C:,<<<,96-?:C:,<<<,K6-?:C:,<<<,+ 6--O:8,,! + 5}A t26.7$&%<$,- &6-.6-%2 (-(Nothing+6-?:C:,<%<<,+6-?:C:,<%<<5},+6-?:C:,<%<<,+6-?:C:,<%<<,) 6--8,6 ) A 86.7$&%<$,"-@!& .5}6-%46-8 (-%(NothingL 6-6-6-) -2- )2 A`5};6-?:C:,<<<%,+6-?:C:,<<<%,1-5(;-36-?:C:,!"@!*"@#*8,"6:6.Ju(t!Efooz(t!sppn=> 5}[("*"@%*8,"6*8@$,"B6.If!ibt!b!cppl!qbhf/Q68@$,-W6-[ :8,"6*"@266.Ju!t5}bzt;!VTF!CMVF!TDSPMM: /8,"6*"+6.Ju!tbzt;!BTZ!SQTFPU/ ;"@7*8,"676.Ju(t!b!wfsz!npwjoh!qjfdf5}/; <"@4*8,"686.HMVF;!nve-!bmhbf-!dsztubm/< /8,"6*"+6.Ju!tbzt;!BTZ!NTFFTB/ 8"@!5}*"46.Ju!tbzt;!BMJ!CBCB!XBT!IFSF8 >"*"@%*8,"6:6.If(t!gsjhiufojohmz!vhmz=> 5"@$*8,5}"616.Ju(t!gspn!uif!cppl/5 ="@3*8@3,"696.Ju!tbzt;!GPS!TUSFOHUI=  ($(Denny sees nothing of v5}alue.(  <'"@&*"@0*8@3,686. Upp!ifbwz/<  + 8,"6'(Denny already has it!+  * 8, 5}&(Denny can't get that!* ( &O:8,,"(It's not here.& < !1@!!,@!F 8@2-4(5}Denny can't carry anymore!8 d  68,-66-  2 8,6((Denny doesn't have it!+(.(2  558,6)+5}@'*@(*@5,A'P H6. Jo!uif!kvh///!68,-6'6-/6-%5"?68,-6H68,-    15}, 8 -@24(There's no more room here!8  )8,6))A(@ W%6.If!tbx!ijntfmg!bo5}e!gbjoufe=.68,-868,-6G68@%,-M6-S6-W     68,-6- iG"*"*(8,46.Uifz!tipx!5}Efooz!tpnfuijoh/=68,-C6-G j3 "*"/6.Uifz!uijol!if!tipvme!mfbwf/3 k_%"@&*"@)*(8@0,F5}6.If!pggfst!Efooz!tpnfuijoh/U68@0,-[6-_ lE"*"*(8,16.If!qpjout!up!tpnfuijoh/;68,-6A6-E 5}mK%+"@&*"@),)+"*",G6.If!ibt!opuijoh!npsf!up!tbz/K |B"@0*"@926.Tif!qjodife!Efooz=5}86-B BP K8,"6*"@316.Efooz!gffmt!tuspoh=A68@3,-6G6-K  V!"*"*8@%5},"6*(8,B6.Uifsf(t!b!tusbohf!eppsxbz=L68,-6R6-V ;"*"*8,676.Efooz!tfft!uif!dmptfu!xbmm/; 5}  q' "*"6-@( #6-'  Y"@)*8@7,"616-$+",%$+",K6.Zpv!dsptt!uif!qp5}oe=U68,-6Y  N"*"*(6-&68@%,-6>6.[{{{{{{{{{{{{{{{{D6-J6-N ! "*" 6-5}6-! 2"*"*8,"66-!6-*68,-. 2 )"*"*8,"66-!6-% ) +"*8,"66-@5})#6-' + + "*"'6.Efooz(t!opu!tmffqz=+ )"*"*8,"66- %6-) !!+*,)@65}AH$4 8,6$6.Efooz(t!tjoljoh=*6-4 BP  6-6- AH'6"@!&6.5}Efooz(t!gbmmjoh=,6-6 BP 6-&6-  //@!)@#)8@#,6AH0G3+8,"6)8,"6})8,",*8,"6*8@$,"696-?6-C G 8(6.Efooz!ibt!gbjmfe!ijt!njttjpo==.6-8 BP d68@26},"6*8@3,"*8,"6*7<,4PRESK6.Uif!cpy!pqfot=Q6-`68@3,-d b2"@!*8,"6*8@#,"*6}7<,4SESAB68@#,-6H6-^6.B!epps!bqqfbst=b B6-?:C:,(>:@4,>:@4,B6} <<@$)@1)8@',)8@0,6AH Y"6.Uif!cpvmefst!csfbl!pqfo=168@',-@68@8,-6}O68@1,-U6-Y  738,6)8,6)8@$,6)+@$*,7 + *'6.Dbo(u!ep!uibu!ifs6}f=+  B`9/%6.Uzqf!jo!uif!fodszqufe!ijou/+6-/ 3+ -#( )-3( -6}(ΠNN;$,;$,;A`,;@&,;,;,;@w,;@7,;,@@;$,9,;@y6},9,;@5,;,;,;,;,ee104,104,133,204,104,133,203,104,133,206,104,133,205,104,104,133,207,162,0,142,26}55,6,134,213,232]]160,0,177,203,209,205,208,8,200,192,3,208,245,134,212,96,173,255,6,24,105,3,197,207,240TT16,141,2556 },6,165,205,24,105,3,133,205,144,217,230,206,176,213,169,0,133,212,96bb216,104,104,133,204,104,133,203,104,104,133,205,1606 },0,177,203,201,61,240,11,56,233,1,145,203++200,196,205,208,240,96,169,33,208,244aa104,104,104,141,253,6,104,104,141,26 }54,6,104,104,141,255,6,165,88,133,203,165,89,133,204,174__254,6,240,14,165,203,24,105,40,133,203,144,2,230,204,202,208,246 }2,165,203,24,109,253,6,133^^203,144,2,230,204,56,165,203,233,1,133,203,176,2,198,204,172,255,6,169,0,145,203,136,208 6 }251,96``104,104,104,141,255,6,104,133,204,104,133,203,160,0,177,203,201,32,240,8,200,204,255,6,208((244,160,0,132,216}2,169,0,133,213,96V6.Jo!b!nbhjdbm!gpsftu36.Jo!b!tupof!sppnE6. Jo!b!wbmmfzV6. Po!b!usbjmHCC6.9EXALOOTAKGE6}TDROGIVPUTTALDRIMOVCLISINGO ENTSAYHITSMAGLUHELprr67<@,.]BOOBEDCLOGLOREDTREWOOBLUFAMSHOHUTSIGGLUFAIMIRJUGBOADWATUNG6}OLSILBRAGLAPAGTROSTRCRYMUDGIAHAMBOUz3367@<A,.BOXPOTCARALGSWAMUSROCHAG! 6. 67$,. !67,. 6}B  A 001,1,2,2,3,3,3,4,5,6,7,8,9,9,10,11,11,12,13``CPPL,5,CFE,-5,DMPUIFT,-6,HMPXJOH!EPPS,0,SFE!TDSPMM,25,6}USFFT,0,XPPEFO!EPPS,0,CMVF!TDSPMM,2833FMG!GBNJMZ,-13,TXBNQ!TIPFT,0,IVU,-15,TJHO,-21RRKVH!XJUI!HMVF,0,GBJOUFE!USPMM,0,6}NJSSPS,16,KVH,16,CPBU,-12,EXBSG,-17,UVOOFM,0^^HPME!EPPS,-18,TJMWFS!EPPS,-18,CSBTT!EPPS,-18,HMBTT!EPPS,0,CPPL!QBHF,0,USPMM6},0,TUSFBN,-23iiDSZTUBMT,0,NVE,14,HJBOU,-26,IVHF!IBNNFS,0,CPVMEFST,-24,GBODZ!CPY,27,QPUJPO,0,SFDJQF!DBSE,16,BMHBF,0 77T6}XBNQ,0,TIFFU!NVTJD,29,CJUT!PG!SPDL,0,PME!IBH,-30h&(Denny can't do that!& A Ap@9 -%(LOAD FROM A6}PE OR ISK)94DAi 0T( Ah @ -&(CUE, PRESS RETURN TWICE.4K:;)@6}C: Ai $D:NIGHTSHA.DAT$6.D -68,- l"6-(6}( A`" 6 -'(NO GAME DATA SAVED! ,6 AA -#(SAVE TO APE OR ISK'/4D76.,6}A Aq 0TAp`H -&(CUE, PRESS RETURN TWICE.4K:;)@H6.,C: Aq@6}D:NIGHTSHA.DAT   - 8, 4 ((6. A(#]+ 6}AV#AYG6-F:A`,%AV$F:Aa,%U&@q]%'E%@$@e.%@%F:A`6},E%@&F:Aa,'Q@!AA6-A 9AEAQAR' -( NIGHT6}SHADE$'[ -[(M |+*+*+*+*+*+*+*+*+*+*+*+*+*+*+*+*+*+|.'[ -[(M|*6}*| |+||+|8'[ -[(M|*|| ||*| |+|6}|+|B'[ -[(M|*|| ||*| |+||+|L'[ -6 }[(M|*|| ||*| |+|| ||+|V'[ -[(M|*|| 6!} ||*| |+||+|`'[ -[(M|*||٠ |٠ ||*| |+|| | 6"} ||+|j'[ -[(M|*|| | ||*| |+|| | ||+|o'3 -3(%|*|6#}| | ||*|t'[ -[(M|+||+| |**|6$}~'[ -[(M|+*+*+*+*+*+*+*+*+*+*+*+*+*+*+*+*+*+| 'AY@4'' 6-66%}-6-6-!6-'6-' 6. :J+ARA%-) /-J(DENNY WAKES UP IN BED.:( -(6&}(Do you want to play again?:KK:)("@:Y,.-7(OKAYA#AaK A :"@:N,: 6'} BP >?+AAR%-?(You saved Nightshade!> B`}0 ;,#B - ",67,.6(}>:,0 }PP104,162,4,160,0,177,205,145,203,200,208,249,230,206,230,204,202,208,242,96 }"6-F:A,&"6-$AV}6)}F:%@,"AU$}-A!AA$-6-?:C:,,}""6$(}) -"%$% ) B6*} 0d}((10,255,170,170,170,170,170,170,255n}%%11,255,85,85,85,85,85,85,255,-1 D:NIGHTSHD"%$% ) B4d**FILENAMTPCSPLAYRFLGSTKSDSCSCRSCR2HKSARELODEC1CCC1XYYXADDADDROTINPMBASPMCXP:,}YPYPYINMOVXPFLADCMPDL@ :-} :.} !"#$%&'()*:/}+,-./&&================================mmANALOG ISSUE NO.22 MI:0}CRO-PUZZLER by Larry G. Hearin (enhanced for joystick ctl)&&================================ GG;@:1},;@,;@,;A ,;@,;A ,W9@,$-@@("168,-5 W40,255,7,0:2},255,39,6,0,15,14,255l +@-@@: @ MICRO-PUZZLERL-@@l @by larry g. he:3}arinp@@d'B7t@d<F:Ad,"@(P-@AT fAdAUp @P(S-@:4}@5 @PLEASE STAND BY...? A0SLoad ASM routines2MAY@4+1@@dC:5}B7t@dM @P3Y-(%ϭҠ0(Y($HEY 'JIGSAW' FANS! THIS PROGRAM WILL4RR(JLO:6}AD ANY 62 SECTOR MICRO-PAINTER PICTURE FILE [OR P.D. ARTIST PICTURE5SS(KFILE] , DIVIDE IT INTO 120 PIECES, MIX AND:7} ROTATE THEM, AND THEN LET YOU6Y,($TRY TO PUT THEM BACK TOGETHER AGAIN!/(Y(%Ǡ: USING JOYSTICK (OR THE7QQ(:8}IARROW KEYS) MOVE THE CURSOR OVER THE PIECE TO BE MOVED AND PRESS BUTTON 8pm(e(OR RETURN). THEN, MOVE CURSOR TO THE OTHE:9}R PIECE YOU WISH TO EXCHANGE AND PRESS BUTTON (OR RETURN).p(9r#(Ǡ: PRESS KEY&(M("Ǡ: PRE::}SS KEYP(o(PRESS TO CONTINUE...r(: F:B2y,@@X;pp(hPLEASE INSERT A DISKETTE CONTAININ:;}G MICRO-PAINTER PICTURE FILES INTO YOUR DISK DRIVE AND THEN ENTER...<T(((>(OR [̠] FOR DISK DI:<}RECTORYA(I(? T@F F:Ad,"AU@pP4F:Ad,A&(>:@0,*4 AZxAd:=}AU"6.D1:*.*6(ENTER DRIVE # :Q67@<@,.[ @1x@@d( @`:>}@(( An< @`&7@<@,4:26-@< A0s27@<@,4:(6-@2:?} A0xg-B:,@6@=67%@<%@,.7<,A [67@<@,.D:g6-@S +@$:@}@@d1B7t@dS6-F:A`,%F:Aa,$AVX)6-F:%@,%F:%@,$AV?6-&@$:A}A$X6-F:%@,&@2%%@@x%6-%@62@@6F:,"@eA:B}F:,"@@2F:,"@y@x,6-%@26-6-%@ A`W%2:C}0@: @PW@@?6-@?7@<@,4062A:D} ^@+@@8@E@R@^6-@ 67,.5@:E} @P5@@5AY!6-?:C:,,5@@Pg)@A)):F}@5AB)@NA [)@gA @ AY@4"@Ap:G})-@A %67<,.>:,) ]-@A 96-P:H:,$A ,%@B6.7,R67<,.7<,]:H}67<,.I%6-P:H:,$A,%@E67<,.=:+!@P,$@,I |-@@+-@@:I}16-76-Q6-+&@,$@%|6-P:+@:7<,,&@,'@,%@d%6-@:7<,,&+&@,$@Z2:J}H:,$@%@@@d A @">7<,41.6-%@$@@%@>6-?:C:,<<,,- :K} -26A6-@20%@F:%@,&@2AF:,&@2@J&6-P:+&@,':L}@,$@2BBy@6-$AVJ BJ7 #A@!-@@%"367<,.>:,7 T%%255,129,129,:M}129,129,129,129,255^I-%A%Ag'+ 76-IA#@hAY@F'B2w:N}@9B2H@HKB2IW6-@c6-@oB2V{B2W6-rO-@@1%:O}A%%@:7<,,K%A9%%@:7<,,O t-(T:,#Ad@- Av R:,"@A:P}x-Ad8R:,,-@w|%246-F:Ad,V6-%@&+"AU,:Q}$AVbAvAAU&6-F:A#,J-A#+"@,$@%+"@,JF:B2y,"@A:R} "AUAr'AdAU'A#@ A@%%2@@@@:S}@APA6-&@ A pAB2H@H%@$+&@,@ApA6-%@:T} A pAB2H@H%@$+&@,@A6-@ A A @:U}A@6-6@ An6-%A%6-%C6-?:C:,<<<@<@<@,n6-?:C:,:,>7<,41.6-%@$@@%@>6-?:C:,<<,>7<,41.6-%:a}@$@@%@>6-?:C:,<<,)6.7<,67<,.7<,)67<,. -6-!B2I-6-:b}/6-?:C:,<<<Av,/"@A 'B2H'B2I*6-@#-@7:c}-@]2A&$@@d6-6x-@@|   4 A\]-@@:d}2 @CONGRATULATIONSD-@@] @ you did it!fY-@@- @ PRESS ?-@:e}@ Y @ TO RUN AGAINp%2A@@7AYIA``AaF::f}%@,rAA@@A AzAAH'AY@4;-@@u? :g}TF:Ad,"@(v2 @ %2A@@7AYN:h}AaP:'AV,mA`&F:Aa,$AVyAAA A-AY@4A-:i}@@uE ZF:Ad,"@(|2 @  AMove card_16-%+&:j}@,$@%+&@,$A@_6-%+&@,$@%+&@,$A@++6-?:C:,<<<@<@<@@,:k}$!@6-@$ @6-@$"%!A6-@&"$% @6-:l}A&$'B2H'B2I`&6-+P:'A$,%@,$A$:-@H%A:m}L `%@@qf%@F:%@,*%@@%@%@2T-@@b%@f :n}D%@@e+%@D%@P:'AV,~@@,@F:%@,C@F:o}:%@,UAYgA`~AaF:%@,\-@#-F @ :p} J \AY@4$UB2H'B2I1+C@@dUB7t@d:q}W-@@?(%must save to same disk as screen fileW(ENTER SAVE FILENAME2B:,"(Ad@:r}(2 @ * 4 ( (ERROR-TRY AGAIN* A!@ A 5@@E(@7:s},R(@_(@j@|Ad@( @ D;@B,#A.-@@B2"@67<,:t}.>:,D D;@i,#A .-@@i2"@67<,.>:,D D;A,#A`.-@A2:u}"@67<,.>:,D $D;A&,#A .-@A&2"@67<,.>:,D .$8Load screenBhh216,104,:v}162,16,169,7,157,66,3,169,0,157,72,3,169,30,157,73,3,165,88,157,68,3,165,89,157,69,3,32,86L++228,189,67,3,133,212,169,0,13:w}3,213,96VMove card`ee104,104,133,204,104,133,203,104,133,206,104,133,205,104,104,133,207,104,104,133,208,104,104,133:x}jbb209,164,207,136,177,203,145,205,136,16,249,198,208,240,29,165,203,24,101,209,133,203,165,204tRR105,0,133,204,165,205,:y}24,101,209,133,205,165,206,105,0,133,206,24,144,213,96~Compare memoryee104,104,133,204,104,133,203,104,133,206,104,1:z}33,205,104,133,208,104,133,207,201,0,208,8,165,208ee201,0,240,4,198,208,198,208,160,0,160,0,177,203,209,205,208,48,165,20:{}7,201,0,240,31,198,207,165bb203,24,105,1,133,203,165,204,105,0,133,204,165,205,24,105,1,133,205,165,206,105,0,133,206,24:|}bb144,213,165,208,201,0,240,14,198,208,24,144,214,169,1,133,212,169,0,133,213,96,169,0,133,212133,213,96Rotate:}} cardff104,104,133,204,104,133,203,104,133,206,104,133,205,169,31,133,209,169,3,133,210,160,0,162,8,177``203,133,207,:~}169,0,24,10,70,207,105,0,202,208,248,133,208,162,8,177,205,133,207,169,0,24,10ee70,207,105,0,202,208,248,145,203,165,208,:}145,205,165,209,201,0,240,54,198,209,165,210,201,0,240ff35,169,1,133,207,198,210,165,203,24,101,207,133,203,165,204,105,0:},133,204,165,205,56,229,207,133UU205,165,206,233,0,133,206,24,144,165,169,37,133,207,169,3,133,210,24,144,216,96 D:}:PUZZLER165,205,56,229,207,133UU205,165,206,233,0,133,206,24,144,165,169,37,133,207,169,3,133,210,24,144,216,96 D8 ODDDDDDDGD})DDDDDDDGD;UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU>}UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU>}UUUUUUUUUUUUUUVUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUjUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUVUUUUUUUUUUUUUUUUUUUUUUUUUUUU>}UUUUUUUUVUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUZUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUZUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU>}UUUkUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUV>}UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUZUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUXFUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUYU>}UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUXJUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUYUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUXFUUUUUU>}UUUUUUUUUUUUUUUUUUUUUUUUUUZUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUVDFUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUVUUUUUUUUUUU>}UUUUUUUUUUUUUUUUUUUUUVDDDFUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUDDDjUUUUUUUUUUUUUUUU>}UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUV UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUVUUUUUUUUUUUUUUUUUUUUU>}UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU (UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUjUUUUUUUUUUUUUUUUUUUUUUUUUU>}UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUb UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUjUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU>}UUX*UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUXUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUhUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU`>}UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU` UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU` UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUh*>}UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUZUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUV(UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU>}UUUUUUUUUUUUUUUUUUUUUUUUUUUUjUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU`+UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU*UUUUUUUU>}UUUUUUUUUUUUUUUUUUUUUUV +UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUV(*UUUUUUUUUUUUUUUUUUUUUUUUUUUUV ( UUUUUUUUUUUU>}UUUZUUUUUUUUUUUV* UUUUUUUUUUUUUUVUUUUUUUUUUUV"UUUUUUUUUUUUUUjUUUUUUUUUUV 芮UUUUUUUUUUUUUV>}UUUUUUUUUUZ(*UUUUUUUUUUUUUjUUUUUUUUUZ ꨊUUUUUUUUUUUUZUUUUUUUUU[ +UUUUUUUUUUUUU>}UUUUUUUZ ꈮUUUUUUUUUUUZUUUUUUUU[ UUUUUUUUUUVUUUUUUUZ*UUUUUUUUUUVUUUUU>}UU[+UUUUUUUUUUVUUUUUUZ.UUUUUUUUUUVUUUUUU[+UUUUUUUUUUVοUUUUUUZ>}UUUUUUUUUUV̫UUUUU[UUUUUUUUUUVʿUUUUUZUUUUUUUUUUV̫UUUUk>}UUUUUUUUUVUUUUnUUUUUUUUUVί̯UUUkUUUUUUUUUV3*UUUnU>}UUUUUUUUVοίUUkUUUUUUUUUV̫23+UUUUUUUUUUUVʿʿUUUUUUU>}UUV̫23UUUUUUUUUVUUUUUUUUVΪ3: 32UUUUUUUV>}Ψ̨ 껻UUUUUUUV3:+3*UUUUUUUVά̨ ήUUUUUUV3>}*㳪*2UUUUUV*쌨ά껻kUUUUU32ꪳ*32nUUUUUꮯ>}άkUUUUU232ꊳ*332jUUUUŲΨάΫ[UUUUU323:*33*2>}UUUUŲά΢λUUUUU33233*33*2UUUUŲάίλ>}UUUUU333:*33*2UUUUŲ̌ΪUUUUU333:33* >}UUUUÛάΨUUUUU332**+ *UUUUÙΪ( >}UUUUU3j22+ UUUUÙV(UUUUU3V22 (ꪪUUUUU>}̀V( *UUUUU3V22# UUUUÙΨ, UUUUU>}3*22UUUUÙ l*UUUUU322c ꪪUUUUÙ>}l ʊUUUUU322c 3UUUÙlZ(뺻UUUU322c>}V*33:UUÙlU`"λUUU322U`3(333UU(*̀άU`>}+뻻UU 32:U`3:333.ÙΨ̌`ʫ뻻U3:3*)`393>}33*̬̀Ϊj,˺3 333*39V333:̀ʎΨUl˻>}媪3333+339Uc333:媪̀ʌʌʎUlʻ媪333333339Uc3332>}媪̪ʌUlκ媪333332239Uc33;2媪ʌʀ Ulλ>}33333239Uc33;2媪ʌʎ ̮Ulλ媪33323*3*c33:ʿ媪>}ʌʎΪlj̫媪3322 23*c339Vʺ媪*ʌʊʀ̪U̫媪3>} 333339U̿媪Πʬ̪U̿媪3*( 33233)U̿媪 Π>}ʪΪU̿媪3* 33233)UZ̿媪*Ψʨʪ̩UU̿媪 3:3 3>}:33UU̿傪ʪ ˪̪UU̿倪*33 3.32U̿ ʪ Ϊ>}Ψ*U̿3 3:U̿* U̿  338*>}U̿* +U̿ *ꪪ338*U̿***̿>} . 33 *̿*+̠̿ *32̿>} Π̿傪*32̿努ʠ̿媪>} 3:̿媪**̿媪̿媪>}̿媪*̿媪*̿媪>}̿媪* ̿媪 ꪪ̿努>}̿倪*̿*̿ꪪ>}̿ ̿ ꀪꪪ̿* >}*̿* ̿ +̿ *̿>}* +̿̿*̿>} *̿* ̿*̿ >}̿* ̿*+̿ >}̿ꪀ* *ꪪ>}  *>}ꪪ*  ꪪ >}  ꪪ <;"@%D:MENUD:DEADLYH6-&@H(}!! @)!@B 02}!"@!% D:DEADLY1.ADV<}$&