9pT F8FKJwFx } F- 9F?nFF =2_F heF {@O`  @`! O%`')+-/1 3@5`79;=?A C@E`GIKMOQ S@U`WY]_a c@e`gikmoq s@u`wy{} @` @ ` @ ` @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` @`!Aa   !Aa!!#A%a')+-/1!3A5a79;=?A!CAEaGIKMOQ!SAUaWY[]_a!cAeagikmoq!sAuawy{}!Aa!Aa!Aa!Aa!Aaǁɡ!Aaׁ١!Aa!Aa " B b  !"!B!b!!!!!"!""#B"%b"'")"+"-"/#1"#3B#5b#7#9#;#=#?$A"$CB$Eb$G$I$K$M$O%Q"%SB%Ub%W%Y%[%]%_&a"&cB&eb&g&i&km&o'q"'sB'ub'w'y'{'}'(B(b((((()")B)b)O`  @`! O%`')+-/1 3@5`79;=?A C@E`GIKMOQ S@U`WY]_a c@e`gikmoq s@u`wy{} @` @ ` @ ` @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` @`!Aa   !Aa!!#A%a')+-/1!3A5a79;=?A!CAEaGIKMOQ!SAUaWY[]_a!cAeagikmoq!sAuawy{}!Aa!Aa!Aa!Aa!Aaǁɡ!Aaׁ١!Aa!Aa " B b  !"!B!b!!!!!"!""#B"%b"'")"+"-"/#1"#3B#5b#7#9#;#=#?$A"$CB$Eb$G$I$K$M$O%Q"%SB%Ub%W%Y%[%]%_&a"&cB&eb&g&i&km&o'q"'sB'ub'w'y'{'}'(B(b((((()")B)b)DEMO `SUPERB h`[. `.. MINDBOMBPRG MMINES22 DAT  MINES33 DAT MST IMG K#`M6Hz?<&NN\OAlEJhf<"hA "g$ѐrt&Fg`g gѐfA$CE""""""&JAC(IL HN""""سoBBBBoNAC8|@?$I<<wBExBGK>MNeN4NDf8oއfNdN$N61(Df8n8NuއfNe0އfNdpr އfNpQHNuprއfN0QNuއfNdprއfNpQNuprއfN0QNu. <߇Nu\K> sA* ) !V0OOwPOf Ё52@ss))( 5c1: (W :0!P0n00 03[6a}@ 523G0@D5$022 +rJ~2 4RPA4)]!> e".RW((A.A*S"ӅQW(r*@CVHʾR)W((B]ADCr\AB@vR e*VRW(Cb2d(fLW( 08*x \! 5 \J@ 宊 sU2 tW(DHP \P 0yH*噘b (c  wC8W((qS*k+MCRDW((<hWrW]9H*lA "(@vW-(U|(r۔U r )_<+.OA$( A(,B~D WBrCW(NR4BrR ARBr&- !UʱBQ*RB q A((A.W!ejVY0Eh®P@U!e(J\hYaQJMc) +(@^RAW( ?OXhH"|8!W(CW95!e*TvEh)(R4& |Q 0 OL>%,~p~eC~620 !7+?7? +2!~C~0p~6>,eL>^P%=`un.'.+N0@ 0[v/16xVZfq[{&\pF^YZ(:9WAe2 bJ_srq<)V+m|7\> 1 aA *BD>C`) `…@E @bE¼T0tt ā |!VP Bo0]`` 0!0 !x!?a@?0C  f(e ' W22āAPB pas)\2<?¡"i (fz z@a«0H0]!( C*^bD L_l$!( tA CaP P  H!// #@_?aB  pa1 CaA`B0 *#??l`PΈ  HPM ]0U80]!00 !۟aC E5 ($a$(%A& CQ$e TeTX0a ! VW 9  aPA2) „Sv@b@azX0& ! $9' y PyB?0a  s*3 ON !#A!iaC(F6^ $b (&\CBaP+G(ā ;a 0 ! H9 O OP0aV A3aS$ „5]@;;b@]`‚T0HEELh HlPNA9 0!0 !  _@?paC:A ;¡0w} (PtF ($ct("BCv wC! w }} aPB) s*3?sC >;eA PCP LD HPK w0Y00R!0 80 !!Oa@`??0aB C`A?1Bpa *?DA`…4 `b@‚ 0T 9ŀ@ā a!0~t 9u ++ aPBp Vs*06 7¡0\ (Pl ($cl(!Cn )C'aP",P  HPJ O0Z7X0Gp!x0 !!o0a@?paBC$88P1 $aA *BDO_?`I…@ybyT0 ā k@ak0( ! 9) w PwBa s(1WU¡!0U`U (<n (Rd!j$D (Ca2#+Px PHxPK | XW0^ x0!0h ! !sa@/?0aB<1 C@?0ЈT?@ā @@A0aPBR)s2A"C|`¡}0(~ (T $g ("CGhaP&Pʄ HPL a0V`!UG 0 ! a@/?aB(001 C0aA(*BF o `…" 88`b@ `‚T0O?@ @@(a` 9.~99. ~99lҀ99NqD99ၺ5x98<`X`8`!``8`!8``8`!x``8` ```!` 8``!x`8`X`!x``8`!```!8` !```!``X`!X```!` ```!l DxgaY01Y8 E - `"'' '''@'P'H' '0'('`'ph$3Pv<\lb(!!&,!868'/%1#P01f1Z*dEF0@5xj\ \#TPّ2@$%aT B%"'@!@$# &  %`"``'`!$#&P PP%P"'0!0$#p&p %"'!H$HH#H~&>?x0c f8|@?3?sRtylqxFl <Y&IApBr!hHxA@dI@t@lH|A  WVDWDVďWVW(1 (p@hhHhxAdIt@lH|A&̉x`xp@hHxAdIt@lH|A$ـــ'%1F+`OgErl)laAlȳll ll&!x'zW Ɂ@Ł!mʠÀOAB@ |"8 |#8* a%IЀ`@tP< H r<|<bx MU#nhb+%ȊِoAI*+),JP*GWBl*hH!)SGC$jIAĐ5UbX,,qk}%`uEt-é PRIAT[`F!BUDE%NŘ!UDeiEEUJP ^UU$T^\WvBERI^@vVJ A%1W$^D+8/,"2B*{ fPC."," J@^Z (@QTqZA⦢Jr**tttʫpPH.1*pC]0Ϊ$ W PYASi%yYy ,5+ʥhd+BXRW^VY@@E^^F^XX@YTDR@K !PE!V aB  A *!lT5_VWz U%v#K !( f LP)"  K Ll0AZ6 VXBTI^LXdP daUUD EEF  2D?Y((J+P("dXFPTEPFUX4ENRL0aN$UUA D@V&H*ʈ $`l'W%AZEQqQSW!((mtx+C+Mm"#A%\*"q9+lMA !ʣᐩCʨ+*+ ˨<ɠpC# T( AUBρdUx!0A h!UU WWz6QU&UaP@U;"*tTGtT`vΔ0#\)"/*V'5XW@(8DB9\uLFi @RkTEl $FXNT@PIU^TVT\NI^VY!FP^AX%f!R@ L@[RZXU&x <+I/3*X,v \9 ?`p ΁ ; fs3U@L86  P^( @@  `8X 12+ i"aq~J|"d48(I@@P(8d4|"Ja~q qpX- @@>@%@4@*@; @ 204 79-6!(8L 3@ `pH(DTXRq>lƒV*hgSU/(o?HU H> 8\ UB@ F 1d\ \ 1h1`\ L Љ؃, l ԃ ]@@@ BB@,n,}YJ@@Bd%\@`@d 7d0 d ,d \偔x `_($* Aq`U%AC5##2615`3d7L0l42|615`1r @4# j&!H|BWWWWW @ L5Ѕh@G`}q4uU%5P"e€\@?Vo#Nfo?Rj j &{j`$*+€#FD5qD5p Fp[~pX5iX5p@%X~ `$ 8yB1 B U` @ jjHjHjjj@j@j J!R腑FyD}pT"LhttJttt ̘r @@o l@c k hD @ .G ftB`tt t tr0XvwH$`,Lpg6g 10P8A 8pgA~;Fdp;G(> F5W9a:eI% rMNS { ?\@@$=Qt`O@Ĉ Ô IB/q`  D @RX "@ rx T f(n%ب1wK ,KC @R *Yމ m锦 pPR 8 - .M(sA4Wr]ȃ`r$Ҕ6AX'|oPv4$ZjȐ&# af@`7J w(<2v A+{D)EYI_Ub渲DM;j[-1ΐ& 8B@ $@"Cqzc`g@G_RD` BBHYVnMApg#aɓqTsBL  ! ]XbP* @,І4(^-p,X ( 40T4AB $ 4@70P#3BC4Ő F6Q(@ bdDJA;ޚ5hd,dChF'zR< FgJ+z  #C6& 6 EЎH+n`2l3@ 8@EqSZ`+b#6)"D @@@8`g諌 e#rF $?s& B 4 5\:oB&iP*#xHC01 y*´cq~B8QQC'ǖCw;`0_05gh`p0n0/n00Pt h?<4pÜQaP* 8@ AA\5b c @x?4#@? 00SD  0/ (z/!* !_/Jπ @!80*EFpiYhZtZQ| 0X A4&Bc#U1#e#Cp!Â1q QNab b~0XHP!G U\<ahQB_q@\30 _?AC:`a 7pCE\DX`@`Y`?8B`C ?+ BB8?(Z0`C> ` #\AZ C g@& H ,1@:@pxAEҹN¡J"(PkQu@_DUj Ya?x0FA>c)sF2HAc t3#b"I .` H}t/AQBT]P.AD`4-A:0EE*XEqJ.@⋠׀d! !(`8?"p#Ngu `0B*B"ؼ5Yx X<'#`1@ <DX}  #  ('^Q?x+` | SP|PB8 7 q p<2P@0 cpԐ1@!F@ gX?FQz,p,8?QM```´9ˣҀ`(,к(4QAG f2ႩBɇ7RdTI4AQ*' Uj<0cC? A|?/. Cx`084&  "&)A8#(>({:aElP!x(ش,xE ?B=T?A ,0p_E`?,P eH8P`A0д E!!38°C |hZYIBƅ-1x j>EGD"kjO@uPp¿2A ثB ߆>`%p9`0A7hPWb 'PPxo <@@`dh0  ?PbJ |QQtڒ\|QPZPjEIG@mdQt 4!CGD0 -Є|Q pFx!ej%PH~ !A `1!9  qƁE@ bS4*BB54TD d!(]"1UCHE(gh@Eo6 - 00@_ HTTpa Ct2j"U!Q DBƂefp ( AT a@54Mդ֩фHT:pUta"Ѕ!* Q7UQJ6H+ hBCe`]`q ܐ.s*@4BPm A~ A`(X+P *! @M!UU8A8UPj@A*Up@ah3 B=APp8/(:1' ?B~ 砤n !X xp#ׇb-C31K`b~(C5$ (4(,aTb^6,; @ n!)WAp (*9f;:͡u@@T炰T'{xp179F ,ŕ@#* ` (|PQ @n !@T0r  ',g<, WF + D`@<*8 ?;`~(pT`A\ s; "7y !tP 'UT e P*E^00 l.IZ`ظ%8@@CmKA#I?xʀ@pawB*J 4)"c0`P@8@E!Ђ %cJ8`G jHP4P*\FX j@o78 h[P F= WAà  P(X~ ; @ (!B?(gx1b%P K`q? @> @MT!I@h(@h>Z,ODPH4Wx@`E@S h%X @xW8#A8@ 5; P HA?"50A!M}=`#x  L (@^+*P6, *T"_bc"Pt0X6*  +@^! A`P **UPW pD025 9 TpA9@ 3 71B9AD0``@ P0O* EUʠZ_P0ªju# @  ^<x_@  H`P4@ m1!#:@ hM+ Cp$ C@ (#9bh"wX(0a€"c @A@IB3 $P?B`?z0<@A>B`?zp(:pP\\v8P(tjAAb8xAc x0# †t t Q@ !Ep1Ac<:N !C9b"00N"= $,`F SC HQ_4L@ 0MB?@T @#χ!@P4q ѥBPP4B`S=4QcPF=qZ @0TX@88 0PtBp) ΤB Y%Th>TT @A**B T__(ԁXH >@ @? |P%  0?ǢpPxOp! B`q3uF`[X@K螁$1@ц0P:5c 0D FЄh   hEuo L/@T8 ? [СC!WEGJ> 3@B ?U^!~]T+!?a=C^PO8x @PhB@B%B*6 @o!>@|  񂂡q! ?@6(>? !1? J3 ?:(z(`CP= $!_@4<`CҎ>s 0P`EB8G  !^A6`B`BB>FBlmr| PQ0P&G }P?@`\px@V !?*(g?PHJu "}Dz`` Dр(>P:P! @F:Thm@UCT 6EPu@ChTD8 F@!Cah B@P(("0"bP aT0(C(E (PsxEGA.FlA`\WA@C "?Co@@`\ 41B n@}50C !AA!PXP|@@()!C@ZC" @??@J |A>l^r 13>!C&Ԉ@-Ph(@'#^E(jX(jEp @XxX4B`R#B@Q`"x0%W,p(J?| PP!Q  3U!"_h!(!!c!"ЌFCe0j a .D !CBu4b40@쀰AL(G 0@" B?gtȜp \#WEP 0 R@"8v*A :@T9_x,$ :@ӄ0?<#? 800u++,V=S`*X \ UUT@Hc^ R_֖(8hP63Fgv? Ӄ PVp?} 4 8'pP  O B UUJWY U@Bx @"X p6P6/ AD)c.)T(jI0 ƤBD`4C+4".(…P<F(8(8$8,00)0`ŁLPP0FA B F   J&``P` 0`w ` . ` pp `` =!)A   F 58 ! Z * 0Qe'@1LSD!( <hZ<\?Bv6o2i ` pH%ch9"Gh3/av(D 8dLy|h0*L,+\xعCx7}tƢDk:&0@p>Pg (>pq `%a5H# ` ܽp+!u6x p%(#8"D$$n(зjJ q-%d*8$5q}q{XBpO0(roOo*HOF(?3h?0y`.,|do튔5NBnu?U3-E3Z`k@+P4/jֈL0&k NnґuJHz] Y&2Ok@~$€|nY!DIBA} <?wA? NQ? TaC 4bZW  = P K r= ? ])BF\D9uq2"O`]@+2GΒIl!rvdgRI@U9DUP~$1x]" Q-@3 ?8@H>6E !?Q)}M`?xZ f:~D\>>C<FL}( ;$etW,w"?{  >@ pp| d (m~8x~x\`D1 q0&!|a!a~1:qp";Dp <@#_-"1@}^X<) /P?  p!x<80|xI .A*> I?F?>_#e>4Gx ?z"{wzQ8?k0kc;^Px333(cI("0gDE Xx0 ?{C@<!̂T@k|@@`wR{aLbc~+0|m8,@m+?=.'^`_p~ 1ug >@ _1` J0 ,1  @Y(=h }42?yFy9~LlqbZ26^"PP/~(4?ԙ-^+]K+l9, xxpY>@;=4`_@׻v."@D]DdŒ#dA>(@^Ȥpq @(0 / h[@_R5hwH-PTPBt Q~xP!a^G0OvX<^2' G  P7 ]ɻ$9Ẃw]? $䗵v69vNj] Dqs R HΚ H`(?-?,fh%dr݌ZfKhK&F,.沙KƱ%?@do ` h -V_ HJEo O^O4J "B@ZE|>M>$Y>#Zd5d]vo8U޲5i6&?aT-?5鼱}e~}I}2D;@:?,~W(7@*@?B-#+Y` 棚Pp $C<(K f@@-?`/@ ~ak `epfZ_ 6^h 0`v~ @9 'yx]A?'r`s`OpE f50 |!py8A"袶x9e+[ ./wP滻|wĸx oi Y^N#)u@@? ?>.;'/9|E: AhuH|lx0N?,n: `>vx`D<$fevXn2c5xlaތ-f 1YT,@lOFg*e[; gf5pn+'愃@e?^Nv>X6\5 H_#Bd͊5JYj֖J pXYG@ rw;g (DHc3xbuIfIpn/F宿dMCRfI,j4R6.XΚs\0ZԪ9k ,Y375\0ԀZ`/CN31>,xFuV̉޹$x63>XYp ʲ< k, Rj1G rgk--Ð2Ql_`8L1Ym 5576Mj,$X7調備%Ŭэf1'3T [(d?Q2̢h9WSAhlY6W9 #YQǀx@t9-Α1p x8X;6Ф7F76ݠ?̞se<cM f)9 h-LxUFsW fd]rSj\ k?(]2&,WДm`,%0ƪle6 ^krm OmOjS5͖4#k7nϺ(Ԧ6+֩ެ97&5IyMURfƂMsHȐ59`tlw^AƽL̒x5x+̊VX/֘-7, 5ڃ`,c;̰f4ݠJj0ޠNtuqqu9B *5׾4YdX*8 g0o,Pql,֘ Mle]` VDqlk.XL0ۋ{+8g)|.Y%aM ?gUL5Y iW.[jM W|_uF"x U8.dY`]PwW0,f=<0YE쵁6qFE5tM5X{oj.g'4 h-xMԨ`)V]!R0 T;[{7k*5= 5Im} F\*M h ̲ 5>sT91͎lS(!x?:~',4Xd2#~(ngM YDf}Ba(*q%/=rKK/\,;V-I\pl}Ձϴ1T% 1{*`3 lg:A>kV975ˁKYV+`?h}-,`֜ Bf\/Xa4 k֭ B*6 (~\1,{ ܉\S,l\o̚s,0u5R,l5:v ֕EaifZ k! A]Ͳ ’y]z[XXOss|Rw:<;x:8[5j*l\#&7O^iq:ۖk;,oѴ2n7 7zg-j5ek93  fξ,o}7mXQüa ø .c0XVoYV~2 B4k/s@*8W."Ğ{/WAݷ>fs2FK,3m6{r̰֜o]$4*e\ 5*Mi5(WM5 ֦0 sT]. *`wLݳb"XN׍l)H[?G ^x,'l zM"jsVrT0mVI%ͲHϚMߚvn65ەfh̗*pKx Yd<3c2/l5+f lp1%ZQdqbO&X 0c&XV@& XvKpuS"X{:U8! ,U2t¬?YhSI6(eo"h8‚R YMf)ByfUs/o,ʲ"jm~XYs};Z<;s mYsΪ)4`1^.nXk ek{0֬2pUsɚwmXP\%.w6kM&VJ&͹̞!\ٜ9yGUsɨfTZ < 58(% ܐR?L l+@=^"XO*G`e X C(N̈́C7`c)e ,1 A'3BBж=d/s@H6F^00K#s;h/ۂO|ZܮLP'q  N ' Vփ.nqMh&ԠPh oXj3j;sEs V,KPjp$ 2J rؠZPդqrg6 ; k;K~ucfz^Ig=fUӑ-[Ef^MVBhQBX1pf X)D,AUywlM"mCjM6mdS@ZCBI jVeYæʷS%sXDΘ(lRֲ.72&ۢP٠kÊ9 ۧpC pskR{|xRnKdt,Bz7X?]_qXفdE(l{A8=`g b4vcv=.` _vrkM%YJ"]>z*BAl{}"$&"S>|Q,,["pSW}>YA?/Ħ>r>s>}jPX]"X'mP3c6Т kD3k{U=l'UrX{1?A$$[?mk$W 6qB+,V"ce̵5$vABm#Xn<~N*,<|Ӷxvj3/*Mkw V`%i4athl{(3F4s X?,9Bw\c[k7y AdJKQ 4m?m94[~Σ֭|\`VYiwz/L^ 83|ƁϨ]+8eg=* V6U%or oܺp#K+UL.+*)6 Yunjb_k@a{3P AGC^ ɂ2,1YVan MVW"]5'&J#4&6g)O 6O|tX 1YsNn V1^* T~6 ޅ ʋ> 4T;$8(BJFb5;,%|0S <#MH۽aNV _j T7Z`B Ug_:fJz aa+]C Tꗻ*$?B, '(KA Df~`_nj$[)(Fn #RK{);;$~7n47>iu XxTc+P8+oذTp8+6)SL @%t3\ 4 ?z<n-R}`Pp, lމe$K s~,_У/,7>5o*<$xQpOe|cH(3:3cH.X| &ϒ`µ Ӏ`*a.5=/`XYi;3 Z YS*7`?<S1=\|(ڑdL ܂U5.j'K f%xN@aIb:PJFaEpDBf ?4coz`/dٴ:,8x@`0H.e6e)P2 >瀻^;2.ɤ^\F!M>̈sT#)( )YV?qVg` fY1pnف?@@ݻi 44pJ@X/򵀐_ q~c$&9`n@ ?Xu27?VQId۲2Unepou(+ E ]Qvq "X`.A$X`5 Ivz3.#a,Hl3. >0c-gK3@f`ׂqMi03ւ|qvЙh+e&X y *<$PpԠ>}dՖ@<F@~e aZJ#1h,1f4˸ !;͍Y˸AӐ`X u@ڶ OIhh7;@&00Xp{>{2C+ATrZѶ1 ](CA ( 8jT8)PB9ר|fT&@B/$?Ǩ:H\@$7t _e uSw]M u%C0o%kSi`1߀SMHz,{#I9CֱPdc5rz@v] 3Pd-6-7ȟ6[p0T$0%4']JCkJ o6UJ{< dC8 F 5A:P<( x*x^!N=MlMB $) ,&x VVǩ-3LM7sNU>AA8MC + ݸ! PwB P<g `` ^Y0 0"μ=bgѰw+o˧S((⩕+&vm̂]x0.!ν'< ؀3aX`^;uap3bʦoc#]#1EG>ɭ1 X@ PW,X!{` h y1%X P:\z^J;R-]mU@k8,P ܘw;``#/ͳf, @U 0W|>@hT`Tfd@ƀ: c`ep  ԐXF0,G@aVeeܸX@@R9H@s@$8y9 vn0&\Xy HF h3x}F Vȓ`Yp;bƼ?w}DFvxan 8fmx'>#gL`>#g `y`V @@UƒOX@g3=;` H+ bh_*!,@eJi)MRJ/zUDţ?Ċp\ ._  ՐQ 0  Ȱ`B~  YP堒xgVj _@$U T*;#7 y b\&d@X?`}Xnx``B @f S @A  z@SЉx?`ڊ?<?<?<NN\?<NNT<gC=9C2/ ?< NA\aDA\ <PC"QaJNq zNY % AUTOMATION PACKER V2.2f,_ <uZNqNqNqA N(H*БJ`jS f dZBAf dBG8vBA30HxlFDSBf QQJCgAV30HB`  3@Q&LPoG:tf dQBARB3 gHSCf QQ3 HC`   Ag@G2vf dQRCBB30Hf RQKs0`0  BBvBDf dvx@f RQDE HSA"Q`NuLSD!dچ`l|"@w@`LI0H @ x X8xf]#FHz4C T\a֠%NNT(?ANAXg1_kC!'!&"9pHQr 2*hAC#2<^"Q3Nu3<Tf(\AջӀLxcJH(N*Nf<` #A,d!Jg#"JD"z4$"iLExCxK (yqN~&Lz-z |:U859EQQ(KIQR9(qNQHM2/ ,fNn V?f A!?p? QNOO Jka.NsLO?/8Nu?8@"h$I|LlSEd-Dj\ !fTZ K"Sf YJ`jSEVc@6vM"xlFDSB^ JCgAV} 30HB`  1ł@QG PoxS:t!x5BARBgjSSCQ]3 HC`   Ag@G2v$ <RC(30 Ks0`0 BBvBD7dvx@ f RQDE HSA"Q`1߂@N AP@0PpDpuwW'wEf ?P==THE xWPLICAPRESENTS+s IMPOSSAMOLE+++8^0 Cـ%'N0PACKED BR.AL[PRESS :'T' FO{TRAIRp[ UNLMT LIVE, GNEY & AMMO?Lw---0m]= *<`===PLI&RPdS$T IMPOSSAMOLE CPT6BN' PACKב<< R.AL >>~2$REEWNGSO:]VB &|DRZAMCA!WDYfGE`R mTCB[UT R DG\S\OLL!NSULT`OFUCKHITv 'COSWpHAV+NODE5 ABToBYE FROM YOUR MASTERS IN CRIME?..<` "f!tO?nzv[!ƳYȬ`ro2cgUCۡ^ z0 ș! vP'|rN-C';Z*n0y(J, {gh`{`k|dDp V9u0.2Bf!Yȵli0Ahn%vS@ p򋐖RB9) 9 ĿftNCp|h52NUDgJ#LYҾ,bd2 ֙ ^+f#eBf!@Yȏ~e"2 6`cHJq4j% qt%4>BHBG*0j24`681p9LNPd4 BABKH,~|B1AO1BMyJ摥NuHJ%gA#hMc& 06а 2 ;Ұ Ak\Dv`3D@rg@ Alqd#H!I`1( (D`*C3@ C% -}dDs h(BP*qLD`JBBFNu"w$B$HȟEhWAQg6@g@7Ah4%tJc,2\(G,AAr @F??0chi Bk2l tZݷ1yh60<2D@<--1F4*J-g!DBBt @FAmnWt ><y"OLNuH޿KRf0BlLaBPBB }- /tD P- 02)"2H A A@ihGjD@(P G 1G| LNucYKML!;xBqNjH@J=Lfd1¯g (kJoVD<m R`SS4p8(JC0@01@1YLYʈ9 8!#`!Zs춻KBp/!aN K*HR@H'4ApJog 3r%<h0AlQ1##lъnT/kxFyQqS" xFxFQ*@sutBLw 9Q$}f  rL" tE{@d < " 䄿yrA?R# CǶ2NONu CRACKED BY THE REPLICANTS K&Cr{p(#Y /CpO{a"h| =r2(AD~AJAjBA` |o2<C^Ҁd0A Dy/A P0@0 _"? ,\!G_G} 1#ƀuKRWȬT,VdXyr;H>x!kܮUF{s]#<9G_3Q'L@kW*5/ ̃C?]e]Jq0HH@7B_"_`0123456789ABCDEF(p9HvS@ A?02(Pl02BNvNu7VEkd"U-T(A rU)i@. 1@0A-1A_ : j!RV`21|ENBARBbcQVfNuAr#!0,2(6` 9sk!WSS2h=&cn村m -Wm`e6PlF'Nr떅΋`mM f*0I~u*llZ+lR`B h7l(wd0(@z&So. tѣ"pHۤ~}rMՐmmM٦1n ASfNuJR0o PnQ,D87ۧ.2s-/ sk7UVtSm'<M hxG@fanư>ul̢atlT= HCq؉J@,NlL Nuull!||dLjxO6RJQ4գH< ![ N,@]TGvP}K-` C2l!ɂa<8 {0@a]Ub4@[hE$zBhBܧT^ NulB[dCd $"}J[`< D!NBz|B Y`8 _~Т:2JgEJ`.;nU1o&#ˮfren}`27B;NAxM`j h<`fQT>uBl!x0l  p3bѰCFT2(8A21|gPRRJAj,l@U.@fԕ-`l|;VADheZNu @" rڡE-r5jJ'gJ\vn*boL"FpS˜fenv>x5`Dj hx*` feTPSB>0f,e* p§PXfl'a<)~l#nf>bA#fݱETX0`2Ab 3c{ `GE!U\By Nu|"o@CzV\::0(9GnmO]hIx )UtCg.MqKXBodT0(@Pvj!GfT'+nZ@q oA. "ZmOF]H6ۧ4.6s"S$ ZB(dUhܠ"ldt@[@ g` hfVVZ7ۧ.HsS6$ar<pB(dTNuF(ft~k6KHfA wr U1Z!{g0SJPffZ-oBlhO]6ۧ.sWU9 hh7fen}|2>ju3aXlvTh!(4` 0<5|fZSdFGrt( A@1Ax>0C "eJClBiNurJ(ep?w@䚠ڠNJ mI}x@$R@n'jd\ES`Lm B\4 (AlJhx?@-" B4*g4 Xl(JTfAr!@"q ONNu,Մnl<N@D'E%Ծp{ !pNb6 *;v` ( |App/J g  CV3O@"q4N AlQNu_ڮHXݜ \"AfJ#ek! B^!K^MOn P bn FJ(ekz4v@絃"De4af~mn`NV@Bh ]ArP#o hl|0fnT &P><WC0p9vS@"q_2( y 'A*IQ iC JQj*gD"NuJGf< ̠R`+o1|Hq peG p Bh{AlQL/ @ 1@"_02)/d6<(2 ޙvhcAn JvS@ po*RB9sDNu ྰ ԰|07?63A؋24;JME][j]v ga  !h %B0#,(6mDFNLOiqgpj6rtxlv wž AmYr`s@{GCwD‹_RgackϠζ HT)OmpP QVRsؐA, 'B"ؠ#G%(845b{6UuDZ^sQb`p짌 CvbwQ L-t`m-H hzoЗs-6tl uѷ +B) =FP 9cjdMCHeSpWQbl^t{>! ?@b[lCGr/(.ՠh/@/?8b@3B3h D@O @DAA 3; #!_@;DNuJW'Ya L*g( )*ܔE+T0R@Jr< ŠBB`0(h 2AAk |n@S#VB96'TCBAXN@Y) Dg/ArX _NuB~B$& ,3@JU$ 0({6QOjDoĀED@n}^2>Lul:̂m(p\!`f i<\fQP>u>l,mO],# aml3 8 U$Eh0()@iXCrc J)ft'*DNuwk&02BBBCaBG> |{d`?KJe%< 8@f&WB[B$"h0( q J2f` 'g>wC @// ?JZ"W0]P[*"_02)Hn!ԳYȴ,dC˫AMn JvS@ pN`RB9G _NuYJJpDPCi "0BpB61i m"#<V_ E>QrvBB$$iE)r=F* l3|M''gZ<"N|@}C px vS@C` 9x-{"0( qf, wBhCNulH݇49 >la~`HKIGYK}ȃeS!Þh]F`l`> wDJ.(!'5)Ŀf :gnRt\ (< N@BZC AXr@i~ jP"22@`d+dC (f@. `yD"NuCNp'vklTlLl AeB3dAE*`0) S@@#rBVC0/l@ Rb_%mjl1 @|Vd 4:Z'>Q 0ꨰ)xk V}p9HXGlJi

eh dFggp^JefV0<2/46b8)NJvP   l8j"MjƮ#BiAB)3IZdCGDNu = |RADx8Zba2nh1|W`JBrC0i6p2RC&PT % p9BAlQ<+A8rJDn>gd 9x)P^j<"]Р5'r4<bB2RDg50`JvpFUnB` hm# (CtJ^Gp2h 2#g^JeâVaf}NBG B$eBfdZE5`6)SCC#r0Bb9/aN@ C}AlQ< "DNuB9(1 C)p gXR0ViPi3h+ V Ń 8 Pg&#e"B^C3|ClQD'NuA Jvk}L1"E@R9;(0|0hCP pJu0p)#h 3gg^J0eEVaFfNBB`YeB daP:`¾SAA#r!~BiCU|`/>A@ ClQ۪`EBr|b$H2o4 6*!UL|@"QΠACurp h /<)2#468)N AlQRG 9(gDNu@&J/* 06cA!GL$ X #+]c-B1% P!E"BGdBp  gBiD^CaQD>NuArdB(* ӥp9("Hk?llJ(f[dl0)0n>Q:F1<4Ne@C!`Uir(3@4#tԲ 3^Jhg9 "ppY D`9f df \leBfdZEm`0)S@@#r/NF /Yd@ R{E%m**X@ (1L !I"Bh|+dp YA`M:'`Qm0uTu5 .pCͥp9ӠlJi_dO\ ggRJ%ef8DJ0<24(@6(8A:DE) E_CNJvu yC@g ,4Z?OΘG P0 H2`F(Pn$Pm)4ZBB p9'@a>Nuў`.PBE` _( d˦ B|l%Xw  MU+ H0rB AFCt("q;@FtB p <'LȻV`zAtJmgxAlQ A)u i1@1A;Jf r)D   T ۪DdP!2B`S1YB([OBRA`tJgAlQ 38Nui1@122, )$Jf.4Bȡ =   AT^P1$*Bp@!qlcS1$1R#BAN OjPRRBhTAbmcjJAKLԠedB(fg:h1j!8VC!I^ WU@ Rwf !>2Nu/^<No@ (EЧpt9vSB42 A1B| i1@i1AFrp)EA1 =  vQ(lcS!1$-1R@BNԠO&P5R;T4bMc JK!LeԠdBLf!gh!]0DE) GpRFN\Q)1B(ri< j![&q@mS(11: 1Z"(ho1TBЋR!<VQ%RAPtJ6gAlQ  Nu:i1@Fc1H  CE 2 A)A 1=TUQp5@!qxhSB1 $f1R&BN5OIP RBT2bMc JSK;LAe dB(f|gʟh!iVC!I^NuAxT m= v v . E h 9A0 XjPT 9 AH pjP* A 8j`PT j(PPxԠU @Ԡh5T*9^AE*AuPԠf5(Z).rVP|Ԡ )pP:`ԠU*,Rx+qS!a`QZZT6 U4@Nn*@hB*Ag s.My3<d'e ?9E}s͆:ehQr (I @s4 >jHN X @Gw ܣ P@B )l<Y NAsĥsd^P)/|.]POA%.3b"FxAx@BD @ ݦdnnZ-A=xZ  AizHT0-o57@nPhPB<wt>*8"4UhsSQKG.TCs2V<PRR\F5! 'Uf^Yl-f &F uBD`YR h5`WlXS~-XOFFghdBbGsr7; sP S*Z!P8 +SD<-N@F5@L0 <|XT  R `~PT ЀHX -ՀDGⵀ"Ex<[MV& MM̤ ^!75KK<\@?BdY4Z"]  IZ8%xBo T lZA 'v &C<'2CI64^{=hd(4dA|j!ln#[NEx[<\ {WxPp60x@gehuxPpAxTA4]bW%4$ J91(E J(e,Zd"W CP2+H `cOf|a%ġ~upB8g*:#0D pn}""VN`BW AlQAݟp/J7PAx h#>mjxrN^BB$JkEN ` )l!( Xw^ +xԣ J9'g|(C"r(OA"qۑeBhAK AlQp!AP ~jV,T/DjlP0.JhRr" Yr"I\1v }VAtov1utaz5,^C<өp1R7F :ClJifS.| pKjCBY'aZVXnvBǶ !"d_mtXo@uYt5͈ \glȬsfhՊk p(xaؼJ\N^ &VfT?K3E`V <@Cm09vS@"qj0(F@@01nN&<TDNuT5hAp1a<  S3a#2< k9) @0 a@gJfW !^T)@fh" ({ȡ !\ JUf5 R`SpjRIBEP~Te 9 HHC5A"GkS&* $kBYJ1 1qJ"<6D"e ^p9@ 1)!@DNu?1'ԲYQEP@:|LDNx[l<J*ZJgR0@Ў @U2 ` qS,@vDe Җ~m#Y lDQr~abU>Gb2Z)B"^pȓ@ 1!@Hg> .4$A2:BC?tB"q0/AgFtB p >N. _> 0@JQ6RY ) dxW z0DYrs A@* xv"LJp |lFX!Ex.ɰ rz0r AI=,@=Dev=BmX">) NxC%DIkTdRlJ* m &hmnL PD |W " B"b"0^pW@ 1!JS2RNKG15R, \<7t>9'OG0Ef>MC@011YF/.x"fDC6p|g J1pNfB-BOܣ$ 좇 i.mj0)@e@U r<@ B`ڪ 22hH"RRDTJ(@f.?p9{vS@015RC1pJxg ClQNuNBcR!I^_!mi}TX)3XDaQ  Oeԧ6"Y4j3e#B3Bg#|<V/ a _"Q^:HE1P P.UjJT7(*BANB8BhBiE?\2R02 !A YTAJrk:0(B3@ &ؖ,Hil TR`#"h^p_tO~Clr f%nB-B$<?@]Ԣ2hQd=*^ibTBi/IJ'gv=ZNu"h^/A _^fC:rN>QJB[B$ _ $f6dTDBiH B)J9>'g #YNNuAA< +c-RJ"w@pVGGG1|RS(Ng$F"Jx T `\$U)Z8; H l#g mU`ZN8|N5HC. f A!24`&4 B"d&Jh+? DV?/  |p~r@ȁ< hw@e6JNx&իr0 !cBCtC|NB"{d(` YAR. AMBh[@f.CAT0(RHJ1g?BA4<2x(@#N6@n

vA+8na,CCb+8[a蟚 T&puAe6DJ`N$ZUB@BA4SbJSNf |ENCxp(@!qsBhaNuu-RȐ.( 8 8 pg/o!mG[  Nn  EÈ) `0l 7x  2eZ g58J(h4 BA4PoJeOf e&F (hPgDBKy vUdN-7lURlJ>lJE=L`(J)J eV@OipPQ/A{2`4 #6H _<N" @R= E-Hf!B  3 W.d(TEad;ANB(OR!,eh:JyCl=RR*GGL] Mp1p@ 1@Nu<'Na@!B9&(!h-hUCm5ېJ0w/7 s#*~|3|N nN&CpBa?,[ 7mj18ԩ9ަ2,4<:aU"HpJx$22) rfXiClQNucxw@@@Ȋ !PPdOdzTA(dA,@6JDN|!N24(r6n8)VC D x!|n402J9G J"#'e Bi /Anr. _ES06@Py6f $R!V0eJ(f`@|BNN#GGCTdp(1qp01pkD/"^@!qV{h Q{gIBhNu'h&eLٲ lE h!eetaXJENa!NP 1   ltRK h@R6R:YC09RHJ1g-|G$B( l!@"@EXpR@#rDB"^ i m!(,"/ I274<da _)@RN k  N:1|UNTs'` &QRC@v@pq ؼ\ƥ@J(f"m` ]%u `0 #n`۲,h0yO->8SO-)NAl?nNEmX|pS@!) E uJuAfeF `!g\JUNd(B@2TBB6<"D)t G ْ"d~éNM!U /$`t^R^ *Bh'@f@^0(RHJ1gN,D]C1Q*!`W~NCk@0C84!P4 ^NuG TP9*x5D' (02BB6<ƗHoV1|Br>B h : ECZ0@i@1& q+*^ p!F(lJd2 d f$:rAAu4`=v<@`QNG?g? Dְ^|dC ,p(@1qg ^eZ DaNuAV[y +(s@J+xSޠ\G <% 6*<`xQrU eJ} C:A*lDzl  ľ`J\ S(`DP 0l2Pu46 P NpeWCB [T 5ehp)VJ(Nz>^jq@ g(aDS3Rf0(1 R"^!I^JN~k6ҰE-jhQZDgԴSv]Ei]5 x}!MexExz/A2 4#a _< @!Y!9+iJ#"Bi[B)`^B"^2h1@ѧ h m YN1Y(RGG0~a4!qps^Nu@!_B89$(!hV9 lJ##P'PF3|N Q&nNp&CpBHn1ަx24 <aՐW"HpJ|$2) rf'XiClQBH/AC"( _Nu>D5UAdaqa9k`mƜS@1d # JNf4NM4@NNGRG1G"B(lCr0).k3|4 pRдxg\ *^VA(e `\J `6`x 0@BB6@Cc0RHJ1ga,Cb#d1Q^ ni@(P,$YB@ˈ(@62@dfAA,TU$(XFe rJhZBbNgA6 S`N;RhݭDfNiHGdL-a@P nF2+ $4C(ҬΪ DNuE ae7J` Y!<G?_|Tl 5#2C$p4@1q@ (dWx"h1Q}$/NF@2+QB-լ.J(j37ت_2Y4<xWJfj͸`7JTe !6a8Nu de"ppXPg0  @ 6]je'iqqp@hm X  X @^ Z0A+d$JІV#v˦Jhp jV!4`emVJ"NNB@2BB6M {8F @$"̖ Ҷ dh|NBzg )j<Q`4>Z:ltZ0lx g&J( hAf A,l@Ӹa&N3Nuf/h"إʖ0g BuejJN6N!Ej4^1|BBeN f0Z$7pqgXG D@Z@k=%Q1Iz R^ hR:@?f j&0(RHJ1g24X  a.NuewRK E@BSR@noV0:RHJ1gZJhA HR|dpH@CV%1q1z@J(fCJp370`*g$A? 2lC!#6h,Bj2&4zb?7D/ HRr"R ^0) BBR h p@!q0 \-4" 0vܡ:d4"=vJh%?~4`}C%1QAt,pem2J( 02< BB6<~(fw |C;®NyNu1*c0C!rx۶viBB)J9`' #<Bh]FAdMUTC$3 >W2]4P/NadDN{R`ijklJA?O~ OtJdNg~lCzr0(@01 RR Sf1RJ@kP>PQ}k,@P-hxBDe}N[!4`#RB!N6hjR  9(g?XACCt0(3@01уR T$ f4BhR`< $0!A0"y䜥42;ao!Dp( 5qA@ rj`P!+9 0( B9C}#YnkZdaP\"aTE7@"ylOen h Y F!ɫ\RBf'U~tz"9N~g!DARW)f`38LUMBAJAKHEINZ...COMMDONFRANKOOOUCHJUGGLERS}xNL[Py"Er@Cxƅ<t #RA(Qa-D!c8Ԥ!'lBh1|_;RB `9yf(^ȴA0"yt? 4N` SWELDON=YOU! A HIGSCOi.ALhm999TERRk8*Rm@ 6BOB GO=44GGGYQ2000Υxii;S"YOURM]FAL SpN5KLeDIKMINhHOE!DTHE AMAZ!"IWGTNDBBERMUDA:RIALEC&GR I`MONTx  YOU HבUCCESSFU?Y DEKAHFIVwGUARDIF/ĄOB0ED b]5ECDLLOF NAL LIFE]THUS SAVG OUR PLANET FROMzCERTAIN DESTRUCTION.SB(]FAhS#ULD PLC C}OSpAoEN FOpTHGFE4MwI YEARS ! ...OW I ONDERHAMY . NEXT ADVENTURWILL BE ?] ErGSAkBdTK6k`SfNur4`x;x;x;ix YR> <aNub?AA3;@3Q~'vp0쩴0 U0prE*tB2$3Z&7HCTOups r]Ay>Ch[p rwQAQ?RBBZNu *x l0ȸl\T I T4HdIH 9TW$h`P`2RyN'pQ8Fa( h$:HLIQjRO'irAS18`A3hB,> x@2m tA3\Ugp aA":B Advp>~^pEv uB2$3Z&CHQoH0 ^@ t9'B@À @2(AAA4AAC>HHLNuu< h: PJ(iQ a.I,QQ h*bF^/ g".WCD020@4p"_Jf?DNuEprGRO!J4 gPOHB4 ?( D"@@ D[!ST@`Bt4j PԠ$5*A0 6jHH?j= & hFgwp17`l m!|"NuAo"yI>9' :G0r tvJgS,C$KЂ4u""je`.QXC QNZ1@}1A01B2?4I6AB1CDJC 1|\DGH`#O.*4L8Cn &Vk@y`q "IJÏ2JGjEDFCS@ڟHD01G@21Aq1C LNuH@LJ၂!4&2S@x00҄_f9$ #LNu"y_E @6 s5dLo37c @p[-Qz,<NpQ07*Q:ypv($B"BEW@lЫeRxAlt $"AQNu mEB੢C"QU*PuJSf$R2aVdOÃpGCz+fla3g %Jk$D dR.t6-K'E mGBJg"SSVq$98cB"BE@Nw` zp -`AAQ%Ctf*p1 @ "0tRF ;oa#CRfzR˜D`MAp00kqr QF"HA ppAx/[@a;0 AQ h g"ypvz4ݟrCTAB m50A6C DC08ȘwD?:D@2@2B4BAAA l*WW -o\"CNuE`ya0PE#?(Dp(SJBpQh<g[YV}RB HCHDHEHFHG4 v9xv|~54\06ZRFCE8:<>/`PYQQC?Qԑ+ hgx"ypvz4rp "AB m@056?C$DC0A8B6ȘSD :D@2@C24BAAAl@38_0-o$Ȳ| Nu.jQ`0!EGxx(Dp k(SJBpQZT.jJ<gIKG6 R(E:mFFE"HA\xY ,>yTTHFQQC`!IZ@\mFEw]o:X\!K" R*;F(HDq$]M\.UUHG~TKCIBj(FF"r\ \xTT= I:h 6"HAiFA`Y nj1šQyQZ\<g4?Hࢍ27&FE(*,.HCHDHEHFHG/`PYQQCQʑ+ hgaA@N䞘8"ypvz4r< ABO em0 6C'DC0hO8ȘbD:D@2@~2!4BAAA$llf"o(|Nu`2AFAAAAAYQQCԗGiQNuJB ]-.E5<gI/K6 R(E:mFFEFF"HA%\xY-,>̓*TTHFQQX?CIX mFEF`(]okB KGQNuIK` R*+FF5(HD'x@]f\.ΫUUHGTK0َuIRE( GFF"Z?x@\e̓TT!~2ItnK6"!p'HAiFASFS? YnSx šVɰpQn<ggHCHDHEHFHG r z5x"x&FE(*,.Blȁʁ́΁!HDHEHFHG/`PYQRtO(JBE-><gf?EYй.UHC؋v"HAFƁt^6$6Z2FAAPYQmGQNuJBXWZvԢ޲<gI H6(:ʂȓY"HA{1\Y;TQC#I xa HmF9k] ܼ Kp R*FʫUHDz؀]U KaI+(aNȓ"#g1l@\T I56"qHAiFSSY`#޼ ><g\h~Ax%QU/+&"FƓHC YQCGQNuH&I(J@YBv$ "B$o<_gH^f'L[lZlZl6tFE<)cLLNuH&I(JBv$ "B$LV/NAX~D̀VAM "C,tEG2A@ LI"#%w0K'MpTRԥ.p&5IMjR'#%Ԡ'HNOpr t@PfQp@1•AJ=@%Z8)ZfC-Hz??PA"I2MjR@TMNIS,xx |F}**;`VX)H "nAG1C()IcfwSl d< gJVH.hU< j4 ?!A~xD.ĢfS#g ls nA}x!.`F!#7 H$JkY4f|5 7pR@)H,H@A=pԁHNu 6$ q@-M=G=FP? -$dR@H Bn4zm8B F܈g.f Cv-H^AK+ jQ ] %Pq! ?i l B*AB(=NuIZEaA,CdhЪ6xUm6M`0, !(g|H l>I2- &@:N ?TfA* g n{gSag <g ) f0n S.-f -gjP @ DnNu M / haw GGp1S$~Z8{fR?- wqjd_YTPKGC?<852/-*(&$" JJ\n` TA 5x`KpJXdz(t p _P4R d>/ȸ {A#(C Ju1x}F_`">s XjkP"8 #23rA +up9)Z讄4 [(x0: Zd/Kuu[0o,۔Ԡ5XQ6ApԠ 4Q#pkLNu !P'pNP.01bRJH6g a\fl*B`"Xp]_o0og^aEx-`j|QbZԢcdE-egmm%gfsQZԦ|m`Jg$Y_ժ$ JgkK\p(E $TX!L$``3_.!I`#!JNuM*!(rtv 4BFJ ABR>(BF@p6Д?h@@A06~L26@o @0?`*AJ@f0<_ǰ!Vdp…H0 356`||hH< I &(Tf0JTg,1|E b d@25 ϡlef|`>6Jf `6.^0p " 1ARVԢX,|N1@PP~Z 2`]R=2g`.4` J?aJ]4Jg!l 1|Bh(|R_n&u1*CB8JyA@X~XG;&r3fQ JQg k# $iR\L)# !In$ gRp8 ሳ$IH@&3 4`W\А)@@z^26kCJ1AjW4g 45ADl1@`1 DJ0.g:BhZIV246(RJAg 4Bff k`Bm61CT!IG!JNu %3`Vr rV-V;`rWB\ :Bp{A$0p0J2XL(*g @n ` hHAm`0J1@jNu7P ΀ \-|;`\@\|9g"Jx_f`ym0g>UXf2{TCZdAZ0 GJ B*g<`j1VDրX\2gH ]< BE^^06 JjAG 4gB薐:g6kf,!X`hH@2`A`05:lhc(gF\f,"p k<%g21 \)!;X)An@|\` Ant 06gJdfaphd?/=x<V?lu2(j8T#IKe$n.4Ԥ`T6QJhdYyl-Nub@g3JyB+fY3:<P>B&!gB(Pu4tXkgKՉ]gJjRA;B=پKf:`@B2 0# o *O.Nu@22I:3v?<eJ@f)]>3@AHJyG0kD !W"P/ g0B29n)n bA6Rp)2(ЏAm1@(h>9 ^p1|1 h !i "Ԡ&B,*`TJg4 a`xvARp7)2(@m`Qs07T3E V3l`QX\h`nQdZ Ԣhlњhn4E-j#QVC pt6x|`lBY`:`*`n07T3E V3s6hn4E"-j&QZ*hXn4\7`[ԢdhE -lj47͢- jQZ#$j. 266:xp6tx`|lmB{RvZ; p Дng<1@si9RGQA"8E ` (A>BpJy.kD2&Jm4*e5\E6-Jldg XH`\*Tar Bh?:x </;x< (=!%,h06FI7 1.@251A2v!.G.v5TZHBL0B3>0Jy.g! # ]Y29g$@?Nu? x;x;x;x;x@%q` <   ob&  ,#x0   M / haw GGp1S$~Z8{fR?- wqjd_YTPKGC?<852/-*(&$" )B,04AAAAAAAAA A  A  AAAx@< .(< .(: q@F `  j<@p0gB96!(;XT#! Za tNs  pNu'NuAvA;0A)PA` pjPԠ5ШAࠨl P0TgM@#jnMAсrݦhDȂd܊@ux*WσɎ\)<F庲Pgl˼6X+$9XZk5FHx'h2'sD&2Y#Fp6`Q&     ej  +  _x(x< < < < <8      }P P P P P PPPPPPPPX '(( ( ( ( ( ((((((((r0Ü$A0 hh[RZC^JQdW200WUC: KQxx^1G&dv!EZTY # "@uTP `@m*GRQd@6*,sdP^8ŨAw;`aT T0`,  $[ul> C` a| 5 $`hl++pV!8!sBU&---]))&$ʅd+`&$"$&)+,,,,+)($ C`,('aeA $]GBꀌl0Sau`8aA&`ρ# n &w֐oρ&B'&&)+,+)&$!`|,6*ځ@_>ρcÀ`>F !`Г:` a`"&&f"&@؂!!M!d$ܤPʟAdڀ!~h!3  O` C <-xu +)1(&%À `  ` ' `? ` -@&&'$f@ " C!BTʘA&+ҁ`qH))+,,,+)**s`g`0rS` 0l !$%0"lpdaLσ)&$$`!!" '\"6&&$&`$!!<`6 0ʁ[ād/v$x  {  `a`dk `O`aO`؃)&$`lρMσ"$$]b 2i rP~laG6 "`^2ɉnԃ%ԁ$"ɢF"ㅿ $Շ%%'Ձ +"S 8PA'+ԇ') d߅$'$%/"$b ` U)))ԁ_%)Յ +0%)% %,),++? .,+,')+'w2N6' S̀ `a҃io`$`сA' " ɓd$<&ɀ ӍɅӃ?i.TŪ ފ^,;A,؋`sWZOBQA(` ࠚ T@& nA5 `i5UM0 6',  r,@d@  l ciT ajPU]Ye- x-x>%^ 5)djP]9A0 )vUqԠ3 (sT Kj{PL  P zFPd  !&QxAatf0xH$<`$$$)`a`=!'$!$'&$&(*+0!(~E!!!&p&&E1(`wq4`$$((p`aMa)`f `d͏0R"xCH0A"\@$%$"!2a`+C  j@`~P @naA` j!!%  df% C { &x&&&&'&$&3" <&<\]QO$${ 3 D)uF1!q<(&S7x$$!@c>p  wA]. u.p7H /$$$$WGd`  "&+.+&"$+~'$*P5L`ad`^x^c7`E'$@$&!!&)-)&$'+'$"  "$'&$"^xJd/x"{F;'$@$Ѐ"  lalwa`d !x@^e0x$x^VȀ\@""ādDLY!"$&'$"!ȝ-x@ bp0pƁ<00<<<?@VQUY]aeRVZ^bfSW[_cgTX\`dhOAEIMimquy}%BFJNjnrvz~TOCGKOkosw{%DHLPlptx|'(T *)PTܒ,.> +-/f;*ڲ Am20Q10/2xxTm 6G6534S߄jPԧ >@"2 BAwDSFGDC@?8FENeO>PQRSTUVWXYUpq  k((A~T/jklmno_defghirsh/z{|}~ݿtuvwxytUo_*JދQ+O j KP*OJЀW,2KF`< Ͷ">A`3dd*x аg8'hPLepـ8gfiBkmGjmlk|Q~z{i4} ~||S44a* t*vuGwyxno=rsq pT*GQzl譛nR >Q@Udू h@ԩ=R* t`HT[w@ 0@T?!$ehgfedd>xstuvwxz{|}~yAklmnopqr /G=2 8<@@d . 6fl8 dNPd@n 2!6Ȁ@Pd)̦lԥmRU*Gyz{hijkGdefg|}=~~`GWǀu@?P~T?lQt xZ]ttlx@>v٠uwvm jPnopqrs4 jPڪS/G=_5VpU*~Cqr{uvh?swtx}efghij?lklmnopyi~{h7z| QBG Q|W%K>{hG}>*GTA5A jĻi~Y&HQ )ߠA?? G/M@YUQP~NZVRKO5[WS_P\XTdefghiK^_`abc[2]jk^C~lmA' SBPRO RSC {lUSBPROHI RSC {AND+<>OR-<=>=NOT*()LIKE/SSSX_XBBSSBBBBBBSSSSBBt1t2t3t4t5t6t7SSfffffffffffffff.FFFFFFFF________________________XXXXXXXXXXXXXXXXXXXXXXXXfffffffffffffff.FFFFFFFF________________________XXXXXXXXXXXXXXXXXXXXXXXX=SSSSBBSutuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuvvvvvv v v vvvvvvvvvv+v;v<v=v>v@vBvavvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvwwww wwwwwwwww!w#w%w'w)w+w-w/w1w3w5w7w9w;w=w?wAwCwEwGwJwKwLwOwPwQwTwUwVwYwZw[w^w_w`wcwdwewhwiwjwlwnwwwwwwwwxx x x xxxxx8\ @"4x`":#\""#@""#4x`"#xD 4`d 0pAՏyqaWA1aa19qq91aa1 aa??UUUUUUUUUUUUUUUU""""""""""""""""""""""""3333333333333333 xxxx<ff<<ff<<ff<~~~~<ff<~~<ff<xxxxxxxxxx<ff<~~xxxxxxxxXXX  8 X x      8 X x      8 X x    x  8  8x8x8Xx88$12 twxy|}~ t0 tRTUVXYZ\]^`abdefhijlmyz{ t t t   7P tl t+ \ j x           q  q q q R p  +*qpqrs t !u "v#w$x%y&z'{(| )} *~,;p -..</J0X1f 2t 3456789 : ;+   * 8($3pqrs t u v w  x yz{ |}~ $#pqrs tuvw xyz { !|"}#~ %9 &C'L(N%P5RTVXZ\^ ` 1 b  d  g  j m/%p+r  At : Vr   @1 @@F @T       At AAAAAAA6   @1 @ @b @p@~R    &q$ !  n O  P Q At A A A A AAA2@  @1@@@nopq rst"q#-u+w N +| } ~$ At Aj A A A AAA . "!        ! # $' &%%1$@'@#`$ "  J     A     @@@t `"  @  @  %  At AfAAAAAA   @1 @ @& @4@B* ij kqF  > > %  "@P @^@l      @z b  z$R%'),z0:2225z. X5- +:5J Attributes ColorSelectionSelectedBBB12345678910111213BSt1t2t3t4t5t6t7SSSSSt1t2t3t4t5t6t7SSF_______________XXXXXXXXXXXXXXXSS123456789012345678901234567890______________________________XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX1111111SS1111111S=<>AND+<>OR-<=>=NOT*()LIKE/SSSX_XBBSSBBBBBBSSSSBBt1t2t3t4t5t6t7SSfffffffffffffff.FFFFFFFF________________________XXXXXXXXXXXXXXXXXXXXXXXXfffffffffffffff.FFFFFFFF________________________XXXXXXXXXXXXXXXXXXXXXXXX=SSSSBBSutuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuvvvvvv v v vvvvvvvvvv+v;v<v=v>v@vBvavvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvwwww wwwwwwwww!w#w%w'w)w+w-w/w1w3w5w7w9w;w=w?wAwCwEwGwJwKwLwOwPwQwTwUwVwYwZw[w^w_w`wcwdwewhwiwjwlwnwwwwwwwwxx x x xxxxx8\ @"4x`":#\""#@""#4x`"#xD 4`d 0pAՏyqaWA1aa19qq91aa1 aa??UUUUUUUU""""""""""""33333333 xxxxffffff~~ff~ffxxxxxxxxxxff~xxxxxxxxXXX  8 X x      8 X x      8 X x    8 x   8 x  8x8XxXx$12 twxy|}~ t0 tRTUVXYZ\]^`abdefhijlmyz{ t t t   7P tl t+ .         "   0 >L Zhv q qqqR p+*qpqrs t !u "v#w$x%y&z'{(| )} *~,;p-./01 2 3456,7:8H9V :d ;r+   ($ 3pqrs t u v w  x yz{ |}~ $#pqrs tuvw xyz { !|"}#~ %9 &C'L(N%P5RTVXZ\^ ` 1 b  d  g  j m%p+r  AtJf   @1 @@ @     AtAA*AFAbA~AA  @1 @ @ @@     &q%" O  P Q At A  A& AB A^ AzAA@ @1@@@(nopq rst"q#-u+w +| } ~$ At A A A" A> AZAvA  "!    ! #6$'&%%1$@'@D#`R$ "       A   @`@n@|t `" @@% AtAAAA:AVArA  @1 @ @ @@ ij kq > >%  "  @@@   @ "$:&2(B*.01r3 README ====== This document contains information about a number of features in Superbase Professional and the Forms Editor which could not be fully described in the User Guides. If you have loaded the Readme file into the Superbase Text Editor, you can scroll down the document by pressing the down cursor key or by using the scroll bars at the side of the window. For a list of the topics covered in this document, see the README CONTENTS on the next page down. README CONTENTS SUPERBASE PROFESSIONAL Using Superbase Personal Files Edit Form Reorganize Using the Lookup Function Keyboard Equivalents New Editing Controls The Current Record Button Passwords Reserved Words GDOS Graphics and Form Printing Displaying Images Image printing Using Superbase as a Relational System Further Rules for Constructing Queries Creating ASCII files DATABASE MANAGEMENT LANGUAGE (DML) Changes to DML New Commands User-defined Menus Saving Files under Program Control FORMS AND FORM HANDLING The Forms Editor Window Form Resolution Changing Text Fonts Using External Files in a Form Report Functions FORM CALCULATIONS Calculation Types Calculation Prefixes PRINTING Printer Definition File Creating a .PRT file MISCELLANEOUS FORTHCOMING FEATURES SUPERBASE PROFESSIONAL Using Superbase Personal Files ------------------------------ Superbase Personal is upwardly compatible with Superbase Professional; so if you have upgraded from one to the other, you can use any of the files that you created in Superbase Personal. (It doesn't work the other way round: Professional files cannot be loaded into Superbase Personal.) However, there a number of differences in the way the two programs store file data. You should take these into account when you are loading Personal files into Professional. When you save the files, Superbase Professional will automatically convert them to its own format. But in some cases you may need to edit your Personal files before you can use them. Here is a checklist of the points to bear in mind when converting files from Personal to Professional: * Professional query files include the details of any database files associated with a query and these files are opened automatically when the query is loaded. If you use a Personal query in Professional, you will need to open the database files yourself before loading the query. Then save the query in order to convert it to the Superbase Professional query format. * Although Superbase Personal does not offer a Constant field type, it allows you to create a special type of calculation formula which acts like a constant formula. For example, if you define a single word formula such as "London" or TODAY it will have the same effect as the equivalent constant formula in Superbase Professional. When you load a Personal file into Professional, calculated fields will be defined as CLC RDO fields. If they were originally intended to act as constants, you should change the CLC attribute to CON by selecting Edit File and editing the file definition. You may also want to remove the Read Only attribute. * The list of words that are reserved for the use of the system is more extensive in Superbase Professional than in Superbase Personal (see the section on Reserved Words further on in this document). As a result, you may find that some of the field names in your Personal files are treated as reserved words in Superbase Professional. For example, Professional offers a large of number of new functions such as YEAR and HRS. If you have used YEAR as a field name, it would now become invalid. Before loading a Personal file, check that the field names are valid; if they are not, change them by editing the file definition. Edit Form --------- The Project menu option, Edit Form, allows you to exit from Superbase temporarily and run the Forms Editor. If you have opened a form in Superbase, you can use this option to edit it in the Forms Editor and then return to Superbase. Selecting Edit Form presents you with a dialog which asks whether you want to exit from Superbase. You should click on OK to load the Forms Editor. Once you have edited the form (or created a new form), selecting Quit from the Project menu in the Forms Editor will return you to Superbase. For Edit Form to work, Superbase must be able to locate the Forms Editor program. First it looks for the program in the parameters directory as specified in the Options dialog. If this fails it will look in the current directory and drive A (which may, of course, be one and the same). If the Forms Editor still cannot be found, Superbase will display a dialog with the message: Can't find SBFORMED.prg Enter pathname or insert disk Hard disk owners are advised to keep Superbase and the Forms Editor in the same directory together with the SB.PAR and SB.PRT files. In floppy disk systems, owners can then type in the pathname for the directory where SBFORMED.prg is held. On floppy disk systems, owners should insert the Forms Editor disk in drive A or B; if they insert the disk in a drive which is not current, they will also need to enter its drive identifier in the dialog box. When you exit from the Forms Editor, Superbase will be re-loaded from disk. As before, if it cannot be located, a dialog will appear which allows you to type in the pathname for the Superbase program file (SBPRO.prg) or insert the Superbase disk. Reorganize ---------- The primary application for Reorganize is as described in the User Guide. It allows you to reclaim disk space after deleting records from a file, and makes disk operations with the file more efficient. This option can also be used to recover records after their data has been corrupted; i.e., when an attempt to open a file produces a disk error message. Reorganize steps over any errors it finds in a file and retrieves as many valid records as it can. The records which have been damaged will be lost when the new file is created so Superbase informs the user with the message: "New file has different record count". There may also be circumstances in which Reorganize can be used to recover data which could not be accessed before. For example, if you turned off the computer after storing new records in Batch mode, the details of these records would not be stored in the file header. Reorganize rewrites the file header so that the records are included in the new file. In this case, it issues another error message (as well as the one above): "Source file size incorrect in header". Note that the manual suggests that the best way to recover data from a disk error is to Export the remaining records and then import them to a new file. This method has now been superseded by Reorganize. Using the Lookup Function ------------------------- There are several points to note in connection with the LOOKUP function: * When you are creating a validation formula (in a file definition) that uses LOOKUP, you should always enter the function's arguments by typing them into the box at the bottom of the validation dialog. In other words, even if your LOOKUP formula contains a field which is shown in the field list above, you should type the field name into the box instead of clicking on it. * It is important to include the file name as an extension to any field name used with LOOKUP. This applies to all fields irrespective of whether their names are unique to one file or not. For example: LOOKUP(Forename.Address,Firstname.Customers) is correct, while: LOOKUP(Forename,Firstname) may cause problems. * LOOKUP will not work with date/time and numeric fields that have null values -- i.e., fields that have been left blank. If you wish to use LOOKUP on fields of this type you must force the first argument to give a null value when empty. For example LTRIM$(DATE$(date field)) will give a null string when the `date field' is empty. Default Dialog Keys ---------------------------- Many of the Superbase dialogs accept Return as the keyboard equivalent to clicking on the OK or Cancel buttons. Superbase indicates which of the two buttons will accept the Return key instead of a mouse click by highlighting the button with a thick black line. In cases where a casual OK might be destructive, Superbase does not allow the Return key equivalent. Keyboard Equivalents -------------------- In addition to the keyboard equivalents described in the User Guide, Superbase also provides the following: Alt B Toggles Bold (text style) on and off in the Text Editor Alt U Toggles Underline on and off Alt I Toggles Italic on and off Alt P Toggles Plain on, bold, italic, and underline off Alt B Toggles Batch mode on and off (this option is only available when the database window is active, otherwise Alt B acts as a keyboard equivalent for the Bold text style) Alt A Select the program command line window -- equivalent to selecting Command from the Program menu. The keyboard equivalent for Set Paging, Alt P is no longer available. New Editing Controls -------------------- Two new controls have now been provided to allow the user to copy lines in the Program Editor and Text Editor. CTRL L is used to select the line you wish to copy; move the cursor to any point on the line and press CTRL L. CTRL R inserts a copy of the line that has previously been selected with CTRL L; move the cursor to the point in the program or document where the line is to be inserted and press CTRL L. A copy of the line will then be inserted below the cursor. Current Record Button --------------------- By now you will have noticed that the current record button on the Control panel does not agree with the illustration in the User Guide on page 1-8. Whereas the guide shows a single triangle (as in Superbase Personal), the program now has two triangles pointing in opposite directions from each other. The reason for this is that, in Superbase Professional, the button has two functions. As well as acting as the current record button, it also allows you to change current page in a multi-page form. In the first capacity, it is used to redisplay the current record after the record data has been overwritten or removed from the screen by some other action -- for example, by Status File. As a page selector, the same button is used to select either the next page or the previous page. Clicking on the right-hand triangle displays the next page, clicking on the left-hand triangle displays the previous page. Passwords --------- In earlier versions of Superbase, passwords were shown on screen in the Password dialog as you typed them in. Now, when you type in a password in order to gain access to a file, the password is not displayed in the Password dialog. Reserved Words -------------- It should be emphasised that the reserved word list includes all Superbase functions even though they are not listed in Appendix C. You should bear this in mind when you are defining a file or writing a program: many of the DML functions have names which you might tempted to use as field or variable names, for example HRS, DAY, MONTH, YEAR. Note also the following keywords which should be added to the list in Appendix C. AS BUFFERS CALL COPY DISK DISKSPACE PAGING PG PRINTER RECORD RENAME TABLE GDOS ---- The GDOS disk contains the files which are needed to display non- system fonts on screen and to print a form in graphics mode. If this disk is not present in drive A: a. Any non-system fonts will be converted to system fonts. b. Superbase will not be able to print a form in graphics mode. The GDOS graphics printer driver is only suitable for Epson and compatible printers. If you wish to modify the disk -- to install a driver for a different printer (such as the Atari laser printer) or to create a new copy discarding any fonts that are not used on your system -- you will need to understand how the disk works and how it is structured. The rest of this section describes the GDOS files and the procedure for editing them. In fact, the only file you will need to alter (if any) is the assign.sys file which tells the GDOS program which screen and printer fonts to use, and where to find them. The assign.sys file should be stored in the root directory of the disk, while GDOS.prg must reside in the \AUTO directory. Assign.sys is an ASCII file which contains four lists giving the non-system screen fonts for each resolution and the printer fonts for the graphics printer driver. Each list is preceded by a line which specifies the device driver used for the fonts that follow; i.e., either a screen driver or the graphics printer driver. The first line (the line before 01p screen.sys2) sets the path for the fonts, and printer driver. Otherwise this block can be ignored -- it contains a list of default fonts and would be the screen device used by programs that do not know which monitor is installed. The second list contains the fonts for low resolution screens and is preceded by: 02p screen.sys (the low res screen device driver) The third list contains medium resolution screen fonts and is preceded by: 03p screen.sys The fourth list gives high resolution fonts and is headed by: 04p screen.sys Following these screen fonts, the assign.sys contains a list of printer fonts (for graphics printing) preceded by: 21 fx80.sys In this case fx80.sys is the name of the Epson graphics printer driver supplied with the product. To use another printer driver, edit the assign.sys file to replace fx80.sys with the new driver name and follow it with a list of the font names used by the driver. You may like to create a working copy of the GDOS disk which only contains the files that are needed on your system. Copy the entire disk first, then delete any screen fonts which are referred to in the assign.sys file but are not actually used; i.e. discard the medium res fonts if you always use a high resolution monitor. It is not necessary to alter the assign.sys file itself. Graphics and Form Printing -------------------------- Printer Options on the System menu has been extended to provide a graphics printing option for forms. At the bottom of Printer Options dialog there are now two buttons labelled Draft and Graphics. Draft is the default setting and is the one you will use for most of your printing requirements -- whether you are printing a report, query output, or simply taking a printout from the current file. If a form is in use all the text items will be printed as well as the field data. If you wish to print the field data only then you should set the Print Status of the text items to non-printing within the Forms Editor. The Graphics option can only be used when you are displaying data with a form. It ensures that all the graphic elements in the form are printed -- lines, boxes, areas, images, and so on -- together with all the data the form displays. Data items are printed in the system font, text items are printed in the fonts and point sizes which were set in the Forms Editor. However, Superbase will also take into account the Print Status of an item as set in the Forms Editor. Note that the graphics printer driver supplied by GDOS will only work with Epson and compatible printers. The graphics printing option is not available if you use another type of printer (but see the section above on GDOS for an explanation of how to install an alternative printer driver). Displaying Images ----------------- There are two contexts in which Superbase can display graphics images: in the External File Management System (EFMS) and within a form that makes use of external files. Images may be in one of three resolutions -- high, medium, or low resolution -- according to the type of system they were created on. This section describes image and monitor compatibility; it describes what happens when you load an image which was created on a system with a different monitor. With a high resolution monitor, high resolution images will be shown as they are; medium and low resolution images will be distorted and, if colour, will be shown in monochrome. With a medium resolution monitor, high resolution images are distorted in both the EFMS and the Forms Editor. Low resolution images are distorted and monochrome when they are displayed in a form, but can be reproduced faithfully within the EFMS. When you click on the camera button Superbase will display the low resolution images in a separate screen without distortion and with its original colours. Click on the camera button to return to the normal Superbase screen. As you would expect, medium resolution monitors can display medium resolution images without distortion. In the EFMS, these images are shown in their original colours. Within a form, you can switch between the image's original colour set (colour map) and the normal Superbase colours. Initially, when you click on the camera button, medium resolution images take the existing set of colours. If you then click in the external field containing the image, the colours will be set to the image's original colour map. Click outside the field to revert to the Superbase colours. Note 1: Superbase does not run with a low res monitor, but on a medium resolution monitor it can show low resolution images without distortion (in the EFMS using a separate screen). Note 2: The Forms Editor manual does not mention that the Alignment attribute also applies to images. In the same way as other field data, images can be aligned to the top left, the centre or the bottom right of their field boxes. Image Printing -------------- Gem can only print `.img' images, but Superbase will convert images in other formats to `.img' format, and store them in a temporary file (in the temporary file directory specified in Options). This enables the user to print images in any of the other formats acceptable to Superbase -- 3 Degas compressed, 3 Degas uncompressed, and Neochrome. Images are clipped on screen but rescaled when printed out. Using Superbase as a Relational System -------------------------------------- Although it is impossible to describe the principles of relational database design in this document, most users will benefit from an abbreviated account of some of the more important facts. When you are contemplating the basic design of a relational database application, there are three key considerations: 1. Establishing relationships between files. Every pair of files between which there is to be a relationship must have a field in each file that will be used as the link between them. These fields should be designated as key fields, preferably with unique indexes. 2. Ensuring integrity of relational link data. At the data entry stage, what goes into the link fields described above must be carefully controlled. The aim is to ensure that, for example, an account code (usually a text field) is always entered in the same case in all files in which it is used. This is done by setting the text field attribute for each of the link fields to perform automatic case conversion to either upper or lower case; obviously the conversion must be the same for both fields. Validation formulas may also be necessary to check the pattern of what is entered, its length, or the range of acceptable values. The second control on data integrity is via the LOOKUP function. This enables the system to check what is entered into the link field in one file against what already exists in the link field in the other file. For example, you would always want to check that a product was in stock before accepting an order for it. The LOOKUP function is attached to the link field in the file definition as a validation formula. However, if you are using links as described in the next paragraph, you must ensure that none of your LOOKUP functions tries to check for a record that you are still in the process of creating! 3. Including links in a multi-file form. If you want to design forms which can retrieve data from more than one file, you must use the Set Link menu option in the Forms Editor to create the links between the files. In Set Link, you specify the link fields described above as the master (or primary) and secondary link fields. At the other end of the application, you will want to retrieve data from your relational system in the most convenient way. There are a number of ways of doing this. 1. Browsing. Use a multi-file form with links set up as described above. The video buttons operate in the usual way, and you can switch files and indexes to vary the order of retrieval. The printer may be used to obtain draft or graphics hard copy. Both graphics and draft forms may also be printed under program control. 2. Queries. The Process Query Edit menu option can be used to set up multi-file queries, which may be stored on disk. Output may include any fields from files between which a relation is specified in the Filter, and can be sorted as you wish. Report functions may be added, as well as limited formatting, but output is basically columnar and non-graphic. 3. Reports. Report programs may be generated automatically with the Forms Editor or written directly in the program editor (the Program Edit menu option). The forms editor allows for multi-line headings and footings, many levels of subtotalling and sorting, and full page field positioning, as well as offering many other features. Relations between files are derived from the links between files, so here again you must use the Set Link menu option before saving the report form. Output is non-graphic. Further Rules for Constructing Queries -------------------------------------- In multi-file queries, the user (especially the programmer) must exercise extra care to ensure that the query is efficient. The following rules should be observed: 1. Files are processed in the order in which they are mentioned in the WHERE statement (Query Filter Line). In some cases you will want to process the smallest file first, in some cases you won't. You may have to experiment to find the optimum query for a particular application. 2. Every file reference in the WHERE statement must be part of a chain. WHERE A=B AND B=C is acceptable, but WHERE A=B AND C=D is not. A simple rule of thumb is that there should always be one less join than the number of files in the query. DATABASE MANAGEMENT LANGUAGE (DML) Changes to DML -------------- Programmers should be aware of the following changes, extensions and undocumented features in Superbase's Database Management Language: 1. The LOOKUP function is case sensitive -- for example, LOOKUP("fred",Firstname.Address) will not find an occurrence of "Fred". 2. The record SELECT commands (SELECT NEXT, SELECT LAST, SELECT KEY etc) have been amended so that they now take another optional parameter, FORM. The effect of this parameter is to activate any multi-file links that have been set in a form. If it is not used, the SELECT commands only operate on the current file and ignore any links between files. FORM must be placed immediately after SELECT. For example, with the SELECT NEXT command, you would enter: SELECT FORM NEXT. 3. The KEY command now accepts a numeric key as well as a string key. 4. The commands EJECT, LOCATE, and FOOTING do not operate when the current output device is the screen and PAGING is OFF. You can, however, use LOCATE with paging off to set the column position -- but not the row position. 5. FORM. This command takes another optional parameter, SHOW, which is used to display external files. If the form contains external file fields, FORM SHOW is equivalent to clicking on the camera button. The syntax for FORM is: FORM [SHOW] [page [,row,column]] Note that the `page' parameter is now optional. When it is omitted and the FORM command is used without any following parameters, Superbase only displays the field data in a form and omits any other objects. 6. The command SET BUFFERS only sets the size of the disk buffers for the current session. If you want to set the number of buffers to be saved with the parameters file (SB.PAR), use the new command SAVE SET. 7. SET TABLE/RECORD/FORM can be followed by the ON parameter. This switches to the specified view mode even if there is a form in memory. Normally SET TABLE, for example, acts as a toggle between Table view and the form. If Table view is the current view mode, this command would switch in the form. SET TABLE ON, however, would leave the current view mode as it is. The advantage of this option is that it enables the programmer to select a view mode without having to keep track of what the current mode is. 8. During the execution of a program, BREAK OFF disables the Stop button and CONTROL-C; also, you cannot use the space bar to pause during program execution. When the program has finished, BREAK is turned on again. 9. Apart from the Stop and Pause buttons, the remote control panel is disabled while a program is running. Stop is only disabled if the BREAK OFF command has been issued, the Pause button is available at all times. 10. STORE takes another optional parameter, FORM. If FORM is used all the records in the current form are saved; otherwise STORE only saves the record which belongs to the current file. The new syntax for this command is: STORE [,0/1/2] [FORM]/[FILE sbfname] Note that STORE, 2 secures not only the current file but also any other open files. It is therefore not necessary to follow it with the FORM or FILE parameters and, in fact, adding one of these parameters to STORE, 2 will cause an error. 11. BLANK can also take FORM as an optional parameter. With a multi-file form, BLANK FORM creates blank records for each file represented in the form. When the FORM parameter is not included, BLANK only creates a blank record for the current file. The syntax for this command is: BLANK [FORM]/[FILE sbfname] 12. If SELECT DUPLICATE does not find a duplicate of the current index field, it leaves the current record unchanged. 13. A string function should not contain more than one intermediate string concatenation. For example, LEFT$("abcde",LEN("x" + "y")) contains only one intermediate concatenation and gives the correct result, but LEFT$("ab" + "cde",LEN("x" + "y")) gives the wrong result because it contains two concatenations -- "ab" + "cde" and LEN("x" + "y"). 14. Provided there is enough memory available, Call can be used to load another program from within Superbase. Typically this would be a utility program, as in: CALL "a:Dump.prg" If the program takes parameters, you can include these after the program name separating them by the space character. 15. With commands that set a single file filter using WHERE (for example, IMPORT, EXPORT and SELECT WHERE) you can include ASK as the parameter to the WHERE statement. The effect of ASK is to display the standard filter dialog when the command is executed, thus allowing the user to set a filter while a program is running. If a filter is present when ASK is executed, the filter expressions will be presented as a default for the dialog. Examples are: SELECT WHERE ASK In this example, ASK causes the filter dialog to be presented. Entering the following filter line (at run-time): Lastname LIKE "[r-z]*" would have the same effect as executing the command: SELECT WHERE Lastname LIKE "[r-z]*" However, a partial filter like this is not allowed: SELECT WHERE datefield > ASK 16. ENTER. The parameters for this command can only be used with a form. With other view modes, ENTER (on its own) places the data entry cursor in the first open field that is not Read Only. 17. REQUEST. There is now an additional dialog type with the dialog number 19. This displays a list of the forms in the current directory. Note that the description in the DML User Guide for dialog type 5 is incorrect. This dialog provides a list of the fields in the current file. 18. ? QUERY. The syntax for this command has been extended to make it easier to select a device for output. It is no longer necessary to select an output device before executing ? QUERY. Instead you should specify the device using the TO parameter. The new syntax is: ? QUERY [TO device] where `device' can be the printer, an ASCII file or a new `.sbf' file. If this parameter is not included output is to the screen. The device options are: TO PRINTER Outputs to the printer. TO FILE filename Creates an `.sbf' file on disk under the file name specified. TO filename Outputs to the ASCII file specified by `filename'. 19. IF THEN ELSE. The explanation of block IF THEN statements given in the manual needs to be supplemented by two further points: * Every block IF THEN statement must end with an END IF statement. (Example 4 on page 5-69, Volume 2, requires a second END IF after the last line.) * Within a block IF THEN statement, you can insert one or more ELSE IF statements. These are used to extend the number of alternatives provided by the original block IF THEN (so that it has the same effect as the CASE statement found in some versions of Basic); but they do not require additional END IF statements. The following examples should make these points clear: IF a% THEN ? atrue$ IF b% THEN ? btrue$ ELSE ? bfalse$ END IF ELSE ? afalse$ END IF IF a% =1 THEN ? "one" ELSE IF a% = 2 THEN ? "two" ELSE IF a% = 3 THEN ? "three" ELSE ? "Not 1 to 3" END IF New DML Commands ---------------- 1. SET PG Use this command to set the page size on your printer. It takes the syntax: [SET] PG rows [,columns [,ss]] where rows specifies the number of rows on the page and column specifies the number of columns (the page width). ss stands for single sheet and takes a value of 0 or 1. 0 specifies that single sheet paper is used, 0 specifies continuous stationery, also known as fan-fold paper. SET is optional. An example of the use of SET PG would be: SET PG 50, 65, 1 This line sets the format for a printed page to 50 lines of no more than 65 characters. It also tells Superbase that the printer takes continuous stationery. You can use this command in a program or from the command line to customize a page for any kind of printed output -- whether you are printing a text file, record data or a report. However setting up the printer in Preferences on the Amiga will override the PG settings. 2. SET PRINTER ON [,0/1] / OFF / [printer def file name] This is the program equivalent of selecting Print on the Set menu. The 0 parameter specifies draft mode printing, and the 1 parameter specifies graphics mode printing. Use this command in conjunction with FORM to obtain form printouts. After SET PRINTER ON has been executed, any output to the screen will also be sent to the printer, so remember to SET PRINTER OFF when the print operation is complete. By supplying a printer definition file name as the last parameter, you can instruct Superbase to ignore the SB.PRT file (see the section on Printing further on in this document) and instead to load the printer definition file of your choice. The file name must be enclosed in quotation marks and should not include the PRT extension name. Thus if you wanted to use the control codes for the Diablo printer, you would enter the command: SET PRINTER "DIABLO" 3. SAVE SET This command saves the Superbase parameter file. It is equivalent to clicking on OK in the Options dialog. All the parameters that have set in the dialog (and those that are set elsewhere) will be saved on disk in the file SB.par. 4. SET MIN This command sets the minimum size allowed for the Superbase window. It takes two optional parameters, the minimum width and height of the window in pixels, so the full syntax is: SET MIN [width [,height]] Maximum width is 640, maximum depth is 183. SET MIN without parameters allows the programmer to lock the window to its current size while a program is running. You cannot use SET MIN to set the window larger than its size when the command is executed. SET MIN can also be executed from the command line or a function key. User-Defined Menus ------------------ On GEM versions of Superbase, you can define up to six menus and each can have up to eight items (not including item 0 which specifies the menu title). The figures given in the User Guide -- 10 menus with 12 items -- only apply to the Amiga. A menu item can have a maximum of 23 characters. Other points to note in connection with the commands MENU and MENU ON are: * The first item defines the width of a menu in terms of the number of characters. When you define the text string parameter for item 1 you may need to allow for the width of other items in the menu by adding spaces to the end of the string. * If you wish to use checkmarks in your menus, remember to leave a space for the checkmark character when you define the MENU text string -- the first character in the string should be a space. * MENU on its own clears all the menu settings (as do ERASE and CLEAR). * After the MENU ON command has been executed, any menus that have been defined remain active until an item has been selected. The program example on page 5-91 of the DML User Guide is slightly misleading on this point since it suggests that the MENU ON command needs to be executed repeatedly. A better way of checking whether an item has been selected would be: MENU ON a%,b% menuloop: ON a% GOSUB sub1, sub2, sub3 GOTO menuloop Note, however, that the MENU ON command should be executed again after an item has been selected in order to reset the menu variables to 0. Saving Files under Program Control ---------------------------------- When you save a file using one of the menu options, if the file already exists on disk, Superbase issue a message warning that the file exists and asking if you want to replace it. But when you save a file under program control, there is no warning message; Superbase will not tell you if you overwrite another file with the same name. One solution to this problem is to include a routine in your programs which checks whether the file exists on disk before saving a file. You can do this using the OPEN `filename' FOR INPUT command, where `filename' is the name of file you are about to save. Superbase will generate a `DOS can't open file' error (error number 68) if the file does not exist. FORMS AND FORM HANDLING The Forms Editor Window ----------------------- When you run the Forms Editor, you will notice that its window does not extend to the bottom of the screen but stops a couple of lines short. The reason for this is that the window has been set to the same size as the Superbase window. Any form which you design to fit in the Forms Editor window, will therefore also fit in Superbase's window. The Forms Editor also gives you the choice of working with a full screen. Click on the full box (in the shape of a diamond) at the top right-hand corner to switch between a full screen window and a Superbase-sized window. Form Resolution --------------- A form can be in one of two resolutions, high or medium. Although you can load a form with the wrong resolution into Superbase, it will be either stretched or compressed depending on the type of monitor your Atari has. To warn you that the form resolution is incorrect, Superbase displays an information dialog message before loading the form. Changing Text Fonts ------------------- Contrary to what is stated in the Forms Editor User Guide, text fonts can be altered without deleting the text and typing it in again. In fact, the text font can be treated in the same way as the text style, as one of the text object's attributes. To change the font, first select the object by double clicking on it; then select the new font from the Fonts menu. Remember that the GDOS disk must be present in drive A if you wish to display non-system fonts. Using External Files in a Form ------------------------------ You can use external file fields in a form in the same way as you do in a database file. The difference is that the external files are displayed in the field boxes rather than in a separate window. This means that multiple external files can be displayed at the same time. When you load the form into Superbase, the box for an external field will show the data in the current record; i.e., the name of an external file. To display the file in the box, click on the camera button. If a box which contains an image file extends beyond the screen, Superbase will move the form so that it shows as much of the image or text as possible. The result of entering a box -- by clicking on it, or by pressing Return after editing the previous field in the field order -- differs according to whether it contains a text file or an image file. If you enter a text box, Superbase replaces the box with the Text Editor window (which is given the same dimensions as the box). You can then edit the text in the normal way. Closing the Text Editor window or clicking in another part of the screen, restores the text to the field box, and moves on to the next field. These facilities for showing text and images in external field boxes only operate if the box is more than one character deep. For this reason, the first thing you should do after placing an external field on a form (in the Forms Editor) is resize it. Report Functions ------------------- Apart from COUNT the report functions -- SUM, MIN, MAX, MEAN, VAR and S.D. -- can only be used with numeric fields. These functions operate either on all the records in a group (if used in an AFTER GROUP section) or on all the records in the report (in an AFTER REPORT section). SUM Gives the field total for all the records in a group or report. MIN Returns the minimum value of the specified field among the records in a group or the report. COUNT Returns the number of records in a group or the report. Unlike the other functions, COUNT should not be followed by a field name -- it operates on the field specified in the REPORT or GROUP box. MAX Returns the maximum value of the specified field among the records in a group or for the report. MEAN Returns the average value of the field data in a group or in the whole report. VAR (Variance) Provides a measure of the spread of the data from its mean. S.D. (Standard Deviation) Provides a measure of the spread of the data from its mean -- for the field data in a group or over the entire report. FORM CALCULATIONS Calculation Types ------------------ The calculations you add to a form have a number of features which are not covered in the Forms Editor guide (you should ignore the calculation examples given in the guide). In fact, with forms that are designed to be used in Superbase, calculations can play a far more important role than is suggested in the guide. This section describes these features in detail. Calculations take the same names as DML variables. If they are intended to store string data, the last character must be `$'; if they are used to store numeric data, the last character must be `%'. Calculations referred to by another calculation must already have been added to the form. When you create a calculation, you will be presented with a calculation dialog where you enter the formula for the calculation. Initially, it will show a list of the fields in the current file which have been added to the form. If you want to refer to other calculations in the formula, click on the multi- file gadget. The calculation names will then be listed as if they were fields belonging to a file called FORMCALCS. There are four different types of form calculation, and each has its own syntax. 1. Blank calculations. These are calculations which do not have a formula attached to them. They provide a means of interacting with a form from a program and can be treated as program variables. To define a calculation of this type, first enter its name and then, without entering a formula, click on OK in the formula dialog. Once the form has been loaded into Superbase, the calculation can be used as a link between the form and a program. This works both ways: you can assign a value to a calculation-variable either by typing it in the calculation's box on the form or by executing an assignment statement in a program. Suppose, for example, you defined a blank calculation with the name fred%. In the form's field order fred% is number 5. If you wanted to input data to a program from the form which contains fred%, you would include the program line: ENTER 5 When this line is executed, the input cursor will appear on screen in the box belonging to fred% and the value entered by the user will be assigned to fred%. If you now executed the Memory command, fred% and its contents will be listed along with all the other program variables. And any other DML commands which operate on variables, such as CLEAR, will also work with a calculation variable. To assign the value 22.5 to fred% from within the program, you would execute the statement: fred% = 22.5 This value will then be shown in the calculation box when the form display is next updated. Note that ENTER is the only input command that can be used with a form. Forms are object oriented rather than character oriented so you cannot use ASK or GET in combination with LOCATE. Another point to note is that when you use ENTER with a calculation, you can only identify the calculation by its field order number; a command such as: ENTER fred% will not work. 2. Standard calculations. These function in the same way as the calculations which are attached to fields, and they take exactly the same syntax. In fact, they can be regarded as a special kind of field which only exists on a form. The calculation name should not occur in the calculation formula unless it is a self-referencing calculation. Instead the result is automatically assigned to the calculation when the formula is performed; that is, after each of these events: * Saving a record * Moving the cursor through the calculation box * Clicking in the calculation box * Retrieving another record, e.g. by clicking on the Next Record button or with the command SELECT NEXT * When you press Return after entering data in the box (only possible if the calculation is not Read Only) Typically, this type of calculation is used to derive a total from the contents of other calculations or fields and then to display it on the form. Another application would be to display a date by using the keyword TODAY in the formula. Examples are: Calculation name Calculation formula subtot1% Quantity * Price name$ Left$(Firstname,1) + ". " + Lastname When$ TODAY If you want to create a self-referencing calculation (see Self-referencing Formulas, Chapter 2, Volume 1), you need to add the calculation to the page and then edit it. 3. LET calculations. The formula for this type of calculation must start with an assignment statement with LET as the first word. It is used to assign a calculated value to a field or another calculation. The field may belong to the current file or another open file. An example would be: LET Amount.invoice = quantity * cost where this formula is attached to the calculation fred%. Quantity times Cost will be evaluated in the same circumstances as for type 2 calculations and the result will displayed on screen in the calculation box belonging to fred%. When a new record is retrieved, things happen slightly differently. The right-hand part of the formula is evaluated and displayed, but the value is not assigned to the field named to the left of the equals sign. As with the other types of calculation, the result determines whether the calculation should be defined as a string or numeric variable; i.e. for a string result, the calculation name must end with the `$' character; for a numeric result, the name must end with the `%' character. If you are using a LET calculation to send or `post' data to a record in another file, remember to save the record after completing a task. 4. Executable calculations. These calculations contain program statements which are executed when the user passes through the calculation box or clicks on it. A calculation of this type must begin with a DML command as opposed to the name of a variable, field or calculation. But, to distinguish it from other types of calculations, the command word should not be LET, AFTER or POST. Apart from this, executable commands follow the same rules as for command line statements. Almost any single or multi- statement DML program line can be entered as an executable calculation. This provides immense scope for creating powerful forms with their own built-in processing facility. At the simplest level, you could use an executable calculation to assign strings to function keys for use in data entry. For example: Key 1, "London": Key 2, "New York": Key 3, "Paris": Key 4, ... More complex applications include running a program, executing another calculation, etc. You can even use the calculation itself as a variable into which the user can enter a value. Thus the following command string could be assigned to the calculation f$ IF f$ = "A" THEN ..... ELSE ..... To force a calculation, make it Read Only and next in order. You can only make a calculation self-referencing by creating then editing it. Calculation Prefixes -------------------- In addition to the four calculation types, there are two prefixes, AFTER and POST, which can be placed in front of the formulas for types 2 and 3. AFTER The purpose of AFTER is to force a formula to be performed more frequently than it would be normally. It is followed by an optional field name and is separated from the rest of the formula by a colon. For example: AFTER : Quantity * Price Here AFTER forces the formula to be performed whenever any event relating to fields occurs on the form -- if you enter a value in a field, if you click on or pass through a field, when you select a new record, and when the form is saved. In the example above, if the formula was attached to the calculation aa1%, the result would be displayed in aa1%'s box every time the user clicks the mouse in any field on the form. If a field name is supplied, AFTER only takes effect after an event relating to the field specified. In the example below, we'll assume the formula is attached to the calculation Tot1%: AFTER Item: Subtot1% * 1.15 Tot1% will be assigned the result of the formula `Subtot1% * 1.15' after each of these events: * the cursor passes through the Item field * the user clicks in the Item box * the value of Item changes * all the usual events that cause evaluation of the formula POST Just as there are some calculation formulas which need to be performed repeatedly -- for these you will use AFTER -- so there are others which should only be performed once, when a record is saved. With POST, you can ensure that a result is only stored in a field (posted to another file) after the other calculations in the form have been carried out. POST takes the syntax: POST [LET xxx =] expression where xxx is a field name and the expression can be another field, a calculation, or a formula which calculates a result. The expression is not evaluated until the record is stored, unless the LET part of the formula is included. If this is the case, the expression is evaluated subject to the normal rules, but the assignment of LET is not made until the record is stored. Take, for example, the formula: POST LET Cust_Balance.Customers = Cust_Balance.Customers + Order_Amount.Orders Order_Amount could represent the final figure in a series of calculations which work out the final value of an order. Clearly, we do not want the total to be stored in the Customers file until all the calculations have been performed. By preceding the formula with POST we can ensure that this condition is satisfied. However, intermediate results can be shown on the form by clicking in the calculation box to which this formula is attached. PRINTING The Printer Definition File --------------------------- The printer definition file contains information about the control codes used by the printer. Whenever you output data to the printer -- whether as a text file, as program output, a query, a report, or by printing records -- Superbase consults this file to find out which (if any) control codes it needs to send. The file is called SB.PRT and it contains three types of printing information: * Control codes for the Superbase print styles -- bold, underline and italics * A printer initialization sequence. This has the same effect as the printer option on the System menu. It allows you to define a sequence of commands which are sent to the printer before printing starts. * An unlimited series of character substititutions. This feature is primarily for users who need to print characters which are not available from the keyboard such foreign characters or certain symbols. Each of these three features is explained in more detail further on in this document in the section headed Creating a Printer Definition File. Many user, however, will not need to familiarize themeselves with these details. The SB.PRT file which is supplied with your Superbase program disk is set up for Epson printers. If you have an Epson printer or one of the many makes of printer that is Epson compatible, you can leave the SB.PRT file as it is. For makes which do not use the same control codes as Epson printers, the program disk also includes the following alternative printer definition files: EPSON.PRT (same as the SB.PRT supplied with the program disk) DIABLO.PRT ....... ....... If one of these matches your printer, you can substitute it for the existing SB.PRT file, using the Rename option on the System menu or the equivalent MS DOS command. Before doing this, you will need to rename SB.PRT as something else (such as SB.TMP). For example, if you were using a Diablo printer you would rename the file DIABLO.PRT as SB.PRT. Provided you were in the directory where the printer definition files are stored, you could do this in MS DOS with the command: Rename DIABLO.PRT SB.PRT Note 1: It is important that you store the printer definition file in a directory where Superbase can find it. This should be the directory that is current when you load Superbase. The SB.PRT file is loaded at the start of a session with Superbase and unless you select an alternative PRT file using SET PRINTER (see below), it will then take effect for the rest of the session. Although you may have already installed GEM for a specific printer, Superbase does not make use of GEM's printer drivers for draft printing (although it does for graphics printing). If the program is unable to find SB.PRT it use a default set of printer codes which are the same as the Epson codes. Note 2: The SET PRINTER command allows the user to select another printer definition file instead of SB.PRT. For more details, see the entry for SET PRINTER in the section above headed Changes to DML. Note 3: If you want to print in draft mode using the Atari laser printer with the Atari Mega ST, you must load the Diablo emulator (Diablo630) program before loading Superbase. Storing this program in the \AUTO directory of your boot disk will ensure that it is loaded automatically when you start up. Creating a Printer Definition File ---------------------------------- SB.PRT is an ASCII file so you can edit it or create a new file using the Superbase Text Editor or any word processing program. If you create a new SB.PRT with the Text Editor, you will need to load in the existing file, edit it and then save it under the same name. This way, you will ensure that it is saved as an ASCII file rather than in Superbase's text format. (It is in fact possible to create ASCII files from scratch using the Text Editor -- see the entry for this topic in the section headed Miscellaneous.) Similarly, with a word processor, you should take care that SB.PRT is saved as ASCII and not in the word processor's text format. This may mean that you have to type it in `non-document' mode, or the program may provide an option for saving documents as ASCII files. The information in the SB.PRT file is interpreted according to its line number. Thus in the first line Superbase expects to find the control codes which turn underlining on, while the codes on line 7 will be interpreted as the printer initialization sequence. The exact sequence is as follows: 1. Underline on 2. Underline off 3. Bold on 4. Bold off 5. Italic on 6. Italic off 7. Printer initialization sequence 8. Attribution off sequence 9 onwards. Character subsitution. If you wish to insert comments in the file, you can do so by entering a semicolon at the end of the line, followed by the comment. Alternatively, by placing a semicolon in the first column, you can enter a comment line on its own. If the first character is a semicolon, Superbase will ignore the line and will not take it as part of the control code sequence. In the first eight lines of the printer definition file the control codes should be entered as numeric values separated by commas. For example, the SB.PRT file for Epson printers (which is the file Superbase uses by default) looks like this: ; ; Superbase printer definition ; ; EPSON type printers ; ; Same as Superbase defaults ; 27,45,1; Underline on 27,45,0; Underline off ; 27,69; Bold on 27,70; Bold off ; 27,52; Italics on 27,53; Italics off ; 27,45,0,27,70,27,53; Initialize : Reset all modes 27,45,0,27,70,27,53; Attr off : Reset all modes ; L=35; Special for UK convert pound sign When you create your own SB.PRT file, you will have to consult your printer manual to find out which control codes are used to set the print styles. Usually, the codes will be given in two formats: as the ASCII control character ESC followed by one or two ASCII characters, and as the decimal values for these characters. (There may also be several single character controls such as SI, decimal 15, which sets condensed pitch.) The codes to set bold print on Epson printers, for example, are shown as: ESC G (as ASCII characters) and 27 70 (as decimal values) Remember to enter the control codes in the second format -- as decimal values rather than ASCII characters. The lines in the SB.PRT file from 7 onwards are optional and can be left blank. Line 7 is used to set up the printer before output in the same way as the printer initialization sequence in Printer Options on the System menu. If used, Line 8 should contain the control codes to turn off any attributes that may have been turned on previously. In the SB.PRT file listed above, Line 7 is redundant since it merely turns off the print styles and is repeated in Line 8. By editing this line you could insert quite a different set of printer commands. For instance, you could use it to set up the printer for Near Letter Quality (NLQ) printing. To do this on an Epson printer (or, at least, on some makes of Epson printer) the sequence to enter would be: 27,120,01 Lines 9 onwards must take the form: char = char1 [,char2] [,char3] [,...] where `char' is the character you want to change, and the characters to the right of the equal sign are the ones that are to be substituted for it. `char' can be either the character itself or its ASCII code; for the substitution characters the decimal values must be given. When Superbase sends data to the printer, it first checks each character in the output against the characters specified in lines 9 onwards. If it finds a match, Superbase translates the character into the substitution character(s). In most cases, this facility will be used to substitute a single character only, such as a currency symbol. But it also allows owners of daisy wheel printers to create printing characters which are made up of two characters in combination with the backspace character (ASCII 8). Suppose, for example, your daisy wheel does not offer the French character `a' (`a' circumflex) but it does include the circumflex. You can display `a' on the screen by holding down the Alt key while typing the ASCII code for this character, 131, on the numeric keypad. The letter `a' and the circumflex accent have the ASCII codes 65 and 94; to ensure that the character appears on the printer, you would enter the following as line 9: a = 65,8,94 Another application for the character subsitution facility is to use it for inserting control characters within the text of a document. An example would be: { = 27,87 Here the control codes for enlarged print on Epson printers are substituted for the curly bracket character. If you create control code sequences in this way, there are two things you should take into account. First, within Superbase the character will be treated as a printable character even though it does not appear in printed output; and it will therefore have an effect on the format of a line. For this reason, it is best to place control characters on a blank line. Second, any occurrence of this character will be translated into the substitution characters when output to the printer; so you should make sure you choose a character that is not used elsewhere. MISCELLANEOUS * In some circumstances the Update option may skip some of the records in the file it is updating. The problem occurs when the update modifies a field which also forms part of the update filter; for example, it would occur if the update fields instruction was: Salary = Salary * 1.075 and the update filter was: Salary >= L8000 The solution is to enclose the filter statement in parentheses, as in: (Salary >= L8000) If you were running this example update under program control, you would place the entire WHERE statement within parentheses: (WHERE Salary >= L8000) This solution works by disabling the automatic optimization which causes the problem. * If you try to print a line longer than the line length set in Superbase's Printer options, Superbase will output a Carriage Return followed by a Line Feed when it reaches the maximum line length. * The output format parameters BF, UL, IT enable you to set different print styles within a report or in the output from a query. If you wish to set other printing features, you can do so by using the CHR$ function to insert the appropriate printer control codes. With a report which has been generated in the Forms Editor, you will need to insert the control code sequences in the report program. In a query, you can simply enter them in the query fields line. For example, on some Epson printers, the control code 14 selects enlarged print, and the control code 20 turns it off. To output the data for one field in enlarged print, your query Fields line might look like this: Firstname, Lastname, CHR$(14);City;CHR$(20), Street * Path names. Superbase accepts path names up to 40 characters long (not including the file name). * File Names. Avoid using the characters : ? # /\ ; or the space character. When using a file name as an argument to a command such as OPEN FILE, it must always be inside quotation marks. However, a file name used to extend a field name, e.g. Name.Customers, need not be inside quotes, unless it includes non-alphanumeric characters, i.e. other than A-Z and 0-9. Superbase supplies quotes when necessary during dialog selections, but if you type a command line in directly be sure to observe this rule. * The Duplicate option on the Record menu re-initializes any constant formulas. This means you can duplicate a record which contains the constant formula SER without duplicating its serial number. Similarly, if a file uses the constant formula TODAY, creating a new record by duplicating an existing record does not reproduce the original date. * The DML LABELS examples on page 5-78 are wrong. Example 1 should not suggest that the command can extend over more than one line; example 2 requires the keyword FILE after LABELS. * GET and WAIT (1). Control characters can be returned in GET and WAIT statements. If these are saved in a file which is subsequently LISTed, they will generate the "File contains non-text characters" error. Note also that CONTROL-C, the standard interrupt key, does not stop program execution if returned in GET or WAIT. It is up to the program to detect the value and act appropriately. * GET and WAIT (2). WAIT makes the window active before it starts waiting for input, so if the window becomes inactive for any reason you cannot reactivate it. If this is a problem for your application, use GET instead; however, you will not be able to input into any other window, such as a CLI window, because GET continually reactivates the Superbase window. * The CLEAR statement must be placed last on a program line. * If you are new to GEM, you may have difficulty in locating the Superbase program icon in the GEM window. When you click on the icon for the Superbase disk (or the Superbase directory on a hard disk), GEM displays the icons for the files on that disk. But if there are many files, only some of them will be shown in the window. One solution is to scroll the Superbase program icon into view using the scroll bars at the side of the window. A much simpler method is to select the `Sort by size' option from the GEM Arrange menu. GEM will then rearrange the directory display so that icons for the largest files appear at the top, and among them will be the Superbase program file. At this point, you may like to select the `Save Desktop' option from the GEM options menu. If you do this, the next time you start up GEM, the Desktop will appear just as it was when you saved it -- with one of the windows open on the Superbase disk or directory and with the files sorted in order of size. [[ This last option is not available in Atari GEM) * The Size option in Forms Editor also works with fields and calculations but only alters the length, not the height. * You may want to convert Superbase text files (`.sbt' files) to ASCII files. The technique for doing this is: 1. Rename the `.sbt' file, giving it a different extension. E.g., rename `Merge.sbt' as `Merge.asc'. 2. Load the file into the Text Editor. Its name will not appear in the list of files presented by the Project Open dialog and you will have to type it into the dialog box (remember to include the extension name). 3. Delete the lines containing information about ruler lengths. These will be blank lines except for two figures which give the start and end points for the ruler that is attached to the following paragraph. 4. Save the file using the same name with which it was loaded. FORTHCOMING FEATURES Future releases of Superbase Professional will include the following product enhancements: * Communications * Multi-line transaction handling on forms * Improved form printing * Data conversion utility * Additional programming commands * Further performance optimization Certain features of Superbase Professional referred to in the manual have not been included in Version 2. These relate to the multi-line transaction handling capability, which requires formula syntax allowing SUM, for example, to be used in form calculations. The EDIT REPLICATE menu option in the Forms Editor will not be enabled until the full transaction handling version of Superbase is released.  , $ -99999.00 dd mmmm yyyy 20 April 1991 44 13,10 1 136 99 15;27;65;7;27;83;0 4 1;1;1;1;1;0;0;0;0;0;1;30;35;9;1;1; 99 0 1 `]. o#+d"h"(pVSk"Q#+PErSk g$ =gT g fQ`G+,`G+/Hyh8N%Pp/HyhHN%PBln3e3e3 e 3e"3e$3e&3e(3e*3$e,3 e.3e0.hj,hkHy.HyhlN9PNN pN^NuNV/.N!XJ@jp //.N PN^NuNVp. @+fN^Nup. d  N^Nup.  @-pN^NuNVp. @+fN^Nup. d  N^Nup.  @-pN^NuNVp3bL3bJ3bae@3a3]6p3a3a3a3a3dpda\e@3eD3]23ab S3aJ3ze43|e60.tR@3aR0.vR@3aT09aLHHntr//NO 3|aV09aLHHnHn`HntHnbHnd/N0O3|aBp09aR3p09aT3p29pA3pByp3aVp3bt09aT @,l3 e NJg$09aLHB/N lP29btHҀ3bt09bt @op`09btH3bt=|09bt2.@nB.H/A Abv09aLHHn////HNxO o0Hy.HnN9P0.HA @9$"PT/9:8/IN9jXU/Hn//N9O Rn`\N|A:p/p5//9aXN O p//9aXN P09]2@3]2BgN(Jg p/a,XN=@J@g H/aX09aLHHnfHnhr///NOBNX09]2@3]2HyLNXHyKNXBn0. @l H @p"@/20F@0Rn`֑#g#g#g#g#g#g#g#g#g#g#d3aN0paaaa09aLHB/NPpeX@=@bHy]8HybN PJgn9]8Jgb=|bB9eeBn0.H @]8 ;gR=@`0.H @]8BHy]8N9jXS=@dHy]8HyerN9PJ9]8g,0.dH @]8 \gHy.HyerN9P`0.dH o @]8B0.R@=@d9b :fHybN9jX=@ @o20.HJk( @b \f @bB=|`Sn`p9b/NXa=@HJk /N dXHybN9jXUgHybN!X09aT @,oA3`A3 /-@NTXJ@fp9]8/NXa=@HJk /N dXHy]8N9jXUgHy]:N!X0.H @]8 ;gR=@`0.H @]8p0.dH @]8Jg @]8/HyeeN9P9eeJgBndHyeeNXJfBN XNHyeeHybN9P0.dH @b .g @bJg 0.dR@=@d`0.dH @bBHybHydN9P ygJg #g`NByd3ObnN 0.R@=@dH @]8/HyeXN9Pa N^NuN/Bp//aP`NVHBn0.@$J@fNa JyePg"09aS29axS=@=A` 09aS29a>S=@=A09aH2.Ag3aH3aJN)09]2gp `p=@@r29at49h v69h x89hz:9hAaHnHnHnHnHyaHya|/| //|//////////|//|//NO\r/=@NX09]2@3]23Obn.gPJyag(09]2g p/N5Xp//NXP`BN5Xa b09a @3a`@.g809]2g,09a29aAf09a29aAg p/N5X.g0.@J@fnB . l @. 2.Hfj29]2gX @. rN@ @B0( Q@g6 . @.`"3a @. 3a3 a=|`=| R`n.gnBN5X=ya09aH mJ l@N`J`2`.`*`&`"`````T`j``"`````09a^Hr//aFP0.H29aH//NhP`0.HAa//aPP`0.Hr////r //NTO`~p/p///Hy`0. @oNJh"g~NvJyePgH09]6@?J@fBgBN X-@Jgg ygg 0. @m0#g-ye>0. @o.-yh"=yh&N#h"3h&JfB`0.@J@g4JgN`&09h& @ f yh"/NXBNԐX09d29h @49bJB=A29d49h A69bLC=B49dRB@=B09dR@A=@A/NX`FNV n 0W@02(WA1A0(\@1@0(\@1@0J@jBP n 0(J@jBhN/09a^HA///Hnr //NO09a^2.Afp`p=@0. HHnHnHnHnr //NOJngJngHn/. N/PJ@gHnp/N12P09a^2. @fb0.29bJA29h A=@2.49bLB49h B=A4.BS@=@0.@SA=AHnN0XA/NX0. HHnHnHnHnr //NO`2N/HnBN12PN^Nu09]2g,B/9aXN P09]2@3]2@3]2aNuBp/NXPNu09]2fFp//9aXN PJyaga,`p//NXP09]2@3]2@3]2NuBp/NXPNup//NXPNuBp/NXPNuBp/NXPNuNV gJ9eXgp@@J9eeg6Hy/"HnN9PHyerHnN9PHyeeHnN9PHyeXHnN9PHnNXJfB.Bp(/HnHy>Hy>N O. :f*p./NXa=@HJk /N dXJ.g HnN!XHyeXHnN9P`pJ.gHnHnp///NHO09]2gB/9aXN PJ9eg&09eHB/N P09eH/N pXNHyl^N'xXHypN'xXHyh(N'xXHyh8N'xXHyhHN'xX09aLHB/N P09]2gN09]2g$09a^H/NX09a^H/NX09]2g09aLH/N X09]2g BNXN/.NhXN^NuNVHJnjBnJnjBnJn gaN09a?@R@3aJog09a2.@m29a09a=A2.@m29a09aH49aHЂ4.H6.Hԃ=An0.H2.HЁ2.H29aH49aH҂4.H6.Hԃ=@n0.H2.HЁ"0.H3a3a3a3a=A`L3a3a3a3a`(09aS@3aJ@f09]2H/@@"/3]2B-@N5X09aH29aH49aH69aH////x////x/NO$Bp/aP09]2 ga,09]2H".3]2Jg p/N5X09aJ@jXBya0.H2.H4.H6.H////x////x/NO$Bp/aP09]2 gaLN^NuNVBnAHnHnHnHnHyaHyap/p //p//////////p//p/p3/NO\=@gF0. @f<=|Jg*p/NX0.HA//a0PBNXJ g p//aFP n f>JnfNN^NuNVHpA/r//-@NO -nJgp n0(X`p n0(X n1@X!y3$!y3 9eHN2$ 9eHN2$0N OSf*09]2@3]209a @gDHnHnN\P-@Jgp&/HygHygNZXO Jf-yg,`-yh",09a @fHn/.,NkP-@ n,1n 1n 1n1n!nye09a @f N `b09wr n,@HnN9jX=@0.H6 .gS=@`0.HB6 n,Hn/N9PN/nHyh p/N12PBN5X/.,NiXHyh BN12P3(bn09]2?@ @@2/ A3]2r//Hn=@N,O 09]2n3]2g p/N5XN/B`fpaH3dBgByh&09a @fT yh"#g0( H29h HҀ49bJH’3a yg2(H49h Hԁ69bLHÔ3a3d4.H#d#d#e yg0(H#e0(H#e #h"ep/HnNPJ@g0. yg1@ 0. yg1@0. yg1@0. yg1@0.HR2.H29aHN Z yg@0.HR2.H29aHN Z yg@HydBHnN,O `09aH g g f09aH29aH//Hyh N0O JgB9b09a29bJA29h A29a49bLB49h B//N΀PBg09h& @ f" yh"p(29aHJg#g0( V@29h @49bJRBB=A|2(VA49h A69bLRCC=B~4(TB@=B0(T@A=@3 a yg0(3aJyeDfHr yg(Ё3a09h 29bJA29a@3a09h 29bLA29a@3aByd yg6/Hyl^N'P#ln yg&/HybN9PHnNBXJ@g 09]2@3]209h& @ frp yg(29aHJgX09bn@3bn0.|H2.~H4.H6.H////BNPO09bn@ 3bn#h"g`. ygB"yg/) /N%O #gJg N yg1n yg1n yg1n yg1n09d yg@09d yg@09a yg@B(09h& @ g ygye ygya ygye09d yg@ya ygya09a yg@N yg1@B"09eV yg@ ylnc yg6"yln/)/N9P yg&Hyb/N9P yg&"yg#H`~09aH29aH//Hyh N0O Jgpbb09a29bJA29h A29a49bLB49h B//N΀PBg09h& @ f yh"p(29aHJg#g0( V@29h @49bJRBB=A|2(VA49h A69bLRCC=B~4(TB@=B0(T@A=@3 a yg0(3aJyeDfHr yg(Ё3a09h 29bJA29a@3a09h 29bLA29a@3aB9b yg/("HybN9P yg&/HnN9PByd=ya=ya09aU@fp/p/HnBHy>=N OSf p/HnN;"PHnN9jXS=@H6 %g6 $gp /BN P`HnHnN: PJgp/BN P`pHnHnN9PHnN9jXU=@H6  f/@R"/B609h& @ f Jgg yg&Hn/N9P3a3a09aU@fDHy;Hn@N9PHnHn@N9PHybHn@/9gNw~O =@`HybNX=|=@0.H @b  g @bJgRn`0.H @bJgR=@0.H @b/HnN9PBn0.H6 .g6JgRn`0.HB6 nf NY^09aLHHnA/Hn///N0O3a09aLHHn/NP=n=n09]2@3]209h& @ fp yg(29aHJg09bn@3bn0.|H2.~H4.H6.H////BNPO#h"g ygJ"g*""yg/)"/HN9jXR///NP ygB"`. ygB"yg/) /N%O #gJg0.29bJA29h A=@ yg1@ 09a2.֒@49bLB49h B=A4.6.HւS=C yg1C2.nSA=AJyeDg4.@=B@=A yg1n yg1n yg| yg|09a yg@B(09h& @ g ygye ygya ygye09d yg@ya ygya09a yg@N yg1@09eV yg@ yg&"yg#HJ.g2&Hn/ N9P yg6"yln/)/N9P`$ yg&Hy12/N9P ygB(6HybN9jXR=@S@fp`p2.HҀ=AH o2p//NP-@Jg yg!@"Hyb/N9P`40. @o* ygB yg"yg/ /N&P`N/nBN5X09]2?@ @@2/ A3]23 bnr//Hn=@N,O 09]2n3]2g p/N5XN/B9eg09dU@f yg&/HybN9PHy18HybN9PHybN9jX29aHN@ yg3a yg4( 3a=@HЁH”Jk3a`209aH29aHJk3a`09a29aA3a=ya09aHr yg(Ё=@=ya09]2@ =@`F09a29bJA29h A29a49bLB49h B//N΀P09h&@ @ f#h"g yg(g -|;`-|;Jggr/.Hn@N9P yg&/Hn@N9Ppbb ygJ"g/("HybN9P yg(gHybHn@/Nw~O -@<`@ yg(gHybNXH-@<`HybHn@BNw~O -@< N OSfHnN/X`x/<p/HnBHy>%N OSfRHnHyl^N'P-@Jfp/HnN P`$ n(cgp/HnN P`B/.N6hP` NǮJ@gB 9h@R/@NǮH"/g&p/p//Hy>Hy>N OSf HydHnN9Pp/p/HnBHy=N OSf pHnHydN9P/93nHydN9PHydNLXJfHydNtXJgHnHydN9P` NbNHnHydN9PN!H` p/p/HnBHy=N OSf HnHydN9P/93rHydN9PHydNLXJfHydNtXJgHnHydN9P` d/9gNfXNHnHydN9P` :/<p/HnBHy=N OSf p/p//Hy=Hy=N OSf /93nHnN9PHnN*X` /<p/HnBHy=N OSf p/p//Hy=Hy=N OSf /93rHnN9PHnN*X` ^Bn/<p /HnBHy=xN OSflRn. :f:p./NXa=@HJk /N dXHnN9jXUg$HnN!XJ@gp /HnN P` B.Jyag ``N` N+>` 09]2g6p/p//HyNN OSfN-yg nJg-h`HnN^X=@SnJno nJg-P`=|` nggNN&#gN3ObnBydN ` ygJgNN& yg#gN3ObnBydN ` ygJgtNN& yg#gN3ObnBydN `Nm Nf`.09]2 @@3]2N0`BydN(RN0` 9eHN2$qN OSfNVN `NN0`0.HFm lN``4`P`l`x`p3eBH/NXJ@fN`|p3eBH/NXJ@fdN`\p3eBH/NXJ@fDN`<3eBN`,p3eBH/NXJ@fN` NhN 3ap3b3eD3bN0`0.HMm lN`B`>`:`6`2``R`N`J`F`B`>`:`6`2`.`*0.R@@M3b3b/<NX`*0.HS @1:3b/<,NXN:pN^NuNVpAB"#aX-@-@-@-A n0( @gBe p1@1@p n0(/@29aHN@$/Ђ n1@p0(/@ 49aH/A"N@&/ Ѓ n1@p0(/@N@"/Ё n1@Jhg.p0(/@ "/N@"/ Ё n1@`p n0( g gx f . @9$/N9jXR29aHN@ n1@t4( ./ArN@ @B /r2(Ҁ n1AR-B`R . @9$/N9jXR29aHN@ n1@".1Ap0(Ѯ` . n1@Nqp n0( g f .R @9$"n#P n0( @ f .3B` `09btH/@MrN@ @B0R /r09aHN@29IВ@3IrR-A=@ . ]n"rN@ @B0(n1@R`N^NuNV-yg nJg-h`Jg nJ$gpN^Nu n-P`pN^NuNVp9e:=@=@Uf B9e:=|J9e:gN^NuN/:J@gp`p2.H=AJlnfp`p2.H=AJyePgp`p2.H=Aa:J@gp`p2.H=ANǮ @op`p2.H=A ygJfJgp `p2.H09]6@?=AJ@f N(J@gp@`p2.H09]6=Ag <`p2.H=AJyePgp`p29dH/t1//9aX=@N O 0.H/r //9aXN O ygJgp`p=@H/r)//9aXN O 0.H/r+//9aXN O 0.H/r&//9aXN O ygJgp`p=@H/r*//9aXN O 0.H/r%//9aXN O Jnfp9e92.HfN^Nu0.@=@Jnfr9e9Hg0.H/r//9aXN O 0.H/r //9aXN O 0.H/r'//9aXN O 0.H/r(//9aXN O 0.H/r1//9aXN O 0.H/r5//9aXN O 0.H/r@//9aXN O 0.H/rA//9aXN O 0.@=@Jnfr9e9Hg80.H/r//9aXN O 0.H/r7//9aXN O 0.@=@J@g$NǮJ@gp/pC//9aXN O `BpC//9aXN O Jnfp9e92.Hgn0.H/r//9aXN O 0.H/r4//9aXN O 0.H/r;//9aXN O 0.H/r//9aXN O 0.@=@Jnfr9e9HgT0.H/rB//9aXN O 0.H/r8//9aXN O 0.H/r9//9aXN O 0.@=@Jnfr9e9Hg0.H/rD//9aXN O 0.@ =@Jnfr9e9 Hg0.H/r$//9aXN O 0.@@=@Jnfr9e9@Hg0.H/r.//9aXN O 0.@D=@gp`0.H=@Jnfr9e9DHg0.H/r///9aXN O JyePgp`p=@H/r0//9aXN O 0.@=@Jnfr9e9HgBp2//9aXN O 0.@=@S@fp`p=@Jnfr9e9Hg80.H/r//9aXN O 0.H/r//9aXN O 0.@=@U@g.gp`p2.An=@Jnfr9e9Hg0.H/rF//9aXN O 0.H/rG//9aXN O 0.H/rH//9aXN O 0.H/rI//9aXN O 0.H/rJ//9aXN O 0.H/rK//9aXN O 0.e9N^NuNV09]2@@H/r3//9aXN LO 09eDH/r4//9aXN LO 09a@H/r//9aXN LO 09a@H/r://9aXN LO 09a@H/r;//9aXN LO 09a@@H/r@//9aXN LO 09a@H/rA//9aXN LO 09a@H/r9//9aXN LO 09a@H/rB//9aXN LO 09ag <`p=@@29aAH/r7//9aXN LO 0.@29aAH/r8//9aXN LO 0.@29aAH/rC//9aXN LO aN^NuNV=|S0. @]nHB//9aXN LO Rn`09bH @B0@SHr///9aXN LO =|M09btHM2.Hg 0.HB//9aXN LO Rn`09b@MS@Hr///9aXN LO 09aLH29bH Abv2H//N0PBn0. @ l29aLHH @e0HA//////NO2.H Ae2=@Afp`p=@2.H AB2ASHH///9aXN O 0.H @e0 @ fp09bS@gf09aLHA////r //NO=@ @ fp`p=@2.H AB2ASHH///9aXN O Rn`N^NuNV=|0. @!n"H2. H///9aXN O Rn`=|$0. @+n"H2. H///9aXN O Rn`=|-0. @4n"H2. H///9aXN O Rn`=|70. @Dn"H2. H///9aXN O Rn`=|F0. @Kn"H2. H///9aXN O Rn`p/p%//9aXN O p/p&//9aXN O p/p*//9aXN O p/p+//9aXN O Bp?//9aXN O N^NuNVHp/-@N5X09]2gRA/p//NO 09hH29hH49hH69h H////x /B/.N \O09]2g p/N5XLN^NuNVHpA///-@NO n-h$"n":09hH29hH49hH69h H////x /B/-HN \Op//.a \P09]2@ 3]23eFLN^NuNVHB n=P=h=h=h09]2g`HnHyhN/PJ@gJA/p//NO 0.H2.H4.H6.H////x /B/.N \OLN^NuNVHp29]2-@-@fLN^NuA/p//NO n-h$-hd09aH29aH//t /B/-HN O=@J@j pLN^Nu09]2H/@@"/3]2B-@N5X nfH09]2@3]209hH29hH49hH69h H////BNPO` nf8p/NX09hH29h H49hH69hH89h H:9h H<9hH>9hHHnHn////////NO(09h2.Af09h2.Ag09h=@09h=@0.3h n1@0.3h1@09]2@3]20.H2.H49hH69h H////BNPO09]2@ 3]2a BNX`BNXpLN^Nu nf=ybB09h 29bHAf09bD`09bH=@09h2.An0.=@09h 2.An0.=@2.3h n1A0.3h 1@09hH29hH4.H6.H////BNPO`0.H m *n0.Hr///.N1hO A////Bp//NOJyeFg20.HaHH @b  n1@ `@0.Ha n"(LHH @b  n!AL0.HB//.N1hO Bp//.N1hO `0.H ,m ;n0.Hr///.N1hO A////Bp//NO0.H/@,aB///.N1hO 0.HHn//.N3O 0.H2.H4.H6.H////x /B/.N \O`0.H m n0.Hr///.N1hO A////Bp//NO0.H/@YaB///.N1hO 0.HHn//.N3O 0.H2.H4.H6.H////x /B/.N \O`=|0.H mZ lPN```|`*`*`X```&````D``r n0(@1@0(@1@0(@1@Byd` n0( @1@0(r@1@r09d @3d` n0( @1@0(r@1@r09d @3d`| n0( @1@0(r@1@r09d @3d`L n0(@1@0(@1@0(@1@0.H/@rN@ n0( @1@ /3eVBp//.N1hO Bn`9e eHH/r//.N1hO Bn`3eFBn`p3eF=@`~ n0(f@1@0(*@1@*9aa`H n0(*f@1@*0(@1@9aa` n0(Zg@1@Z9ee` n0(Z@1@Z9ee`p/p //.N1hO A////Bp//NO n0(B@1@Ba^p//.aP n (L9aHH Ab" n!@L9aHH @b  n1@ Bp//.N1hO 09dJ@f n0(r@1@rJngJHnp //.N3O 0.H2.H4.H6.H////x ///.N \OA////Bp//NO09]6@?J@g ng ng0.H/apX09]2H".3]2Jg p/N5XpLN^NuNVHBp=@=@=@0. @lH @b-Rn`A/p/BNO n!|;}$!|;l!|;!|<!|<!|;HnHnHnHn/-HN@O0.H2.H4.H6.H////x/NPO0.H2.H4.H6.H////x /B/.N \Op//.aPp//.NXP=@HB//.N1hO 0.H mX nP0.H @b"@b 2."n")  p//.a&P=|0.H m #n 0.@=@ n(fPBn0. @l.H/@ @b"@b "/Ё Rn`p//.aP=|0.H &g 'f n'f$Bn0. @lH @b Rn` n'gJnf.0.H2.H4.H6.H////BNPO`09aS@3aN NLN^NuNV-n=|0. @lJ2.HHҀ/@pN@ n ( "/S"Ab"!@ Rn`0.HB//.N1hO N^NuNVH09]6g-ygJg n(g0. H m *nyaya`\0. H ,m ;n nya`80. H g f nya` n f nye n-P`Z09]6g-ygJg n(g0. H m *nyaya`0. H ,m ;n nya``0. H g f nya`< n f nye`&0. H m n0. HY n@ n-P`009]6g-ygJg n(g0. H m *nyaya`0. H ,m ;n nya``0. H g f nya`< n f nye`&0. H m n0. HY n@ n-P`009]6g6-ygJg( n(g n fye n-P`09]6g-ygJg n(g0. H m *nyaya`0. H g f nya` n f nye`t0. H g g n g n f09d n@09aLHr( Abv2H//N0P09aLHr n( Ae2HA//////NO09aLHr n(//NP09aLHHn n/( /NO 0.S@ n1@0.2(AS@=@29d@n2.3d`h0. H oX f09b n@ n, f09b n@09aLHr n( Abv2H//N0P09aLHr n( Ae2HA//////NO09aLHr n(//NP09aLHHnA/Hn///N0O0. n@09aLHHn/( /NO 0.S@ n1@2.HSA0(=@2(Ht(=A4(@=Bp(HЁ=@HnNڶX n-P`09]6g6 yg-hJg" n(g0. H m *nyaya`"0. H g f nya n f n(@9e@`0. H g g n g n f09d n@`\0. H m n09eV n@ `6 n f.9eg n(@` n(@ n-P`09]6@?J@g|3Obn09d29h @49bJB49d69h B89bLD89dVD@09dV@B3d=AH=CH=DH=@H////BNPOLN^NuNVBnpA///-@NO -np09h&r0kfN ```v`P`*`-yh"p n(=@`-yh"p n(=@`x-yh"p n(=@`Z-yh"p n(=@`<-yh"p n(=@`-yh"p n(=@NqJng=| n0(Z@1@Zn1@Z09]2gBp //.N1hO N^NuNVpA///-@NO np"n) 29eVH-Hgv2(A1A2(A1A2(A1ArN@ n0( @1@ 09]2gBp//.N1hO n( @3eV9ee n7 n(g9ee n709]2g$9eHH/r//.N1hO N^NuNV/. /.aJP-@Jfp/BN P .N^NuNV/. /.aP-@JfBaX .N^NuNV/.NBpX-@JfN^NuJ gB/./.NO .ѹKjJ gB//.NO .N^NuNV nJg2/NCXJgA09a @g2(& "g(HyKHnN9P n6/HnN9P09a @gp0. r2.4( 69bpCH8( :9brEH<(CH6(EH//////apOS@f .LpN^Nu n-h`zpLpN^NuNVH3h&-ygJgp n(#e>p0. r2.4( 69bpCH8( :9br?D EH<(CH6/ EH//////aOS@f .LpN^Nup0. r2. n4( 69bpCH8(:9br?D EH<(CH6/ EH//////a^OS@f .LpN^Nup0. r2. n4( 69bp?BCH8( :9brEHp0. r2.4( H6( H8(H:(H//////aOS@f .L0N^Nu n-h`pL0N^NuNVH 3h&-ygJgjp n(#e>p0. r2.4( H6( H8(H:(H//////apOS@f .L0N^Nu n-h`pL0N^NuNVH3h&-ygJgp n(#e>p0. r2.4(H6(Hx(/CH8(H؂Hz(,/چH//////aOS@f .LpN^Nu n-h`tpLpN^NuNVH 3 h& yg-h Jghp n(#e>p0. r2.4( H6(H8(H:(H//////a*OS@f .L0N^Nu n-h`pL0N^NuNV0. H2.Hm 2.Hn0.nm nnpN^NupN^NuNV9aHB9a29aLHt//=@NhP09aLHr//NhPJgN4\09aLH/</NPHyh p/N12PBN5X09aLHr//NPPp09h&r0kffN```D` `` yh"0(=@2(Ht(=A4(@=Bp(HЁ=@Jf A/aXA/N*X yh"(@09]6@3]6`Jf yh" /aX yh" /N*X yh"(@09]6@ 3]6`Jf yh" /aVX yh" /N*X yh"(@09]6@3]6`JJf yh" /aX yh" /NX yh"(@09]6@3]6`Jf yh" /aX yh" /N*X yh"(@09]6@3]6`Jf yh" /aTX yh" /N*X yh"(@09]6@3]6`HJyePg@Jh"g8 yh"|*/-HNJX-@Jg @|*3bnN 09]2g p/N5XHyh BN12P0.aN^NuNVHBybn09]6g<-yg3h&Jg n(@-P`09bn@O3bn09]6g<-yg3h&Jg n(@-P`09bn@;3bn09]6g<-yg3h&Jg n(@-P`09bn@93bn09]6g<-yg3h&Jg n(@-P`09bn@83bn09]6g<-yg3h&Jg n(@-P`09bn@O3bn09]6g@ yg-h3 h&Jg n(@-P`09bn@O3bn09]6@3]6JyePg6N(J@g,-yh(Jg nB(*-P`3ObnN `x09dHJkl29h HҀ49bJH’=A49d69h B89bLD=C89dHR=D09dR@B=@HHHH////BNPO3dLN^NuNV09dJ@j$ n3d3d3d3d`|09d n2Ao n03d09d n2(Ao n0(3d09d n2(An n0(3d09d n2(An n0(3dN^NuNV-ygJg2 n(g @` n(@ n-P`-ygJg2 n(g @` n(@ n-P`-ygJg2 n(g @` n(@ n-P`-ygJg2 n(g @` n(@ n-P`-ygJg2 n(g @` n(@ n-P` yg-hJg2 n(g @` n(@ n-P`N^NuNVHBybnp09h&r0k@fN ````j`6`-yh" n(@09bn@O3bn`-yh" n(@09bn@;3bn`-yh" n(@09bn@93bn`-yh" n(@09bn@83bn`-yh" n(@09bn@O3bn`X-yh" n(@09bn@O3bn`.09ePH"9h"Jg AB(*09bn@O3bn-A09dH gt29h HҀ49bJH’=A49d69h B89bLD=C89dHR=D09dR@B=@3dHHHH////BNPOLN^NuNVp=@=@N09a29bJA29h A n1@0=@=@09a29bLA29h A1@1@=@=@JyePgHnN XJg0.2.A=@N4\HnHnA//NO0.@H=@BN5XHyh p/N12P09]2g p/N5XHna*XAaC/ / / HnHyaHyap/p//p//////////p///p2/NO\=@fB09aH29aH//Hyh N0O Jg.gp`p=@J@gBn0.nJ@g809a29bJA29h AR@ n2A29a49bLB49h BRA4(B=@=AJyePg0.ڰAo0.=@0.nf 0.ng09]2g p/N5X=n=nJnf JyeDgJng$09a2.@l=@09a2.@l=@09aH/@rN Z2.HҀ09aH/@=ArN Z2.HҀ0.H=A"/N Z"/N@2.H=@ "/N Z"/N@=@ n0H2.HЁS2(Hf$0(H2.HЁS2(Hf .gN4\HnaX.gN3xHyh p/N12PN n0nS@1@=@2(nSA1A=A0=@=h2.@l =@=A=@0.2.Al =A=@=AN4\HnaHX`A////Bp//NOHnaX n0(2Af0(2(AfpN^NuHyh BN12P n01n1n1npN^NuNVp=@=@NN4\09a29bJA29h A n1@009a29bLA29h A1@1@HnHnA//NO0.@H=@BN5XHyh p/N12P09]2g p/N5X/.aXAaC/ / / HnHyaHyap/p//p//////////p///p2/NO\=@fB09aH29aH//Hyh N0O Jg.gp`p=@J@gBn0.nJ@g09a29bJA29h A29a49bLB49h B=@=Anfng09]2g p/N5X0.2.=@=AJyeDgx49aH rN Z2.HҀ09aH/@=ArN Z2.HҀ0.H=A"N Z"N@2.H=@ "/N Z"/N@=@0.HS n2(Hf0.HS2(Hf .g809]2g p/N5XN4\N//.aX.gN3xHyh p/N12P0.S@ n1@0.S@1@N4\/.apXN/.gN`A////Bp//NO/.a.X n0(2Af0(2(AfpN^NuHyh BN12P n0(H2HJjD` n0(H2H n2(H4(H’/@JjD` n0(H2(H" /o" n1h0=@2(Ao,01n`" n1P0(=@2(Ao 1A1n n02(Ao n0(29h A29bJA n1@02(An n0(29h A29bJA n1@ 0(2(Ao n0(29h A29bLA n1@ 0(2(An n0(29h A29bLA n1@pN^NuNVH p=@=@9aHB9a n4(RB1B=@=A&NNY^09aLHHnHnHnA///N0O0.3aJyeDg09a29aA3a09aLHHnHyN/NO 0. n1@ Hyb=@N9jX=@=ya29a49aؒB=A=n9b=@Jf=|` n=h0.=@29a49bJB49h B n1A009a49bLB49h B1@ 4.B6( 89aؖD1C8:.ESD1D8(BSD1D49]2?BB@8/D3]2B=@=A=A=B=CN5XHyh p/N12PN4\/.a X0.H2.H4.H/v///aPOAaC/ Hn/ / / / p/p //p//////////p///p!/NO\=@.fAaHnHnHnHnHyaHyap/p //p//////////p///p3/NO\=@gBN XJf0.@J@g.g0.@ @ f`0.H2.H4.H/v///a8O0.HHnHn/aO 29aLHHnHyb/=@NO 9bJf=|.gN3x n029bJA29h A=@0(29bLA29h A=@Hyh p/N12P n0(H2( H4.H/Hyb//aON4\/.a XN/0.H2.HgԲlR09bn@3bn0.H2.H4.BH6.H////BNPO09bn@3bn`N4\/.aXHyh p/N12P n0H2.HЁSJnp n1@0.=@2(H4( HH/Hyb//a ON4\/.a"XHyh p/N12P0.J@f n=P`H0.H/HybHn(N9O 09aLHHnHn(/NO n02.A=@0.H2.H4.H/v///aO=nN/`0.H2.H4.H/v///aO0.H2.H4.H6.H////BNPO09]2n3]2g p/N5XHyh BN12P09bJ29h ?@A49a@3a09bL69h ?@C89a@3a09aH49aH/@?A "N Z"N@"/ /3a29aH49aH /@"N Z"N@"/ /3a2/ 4/B49aA3a0/@09aC3a0.&a.gp`p3d0.S@fBn0.L0N^NuNVNNY^09aLHHnA/Hn///N0O0.3aJyeDg09a29aA3a09aLHHn/NP0.=n29a49bJB49h B n029a49aؒB49bLB49h B1A@SA1AHyb=@NDXJ@g\ yln Hyb/N'P-@Jg: @($@3dr3d09d2. n0HЁS1@pN^NupN^NuNV09h 2. @09bJ@=A09h 4.@09bL@=BnSA=AnSB=B09aLHr//NP09aLHB/N8P09aLHr//NPPN/09aLHHn/NPN/N^NuNVH9aH n2H49bJH’=@ 9eH/AN2/@ //AN&/(//B$&N8:9h H/@ /A$N*/ ,/$/@(/A,$&NN=@=@=@0(H29bLH/@8 9eL/A4N2/@< /8/A@N$/<&/@N8:9h H/@D /AHN*/D,/H/@L/AP$&NN=@=@=@0(H"/N$/&N8$/(&/,NN=@=@0(H"/4N$/<&/@N8$/L&/PNN=@=@J9e:gB9aN/9aYg09aLHHnr//NO 9aHHm0 l&N``` `J`9aH=@Jngp/HnaP09aLHHnr//NO Sn`09aLHr//NP09aLHHnr//NO p/HnaP09aLH/09bS@f409aL29aNAf$H2. H4.H/.///NO`609aLH2. H4.H6.Hx////.///N OLN^NuNVB n 0=@H n=P-@0. HJf0. H=@ =|HrXkfN ` `PK4`*M`K`R`G``a``J`0.2.@g=@0.nnH @bR"@bRn`Sn`~SnSnJnjp=@Jnj=@0.2.@gR=@0.nnBH @bR"@bRn`p=@=@`Bn`=n`SnlBn`Rn0.H2.HoS=@`=|JnoSnlBnSn`Bn=|JnoRn0.H2.HoS=@Sn`p-@`|0. @=@ @ mj ngb0.2.@l8-|=@0.nm"H/@R @b"obSn`0.H @b2. RRn=@AaC/ Hn / / / / p/p//p//////////p///p!/NO\=@.fZ0.H @bB n 0 n0 .N^NuNVBJgfN^Nup/HyNNPS@gN^Nu=|Ap//NPS@gN^NuNǮ=@ 9h@=@N=@JyePgp`p=@A0.H//NPS@gN^NuBHnN¨XJgV n/(HnN9Pp /HnNPS@gN^Nup)/ n/(\NPS@gN^NuHnN¨X`-yh8Jg n r//NPS@gN^Nu n r //NPS@gN^Nu n% r//NPS@gN^Nu n5 r //NPS@gN^Nu n-P`n-yg nJg-h`JgJf/.a4X n-P`Jf09]2@3]2JyePgNN^NuNV ngfN&p/HyNNPS@gpN^NupT=@Ar//-@NPS@gpN^Nu .,/./NPS@gpN^Nup//.a0PJgpN^Nu nJfJf09]2@3]2pN^NuNV ngfN&J k:p/HyNNPS@gpN^NuAdp//NPS@gpN^Nu-yh(p -@JgJ k nJ(*gp/HyONPS@gpN^Nu . /./NPS@gpN^NuJ obHn/.NPHnNX0.H n2( 49aDH//<'/NO nB/Hyh(N&P n-P`6 n-hp-@Jg n-PJ k (gfp/HyONPS@gpN^Nu . /./NPS@gpN^NuJ o" n"nf#P np//aRP-n`r n-h p-@Jg n-PJ k (gfp/HyO NPS@gpN^Nu . /./NPS@gpN^NuJ o" n"n f#P np//aP-n`r n-hp-@Jg n-PJ k (gfp/HyONPS@gpN^Nu . /./NPS@gpN^NuJ o" n"nf#P np//aP-n`r n-hp-@Jgr n-PJ k (gNB/.NlPp/HyONPS@gpN^Nu . /./NPS@gpN^Nu n0(H2( HrN Z-@ n2(HR4( H’N@r n(-@N@ n-h-@ . u0o.u0/<u0/.NPS@gpN^Nuu0`/./.NPS@gpN^Nup//.NlPJ o. n"nf#P/.N\RX np&//aP-n` n-hJg n-PJ k (gp/HyONPS@gpN^Nup n( -@Ap//NPS@gpN^Nu ././NPS@gpN^NuJ o. n"nf#P np(R//aP-n`. n-hp4-@Jg8"n Q -@J k )gp/HyONPS@gpN^Nu nJ"g h"R n@! n(@/A" /./@NPS@gpN^Nu n(.@J"g& h"Rp"n)!//NPS@gpN^NuJ oV nBJ"g0""n/)"/HN9jXR///NP nB" n"n/ /N&P-n`J o,09]6gNfNNVBy]63dpN^NuNVH BBnN&Ap//N&PS@gL0N^Nu FEDFfAp//N&PS@gL0N^NuA0.H//N&PS@gL0N^Nu0.g$3ap3b3eD3bN0Bn0.2.Alp /HnN&PS@gL0N^Nup)/HnN&PS@gL0N^NuHnHnN9PHnN/XJfNN(L0N^NuJlng ylnc0.R@=@`fBn0.2.AlB/9hN@Nݬ4.H/@ /@/Ar>N@/@ /N2/@$ / /A(N/@, /$/A0"/($/,&/0N(N-@ / dlBf /g0 n-hJg n0( H/@ .N2/@ //AN$/ &/N8N1@ 0( H/@ .N2/@ //AN(/*/$&N8N1@ 0(HN$/ &/N8N1@0(HN$&N8N1@-P`* n-h Jg n0( H/@ .N2/@ //AN$/ &/N8N1@ 0( H/@ .N2/@ //AN(/*/$&N8N1@ 0(HN$/ &/N8N1@0(HN$&N8N1@-P`* n-hJg n0( H/@ .N2/@ //AN$/ &/N8N1@ 0( H/@ .N2/@ //AN(/*/$&N8N1@ 0(HN$/ &/N8N1@0(HN$&N8N1@-P`* n-hJg n0(H2( H4(6( C=@ ./A N2/@ / /AN(/*/=B$&N8N1@ 2( H ./AN2/@ //AN$/ &/N8N1@ 2( n1A0( n1@-P`< n-hJg n0(H/@ .N2/@ //AN$/ &/N8N1@0(Hr(1@H/@ .N2/@ //AN$/ &/N8N1@09aLHr("Abv2H//N0Pp n( @e0=@ @ f n(SgRn09aLH2.HA//////NO09aLHr n(//NP09aLHHnHnHnA///N0O0. n@09aLHHn/( /NO 0.S@ n1@0.HS@0(Hr(Ё1@-P`J n-hJg n0( H/@ .N2/@ //AN$/ &/N8N1@ 2(H ./AN2/@ //AN$/ &/N8N1@29aHt( N@ n2( HҀS1A09aHr(N@ n2(HҀS1A09aHS@-P` n1yal1yanL0N^NuNV"n#H"#H#n N^NuNV n-P"n Q-Hg/. /(N:PJkNqJf n-h` n-h/. /./.a>O N^NuNV/./. /.a"O -@JgN^Nup/N XpN^NuNVp/ n/( NBP-@JfN^NuJg\/.N9jX-@RB/NBP n!@Jf"n/) HnNP .N^Nu/. n/(N9P` nB/. /./.a O .N^NuNV n"n #Hg" ` n"n " n Jg"P#H` n!n  nRN^NuNVJ f . N^Nu n -P//.aNP n Jg&P"n /)/HN9jXR///NP n/( Hn NP .N^NuNV n Jg h"n ` n "n" n Jg P"n !i` n "n#h nSN^NuNV nJg n//a&PJfN^NuNV nJgR"n QB-Q nJ"g(""n/)"/HN9jXR///NP n//aPJfN^NuNV/. n/aPN^NuNVJg0 nJg/. /(N:PJf .N^Nu n-P`pN^NuNV09eD @3eDJ@g09]6@?J@fN^NuN&09]6g6 yg-hJg$ n(g /aX n-P`09]6g6 yg-hJg$ n(g /aX n-P`09]6g6 yg-h Jg$ n(g /alX n-P`09]6g yg-hJg n(g0(H29aH/@/AN Z"/N@"/ / n1@0(Hr(1@H49aH/@/A"N Z"N@"/ / n1@H"/Ё1@ n-P`P09]6g4 yg-hJg" n(g /a^X n-P`09]6g4 yg-hJg" n(g /aX n-P`3ObnN N^NuNV n0H29aH/@/AN Z"/N@"/ n0(H49aH/@=A"N Z"N@"/0.H$/ n00(A1@0(n1@0(A1@N^NuNVHA/p/BNO -n n-hT!|:$!|:C!ICo!ItCQ!IC3!I!|<Hy:HnoN9PHy:HnQN9PHy:Hn3N9PHy:HnN9PHnN:XRfB.HnN9jXA-H n \gS`R/.N9jXJf AB.-H/.HnN9PB.a=@H/HnN8PHnHnoN9PN:/Hn-@N9PHnHnQN9PND./Hn-@N9PHnHn3N9PHyO*/9lnHnNSO -@Bp //.HnHnHnp /NPO .r//./NP2O HnHnHnHn/.N@O09]2?@@@2/A3]2B=@N5X0.H2.H4.H6.H////x/NPO0.H2.H4.H6.H////x /B/.N \Op//.NXP=@HB//.N1hO 0.H m lvN```Nq0.Hr //.HnHnHn/NPO .r//./NP2O Bp //.N1hO Bp//.N1hO Nq nfBHnN'xX0.H2.H4.H6.H////BNPO09]2n3]2g p/N5XLN^NuNV-yg nJg-h`BnJgRn n-P`0.N^NuaS@gpNuN&JyePgpNu ygJgpNu ygJ gpNu ygJgpNu ygJgpNu ygJgpNu ygJgpNupNuNV/.HnN9PHnHnaPHnHyl^N'P#lnJgpN^NuHn/9lbHyl^N%O Br)/-@NP n!@\Hn/N9P n p(//N%P n#ln/aXJgpN^NupN^NuNV n/(\HnN9P n/(HnN9PHy3HnN9PHnaXJfB/.aPpN^Nu/<6Hna6P=@J@gJ.gUn0.HA >f&/<HnaPJgd0.SnHAB0.HA >f"/<HnaPJg*0.HABHn/.a&PJfZaXpN^NuaNJfpN^NupN^NuNV/<Hn Hyfa\O p/HyfN;"P n Hyf"n/)/N%O -@JfpN^Nu n!n /<Hn HyfaO #fgBnB-@ . l< @4"P/ -IN9jX2.Hn/.N9jX"=AR`Yn ygJg fRg`B . ld @Otp///9gN;fO Jf:Tg . @O"n2)H3A @O FH€3A`R`Rg`h/<Hn HyfaO r/Hyf-@N;"P n0(?@@J@g 0/@1@ n0(H-@m lN`d``t``l`h`d`HyfN9jXr(/Hyf/@a2PH"/Ҁpe/Hyf/AaPH"/Ҁ nA$pz/HyfaPJ@g n($S@$p,/HyfaPJ@gHyfaX=@ @l n($S@$`WnWno n($R@$`HyfN9jX n@$pm/HyfabP @ofp n($2.HЁ@$`NHyfN9jXr./Hyf/@a"PH"/Ҁ nA$`HyfN^X n@$NqpN^NuNVH|/9O,NX. gR f nBR LN^Nu mR  op/BN PpLN^Nu  nR` nBpLN^NuNVHyP@/.NP#O,Jfp//.N PpN^NupN^NuJO,g$/9O,NXRfp/BN PpNuBO,pNuNVB"n QpJg( ;g .l "nR n RR` nB"n Q ;fR .N^NuNV nJ\g\p)//NP"n i -Hg // N&P` n/(HyhHN'P-@Jg/HyhHN&P/.Hyl^N&P-@Jf-yl^ ylnf#lnN^NuJlngB/9lna@P`NuNVB-yl^ n g n /./N'P-@Jf"n Q-Hf .N^NuNV-n p n/NXJgR` n.R nJg n"Rp//. /.N9O Ѯ nJg n"R nB N^NuNVBn nJg.fRnR`0.N^NuNVBn nJg6p 9g 0g *g xfRn n .gR`0.N^NuNV/.N9jXS=@0.HJk( n \g0.H n :gSn`0.HR n//. N9Pp n @0.HR"nBN^NuNV nJfpN^NuHyPDBHyrNSO p"//.N8P=@gp /BN P`HnD/.aPHnHnDa,PJf/.HnaP njp(//.N8Pr)//.=@N8P=@nfHyrN'xXpN^Nu0.nop/BN P`p/BN PHyrN'xXpN^NuNVH p-@-@-@ nJg^ "f"n RR Jfn`Jg n"n RR ` n fR` n 'f p-@-@`p n @+g. n"n RR p n @+f`J~ l(n " AT*Pp/NRXrRf`RJfp @+Jf _f lp n R n R "R-@ f-@-@-L`R`fp n"@+Jf"n RR ` n"n RR p n @+Jf _g n .f"n RR n "f8 n"n RR n "f n RR `R nJf`H n"n RR p n @+Jf` n f"n RR n` n B .L0N^NuNVH *n(n p-L-@-@Jg "fRRJfn`JgRR` fRR LRRr-A f p-@-@` . vm8 yn0Jg 'gz :gr f - ^g`RR` . LmJ Nn@RRRRRRRR`$ 'fp-@-@` fR` :f RR`p @+g.RRp @+f efRR`~p @+JgpL-@p @+Jf g _f RR oNqp $g %fpN-@ RR6x fS`B6x op/HnN PpL0N^NuJgR LR . NfJHnHyrN'P-@Jfp/HnN PpL0N^Nu~ lxRR` .fpR-@ "fRR~xJgVp @+JfJf`8 "fR`,R mB6xp/HnN PpL0N^NuR`B6xHnHyl^N'P-@Jfp/HnN PpL0N^Nu n Hn/N'P-@|M`< yln-Hfp/BN PpL0N^NuBHnN70P-@Jfp/HnN PpL0N^Nu~ lTxRR`RR`@BpL0N^NuNVH *n p-@-M nJg f"Rp nS"@T(Q NfNB.. dr.R nR.`Jg np//(/ N9O B`p n Lg Mf\ nPRHnaXr/ @/(/ -@N9O .Mf"n i /(/ N7P*@SB`hJWDHHRJg RRJgR` n g4 R`, nRp n g :fp`p-@R o nB(p/BN P <L0N^NuB L0N^NuNVH*n~ l URxR` .L N^NuNVH .^-@JrfAr#rr#rB*yr&MX^fxR . oh.<?/N"X(@f pL8N^Nu MX"g *Y*L M"(A*(r#X^"f*K-fX&M (@,f*` L" "M $ . .e(c * @ #r MX L8N^Nu *@`NVH nY*H-f pL N^Nu#rpL N^NuNV-|s nJg n-P` .P/N"X-@JfN^Nu n!nB"n"P N^NuNVp/N"X-|r-@ n -@(f"Ѯ-n nrf .N^NuNVHpA/r//-@NO -n n-h<09ePg !|;\` n!|;\ n!|<!|<!|< n!n1|-ylnHy;HnN9P n/(HnN9PA"n#HtHyXb/.HnNSO -@B n/(HyhH-@N'P-@JgBJg, n "n/)/N:PJg n-PR`Jf B-n-np //.HnHnHnp/NPO .r//./NP2O HnHnHnHn/.N@O09]2?@@@2/A3]2B=@N5X0.H2.H4.H6.H////x/NPO0.H2.H4.H6.H////x /B/.N \Op//.NXP=@@n2.HB//.=@N1hO 0.H n mBp//.N1hO 0.Hm lN```````````` ````x`t``l`HnN'xX"n Q-Hʱf-yl^Hy;HnN9P n/(HnN9PHnp//.N3O 0.H2.H4.H6.H////x/B/.N \OHyXd/.HnNSO -@ nB-@JfX0.H2.H4.H6.H////BNPO09]2n3]2g p/N5XpLN^NuB n/(HyhHN'P-@JgBJg, n "n/)/N:PJg n-PR`Jf B-n-n`d nBBp//.N1hO `0.HUrN@ n"Pp// /.N9O Jngf nJg=|`|0.Hr //.HnHnHn/NPO .r//./NP2O Bp //.N1hO Bp//.N1hO Bp//.N1hO Nq0.H g f0.H2.H4.H6.H////BNPO09]2n3]2g p/N5X nJg nfp`p=@J@g#ln n/(HyhHN'P-@Jf> n/(/9hHHyhHN%O -@JfHnN'xX0.LN^Nu n "n/)/N9PHnN'xX0.LN^NuNVHBJyePgB9epLN^NuA/p /BNO n!|:$!|; l!|:!|<!|<HnHnHnHn/-HN@O0.H2.H4.H6.H////x/NPO0.H2.H4.H6.H////x /B/.N \Op//.NXP=@H g_f0.HB//.N1hO 0.H g> fj9e eHH=@H/r//.N2O `49e eHH=@H/r//.N2O 0.H g_f40.H2.H4.H6.H////BNPO nfp`p=@LN^NuNVN&Jg Ad0. H2.H///aO -ygJgjJg. n(g 0. H2.H///aO `, n(g 0. H2.H///a`O n-P`-ygJgjJg. n(g 0. H2.H///aO `, n(g 0. H2.H///aO n-P`-ygJgjJg. n(g 0. H2.H///aO `, n(g 0. H2.H///apO n-P`-ygJgjJg. n(g 0. H2.H///a&O `, n(g 0. H2.H///aO n-P`-ygJg^Jg( n(g0(n 1@0(n1@`& n(g0(n 1@0(n1@ n-P` yg-hJgfJg, n(g 0. H2.H///a>O `* n(g 0. H2.H///aO n-P`N^NuNV n02.A00(A1@0(2.A1@0(A1@N^NuNVB .lDJ grN@".Ҁ n "A"-P ` .rN@".Ҁ A a\R`N^NuNV n nh0.H/@RrN@".Ё$//@ rN@".Ё @"o20.HRrN@".Ҁ ABP`Z0.H/@RrN@".Ё$//@ rN@".Ҁ A0 n "(N Z o00.HRrN@".Ҁ A0 @l00.H/@rN@".Ё$/R/@ rN@".Ҁ o0H A4HB"/-@ . dN```4`JHnHnHnHnNO0.R@HHnHn//.NO0.2.Ao4Bn nl n ^ n l"n Q" nRRn`Bn nl nJg"n Q" nSRn`0.H/@RHr/////.N;O n "(_-@N@"<N Z-@ n ".o"n Q" nR` n ".lL"n Q" nS` nJg2"n Q" nS` n ^ n l"n Q" nR n "<N@ n "(_N Z2.HR-@pN@".Ҁ ./A".N@"<N Z o0N^NuNVp //.N%Pp nr0k*fNg`d`Na`f`i`2.`|*p/.Hn-@-@N9P n( *f( *fB.p-@`/.N9jX-@HyXf n/(/N%O JgN ".H/Hn-@N"RPJ@fbJg n(g^ n/N9jX-@Sf n( .g2 n/./HnN9O Hn/.N% PJgN"nJ@g n//N&P` n -h Jg n0(g/("n/)/ N%O Jg n-P` n -h Jgn n0(@J@f/("n/)/ N%O JgJ n-P`-yg nJg-h`Jg n-hJg6 n(g/("n/)/ N%O Jg n-P` n-P`-yl^ J g n /("n/)/ N%O Jg n -P `HnHnp/NղO -@ n0(Y@f`/HnN9PHyXgHnN9P n/HnN9PHn n/(/N%O Jg n-P` n N^Nu/.N'xXp n!@ N^Nu09aLHr//NPP09aLH9aHH A/2r///NO 09aLH9aHH A/22H//NP09aLHr//NP09aLH9aHH Ab"H//N8P09aLHr//NhP09aLH9aHH Ab"H//NhPNu09aLHr//NPP09aLH9aHH Apr///NO 09aLH9aHH Ap2H//NP09aLHr//NP09aLH9aHH Ab"H//N8P09aLHr//NhP09aLH9aHH Ab"H//NhPNuNV09aLHr//NPP09aLH29bH Abv2H//N0P09bH @e0=@ @ f 09bS@f09aL29aNAgRn09aLH2.HA//////NO09aLH9aHH Ab"H//N`P09aLH29dH//NPN^NuNVH nJfH .r//NP n Jf pLN^Nu"n Q"n " "n QB`R"n Q .r///H NP o Jf pLN^Nu"n Q"P#H"n Q"P$n $BpLN^NuNVJg n-Pp/HnNP-n`ڑ#g#gN^NuNVJg n-Pp/HnNP-n`ڑ#g#gN^NuNVJg n-Pp/HnNP-n`ڑ#g#gN^NuNVJg0 n-Pp(R/Hn-@NP-n`ʑ#g#gN^NuNVJg* n-P/N\RXp&/HnNP-n`Б#g#gN^NuNV nJg( (/NCXJgp /BN P nBN^NuNV nJgHyXr/N9PB/</.NO #w4Rfp/BN PpN^Nup#w|#wa/9w4-@N(XJg/.BN PpN^Nu3w<w2p//. /9XjaO #XjN^NuNV09w29wr29wnH-@N@/-@NBpX#XjJfpN^Nu#Xjw809wl@@3w<3wnw>H3w@AwLBp//NO 3pwX3wrwD#s"wt3wpN^NuNVAw`p///9w4NO 09wd @nJ@g 09wl @opN^Nu09wdS@fp`p3wpJ@gp`09pH3wr09wlH/@^rN Z3w /rN Z3wa-@JgN^Nu09w29pB/Hy]8NO ywtBywp09w///9w4#wxNO 3wByw09w=@=AвBm.29w2Am$0AS@1@0(29w>AS@1@ .N^Nu0.H29w>Ho n 0(HЁS1@09w<2.Ҳ@o n 029w2AS@1@ n 0(R@2A2(RA4(Bt=B=B=B=B=@S@=@=@=ASA=A=A0.@@=@=nH=@3wB=B09wrS@f09p`09wr=@2.H4.H N@2.HN@/-@NBpX-@Jf8p/BN PJng/.NCXJgp /BN PpN^Nu-n09wrS@f209aLHAw8CHyXn/ /Hnr//NO`*09aLHAw8C/ /Hnr//NO/.NCXJgp /BN PpN^Nu3wr .N^NuNVH n0( 29h @49bJB=A4( 69h B89bLD=C8(RD@=D0(R@B=@#w8DD3w<3w>BywBHĉ3w@(@3wD 9eL=AN2=C$BywBH3w@(@3wD3wr3w2B/. /=AaO -@Jf$ n"n 2 3h 3h3h-h n N^NuNV n0(R@2( A2(RA4( B#w8=@@@3w<3w>H3w@(@3wD3wB09aLHAw8///=ANPO N^NuNVN&09dS@f, 9dH"9eHt///NMO N `@Jydg6 9dr0kfN ``*``.``09dU@f0 ygαgf ygB ygp//N.P`09dY@f-ye 9d@ n1@ 9e@1@ 9e@1@ 9e @1@`J09dU@f0 ygֱgf ygB ygp//N.P`09dY@f-ye 9d@ n1@ 9e@1@ 9e@1@ 9e @1@`09dU@f0 ygƱgf ygB ygp//N.P`09dY@fv-ye 9d@ n1@ 9e@1@ 9e@1@ 9e @1@`.09dU@f> yggf ygB/9gN\RX ygp&//N.P`09dY@fN`09dU@f< yggf ygB ygp(R//N.P`09dY@f~N`t09dU@f yg-h nBJ"g0""n/)"/HN9jXR///NP nB" yg"n/ /N&P9eg yggf ygB ygp(R//N.P`09dY@f#eg 9d@ yg1@ "9eA yg1A 9e@ yg1@"9e A yg1A0(HR4( H49aH"N Z yg@0(HR2(H29aHN Z yg@NN BydN^NuNV09a2.0. HЁ=@2.SA=AR@=@09a@RA=A09aLHr//NP09aLHr//N8P09aLHr//NPPN/09aLHHn/NPN/09aLHr//NPPN^NuNVHBBn n =P n$=P n(=P n,=P0.HHnHn//.NO09a2.=n0. H=AJf0. H=|=@ HrPkfN `T `K4`M``K`0R`G```X`0.H2.HЁ2.Hg.=@0.nnH n R"n Rn`Sn`Bn`SnSnJnjSnp=@Jnj=@JnjBn0.H2.HЁ2.Hg=@0.nnH n R"n Rn`p=@=@=@`^p=@=@`P0.nl=@`>0.S@2.@=@=A`&SnlSnp=@Jnj=@`Bn`Rn0.H2.HҀ4.H²oS=@0.H2.HfRnS=@`Bn`Bn=|JnoSnlSnp=@Jnj=@`=|Sn`Bn=|JnojRn0.H2.HҀ4.H²oS=@0.H2.HfRnS=|=@Sn`0.H2.H4.H///a8O p-@`n n m0.H2.HЁ2.HlNR0.HgB=n0.H2.HЁ2.Hm$0.H/@R n /"n Sn`0.HR2.Hgj4.H6.H/B ԃ n 4. R=CH4.H=@f / րgSnRn0.H2.HЁ4.H°fSSn=A`BnJf0.H n BJng". 4.H҂ n PoP`0.H$=BH n PB0.H2.H4.SBH6.H89aTDH////B//.N \O0.H n ` 0.H2.H4.H///alO 0.H2.H4.H///aLO =n n 0 n$0 n(0 n,0 .LN^NuNVH -|p=@=@-yln6=@|=@=@=@=@=@=@Jg2 n(UgJ6/Hyl^N'P-@6Jf.pLN^Nu n6(cf"P-I6f-yl^6` .=@pA/r//-@-@RNO -n n-hT=n=|=|+p=@=@=@rAAC$nR!n $Hy;HnV=@=@-I-J:N9P n6/(HnVN9PAV"n#H<#|;t#|<l#|<#|<A$n$A%HBJ/.:Hn-IN9PHnN9jX=@J.gp`pr.HyX/.6Hn&-@N-AFNSO -@"J2f pLN^NuBBp$//.HnBHn"Hn&p&/NPO n r//."/NP2O HnHnHnHn/.N@O0.H2.H4.H6.H////x/NPO nPopP`0.H=@HAP!AB0.H2.H4.H6.H////x /B/.N \O0.HA!=|rAaHntHnHnvHnxHyaHyap/////////////p//p/p/NO\=@zgJngA"nfp`p2.H4.H6.|H=@ n HnHnHnHn///.//./aO(2.H=@zJf0.H"=A nzf Bn=|z`BnzA"nf=n=n=n`A"nf=n=n=n.{g Jng 0.H2.H4.H///aO Bn0. @ f"A"nf <` <,=@r`09aH29aH//t /B/.N O=@rJ@ja ` d0.rH/@rN@ n0( @fLp/// /.N1hO A////Bp//NO0.rHB//.N1hO 0.rH"<kJfN`2`*`D` ` ` ` ` ``'`v&`n%`f$`^``|``Z`,`"`Hn&N'xXJ6f -yl^6` n6-P6J6g n6(cgHy;HnVN9PJ6g n6/(HnVN9P`HyXHnVN9PHnp//.N3O nPopP`0.H=@HAP!AB0.H2.H4.H6.H////x/B/.N \O0.HA!J6gHyX/.6Hn&NSO -@"`$HyX/.6Hn&NSO -@"J.gJ2f60.H2.H4.H6.H////BNPOpLN^NuBB`BNHnN8XJfVAKHnB/N3O 0.Y@H2.YAH4.PBH6.C H////x /B/.N \OBp//.N1hO `&Bnr09a @ f09aU@fJg n(gNq=|r0.HSABHnN8XJf`AKHnB/N3O 0.Y@H2.YAH4.PBH6.C H////x /B/.N \O=|r`hHnN9jX nRHn/N9P`Bp=@=@=@=@=@=@A"nf=@=@=@=@p@@A"n"A#Hp-@Np-@F-@R`0.r=@|HHnHn//.NO nrf"A=n=n=|+=n-H` A=n=n=|=n-H09a2.A29aH=@=@H2.HЁ4.H°o =B=B0.H2.H4.H///aO =|` 0.rHr$//.HnBHn"Hn&/NPO n r//."/NP2O Bp$//.N1hO Bp//.N1hO `0.rHr///.N1hO A////Bp//NO0.rHB//.N1hO Bp//.N1hO Nfa`$p-@N.JgHyXHnN9Pp-@F0.rH_rN@ n"P/ HnN9PJ6g0.rH_rN@ n"P/.6/ N70PJgdHnN9jXA"n6/)/N7P`< Ng.Jfa`bA-H>p n>"@+f -g +fR>`HyXHnN9P n>Jg . "fHnHnN9P`4HyXHnN9PHnHnN9PHyXHnN9PB.A"n#Hpr-AN=@=@=@`^BN`h0.rH m0rN@ n0( @g0.r n0( @f =|r`P Nf nrga`6p-@N=||HnHnp//.NOA=n=n=|=n09aH2.H-HJjp`09aH2.H=@29aH=@=@H2.HЁ4.H°o =B=B=|.JgHyXHnN9P0.r n"h / HnN9PJRg nrfBRHnN9jX=@A"nf=@HnN9jX=@~no$ .J=@~0.H".JnARJB`0.~H +o2'r'A=@H$Ԁ"n"=A"nf =n=A0.~HBr//.-@JN1hO 0.H2.H PoP`0.H"=AHAP!ABBp//.N1hO 0.HA!Jng 0.H2.H4.H///aO 0.rH gJfHn&N'xX0.H2.H4.H6.H////BNPO0.rHLN^Nup/p/NNPNuNV HpA`/r//-@`NO -n`\ n\!|;$!|;(!|;I!|;O!|;X!|;_!|;d!|;k,!|;qD!|;w\!|;-3 e p3h 3h =|t0.t @ lH=0.tR@=@t`=|=|J9efND.-@: op`peJ9ef0.rHB/N P9e d$HnxHyaLHnN O 3aLe`23eaL=yex=yez=ye~=ye=yeJyaLg2Jngp` < 2.~H=@8 <N ZNݬ#eH2.H <BN ZNݬ#eL 9eHN24.xH/@ /AN$/&/N2l0.x0.xHN$& "N#eH 9eLN24.zH/@ /AN$/&/N2l0.z0.zHN$& "N#eL29aP 9eH/AN2/@ //A N/@ //A"/ $/&/N(N#eH 9eLN289aJH/@ /AN/@ //A$"/$/ &/$N(N#eLr=AZ=A\ 9eHN2/@( //A,"/$/(&/,N8N=@^ 9eLN2/@( / /A,"/$$/(&/,N8N=@`09aLHB/NP09bn=@D@3bnHnZp/N12PHnFN0X9e dN09aLHB/N lP9eSfe3xe3ze3~e3e3e0.D@(n83bnHnFN0XHnZBN12P09aLH/N HXJ9ef(09aLHB/N P09aLH/N pX`09aLH/N $XJ9ef0.rHB/N lP e 09]2np3]2JyaLf.0.r3aLHB/NP3Obnp/BN P3raL09]2g*p/N5X`ap n\2(=@ng=@n n\0(go09a2.BHBnt=AB09aJH29aHN Z2.tHlBnl0.l @lHAi Rnl`B.Y0.tH2.nH//HniaO HniN9jX2.BH/Ao$PAiB /Aip//aPp/HyXaP0.tR@=@t`Dp/HyYaPLN^NuNVp/N X=@H#wJgp/NhX-@` N xH-@Jf>N/BNAX/p/NPS@gN^Nu09]2 gNP`~N^NuNV f/.N9jX-@ . S Jg n fJwg6p/NhX-@JgJg8 n@H/r/NNP` n@H/N PXH-@Jf@N/BNAX/p/NPS@gN^Nu09]2 g\NP`RR`[N OSgN^NuHnN^X29]6=@g& yg-hJg n(gx0(2.@o n2( n0(HR=AH2.Hn n0(HR2.H"=AH09aHҀS/@ "/N Z"/N@=@ n-P`h yg-h0.nJgd n(gLBn(@Rn0.nn.2.HҀ09aJHn0.H//.a&P` n-P`3 bnN BydN^NuNVH 09]2@3]2 ygB"yg/) /N%O #gJfLN^Nu n"yg3h 0(2.A"yg3@3h0(A"yg3@h"ygh"ygh"ygh"ygh"ygh"ygh"ygB)"ygha yg1@B" yg6"n6/ /N9P yg&"n&/ /N9P yg&"yg#H$n j""yg#H"g@/*"N9jXR=@HB/NP yg!@"Jg"n/)"/N9PLN^NuNVp-yg=@=@ nJg-h`JgBn"n i-H-HJg nBh-P`0.H n$l-h0< =@=@Jgd n0(H2.HnFJhf@0(=@Hl=n=h -H` n0( =@nl=h=@-H n-P`Rn0.n n1@`\0.n n-P`N^NuNV09eHy>N O`09eBJ@g09eBHm lN` ``t`L`p`f-yh, n-P`\HyYHyh(N'P-@"n i-Hg00(Y@g`&HyY Hyh(N'P @-h`-yh, n-yh(-H-Hg8 n=h ng-P n0( n`09a2.=A`Bn0.H29aHH//<'/aO B/.Hyh(N%O -@JfN^Nu n1| 1yeBB(*Hn/N9P nHyb/N9P09eBH gUfB09eBR@3eBHyYHyh(N'P29eB-@WAf6"n Q-Hg 0([@gNqJg n-h`-yh,-n-yh(Bn ng0( n-P` n0( n0.H29aHN@=@HH//<'/aPO B/.Hyh(N%O -@Jf/.Hyh(N&PN^Nu n1| 1yeBB(*Hn/N9P nHyb/N9P3ObnN N^NuNVp=@=yaH-yh(29a49bLB49h B49aH=@=AJg n0( n0.ܰnm n-P`JfN^NuaH n2( HЁ4.H/B29aH=@ N@=@$/ N@S=@ n=h 2.H=@H//aP @lp`0.H2.H//adPH=@N=n=n=n=nN4\HnHnA//NO0.@H=@Hyh p/N12PHnN*XAaC/ / / HnHyaHyap/p//p//////////p///p2/NO\=@gp`p=@J@gBn0.nJ@g$09a29bLA29h AR@2.A29a=@Hl=A09a2.Ho=@09aH/@rN Z2.HҀ=AH "/N Z"/N@2.H=@HҀS0.Hf .g09]2g p/N5XN4\HnN*X.gN3xHyh p/N12P0.nS@=@=@=nN4\HnN*X``A////Bp//NOHnN*X0.2.AfN^Nu0.H2.H29aH/AN ZR n1@ H2.H"/N@2.H=@H//<'/a&O Hyh BN12P3ObnN N^NuNV-yg yg-hJg: n0(n m"0(nn0(2.A1@0(A1@ n-P`Jg4 n0(H2. Hm2.Hn 0(n1@ n-P`N^NuNVBn-yg yg-hJg@ n0(H2. Ho"2.Hn0(2.@n n2(=A n-P`JgP n0(Hr(Ёr(=@H2. Ho2.Hn0.nn0.=@ n-P`0. n09a?@Hn0.H2/N^NuNV n 0( n2(Ao n0( n 2( n4(=@Bo n2( n 0 n4=ABn n0 n 2( n4(=@Bn n2(=A0.nm 0.Amp`pN^NuNV-yh(Jg n0(n g n-P`Jgp`pN^NuNV09aH g @fp`p=@JyePf | N^Nu-yh(09a29bLA29h A29aHBn=@Jg:0.H2.HҀ4.H´m n2( HЁm n0( n-P`JgL nBP0.H29aHN@ n1@1yaH"n0) HN@ n2(HҀS1A .N^NuNV-yg yg-hJg4 n //.aPJ@g n(@ n-P`Jgb n0(=@2(Ht(=A4(@=Bp(HЁ=@Hn/.aPJ@g n(@ n-P`N^NuNV-yh(Bn ng0( n-P`J gL n BP0.H29aHN@ n 1@1yaH"n0) HN@ n 2(HҀS1AN^NuNV n0(HJg Sg0(]@fpN^Nu n0(H gWf( n0(H A///NղO N^Nu n0( @=@-yh(JgV n0(2.Af<"n// N:PJf n"n/ /N:PJg n-P` .N^NuNV-yh(Jg nJ(*gpN^Nu n-P`pN^NuNV yh,Hn/-Ha\P0.R@29aH49aJRBH…=B@ N^NuNV~HBNǮJ@f pLN^Nu-yln n(cf"P-Iܳf-yl^`B.A/p/BNO -n n-hT!|;$A"n#H/HnN%PBl-yl^pJpg npc-Pp`p=|ZrAtA yh8=@^=@\-HPgJPgB/.HnN%O @-HL "nP / /N9P nL"nP/ /N9P nL%"nP%/ /N9P nL5"nP5/ /N9P nP-PP`h-yh8P nP/Hn>N9PHn>Hyl^N'PHntHn/.P-@pa O `,-ylnp np(cf"P-Ipf-yl^p`AC/ p /B-HhNO -n n-h``6`2`.`*`&`"`HnN'xX"np Q-Hpf-yl^p np(cg (` 2.\HfHy;HnN9P np/(HnN9PHn`p//.N3O 0.`H2.bH4.dH6.fH////x/B/.N \OHyY./.pHnNSO -@=|JJPg&JPg nP-PL/Hyh8N&P-nLP`._g nhB` p@t@JfX0.H2.H4.H6.H////BNPO09]2nV3]2g p/N5XpLN^NuB` nhBBp//.N1hO ._fvB.tBp//.N1hO =|JJPgP nP-PL/Hyh8N&P-nLP`=|JJPg nP-PL/Hyh8N&P-nLP`0.HUrN@ n"Pp// /.hN9O HyY0/.hN9P np/(/.hN9PJnTgR0.Hr //.HnHnHn/NPO .r//./NP2O Bp //.N1hO Bp//.N1hO Bp//.N1hO Bp//.N1hO `HnN'xX nhJgBp//.N1hO Jn^f npc-Hl`&._g npc nlcJPfVB/9hO ` p@t@RnZ`-nplRn^ n^o=|^._gAt`A-Hha 2.Z@l> n^op `p=@\"np Q-Hpf-yl^p np(cg (` 2.\HfJPgRJnJfL._g nP5/Hn>N9P` nP/Hn>N9PHn>Hyl^N'P-@pHy;HnN9P np/(HnN9PHn`p//.N3O 0.`H2.bH4.dH6.fH////x/B/.N \OHyY2/.pHnNSO -@JPgJnJg nhBJfX0.H2.H4.H6.H////BNPO09]2nV3]2g p/N5XpLN^NuB n^f n!|?R\` n!|?g\0.Hr //.HnHnHn/NPO .r//./NP2O 0.H2.H4.H6.H////x /B/.N \O`B-yl^pJpg npc-Pp`p=|ZA"yh8Hnt// =@\=@^=@J-Hh-IPa`O nP/Hn>N9PHn>Hyl^N'PHy;Hn-@pN9P np/(HnN9PHyY4/.pHnNSO -@Bp //.HnHnHnp /NPO .r//./NP2O n!|?9\0.H2.H4.H6.H////x /B/.N \O0.H g f nfHyh8N'xX-nLJLgB/9h @()gHyYMa $XJ@f  n()gHyYYa XJ@f HyYaHnN9PHy?HnN9PHyYkHnN9PHna XJ@f HyYwa XJ@f HyYa XJ@f zHnHnp/a O -@-@JgBn0.2.An`Bn0.J@kH0.Hr//Hna 6O J@g,Jng HyYa (X=|Hyba XJ@g` 0.R@=@`HyYa XJ@g` HyYa XJ@f HnHnp/a ^O -@Jg=| n0(H @5@/a XJ@f |HyYa XJ@f jJnf8A//Ba O -@Jg @()gHyYa LXJ@f ,0.2.An3eHyYa $Xp=@=@0.J@kF0.HB/Hna O J@g,Jng HyYa X=|0.Hr//aP`JyeRgHyYa XByeR` HyYa X0.R@=@`R n0(H^ @5@/a xXJ@f XHyYa fXJngJBn/.NJXHn/-@NP0.29aHR@=@ n2( AU@=@``HnHnp/a O -@Jg @0(H @5@/aXJ@fHyYaX0.2.An3eHyYaXp=@=@0.J@kF0.HB/Hna zO J@g,Jng HyYalX=|0.Hr//a$P`JyeRgHyYa>XByeR` HyYa*X0.R@=@`R n0(H^ @5@/aXJ@fHyYaXHnHnp/anO -@Jg> @0(H @5@/aXJ@f| n0( HS/HnN8PHnaXJ@fdHyYarX0.2.An3eHyYaPXp=@=@0.J@kF0.HB/Hna O J@g,Jng HyYaX=|0.Hr//a P`JyeRgHyYaXByeR` HyYaX0.R@=@`R n0(H^ @5@/aXJ@fHyYaXHnHnp/aO -@Jgd/NJXHn/-@NP0.29aHR@=@ n2( AU@=@HywN'xXHyYaXJ@f n/HybN9PHyZHybN9P n/HybN9PHybaXJ@f0.2.Anfp=@=@0.J@kH0.Hr//HnaO J@g,=|HyZarXJ@fRHyba`XJ@g`>0.R@=@`HyZa@X=|/.NJXHn/-@NP0.29aHR@=@ n2( AU@=@0(H"@5@/aXJ@f n/HybN9PHyZ HybN9P n/HybN9PHybaXJ@fjHyZ axXJ@fX0.2.An3eHyZaPXp=@=@0.J@kF0.HB/Hna O J@g,Jng HyZaX=|0.Hr//a P`JyeRgHyZaXByeR` HyZ!aX0.R@=@`R n()gHyZ$aXJ@f n0(H^ @5@/aXJ@fdHyZ,arXJngBn`,"n i-Hg>0([@f6Hn/NP0.29aHR@=@ n2( AU@=@`HnHnBaO -@Jg @0(H @5@/aXJ@fHyZ1aX0.2.An3ep=@=@0.J@kF0.Hr//HnaO J@g*Jng HyZ3atX=|0.HB/a.P`0.R@=@2.AnJyeRgHyZ5a6XByeRHyZCa$X`XJyeRgHyZMa XByeR` HyZZaXJh@gHyZ]aXJ@f-yh8Jg n /HybN9PHyZdHybN9P n/HybN9PHyZfHybN9P n%/HybN9PHyZjHybN9P n5/HybN9PHyba$XJ@f"n Q-Hg8HyZlaXJ@g&`HyZraXHnHnp/ajO -@JgBnHyZyaXJ@fJg n0(Y@fzJngHyZaXJ@fn=| n/HybN9PHyZHybN9P n/HybN9PHyba4XJ@f n-P`tHyZaXNHywN'xXN^NuNV/.N9jX//.NPS@gpN^Nup //.N8PJ@gBye`/.N9jX29eHҀ3e09e @o"p/HyZNPS@gpN^NuByepN^NuNVBn-yh(Jg n0(n g0( n-P`JfpN^Nu0.R@ n 0 n2( AU@"n2 N^NuNVBn=|' ngtB-ygJgb n0(29aH=@nf<0(29aH=@H n2Hm2.Hl=n-n=| n-P`B yg-hJg n0(29aH(A=@=AJng0.H2.HЁS2.Hfh n0( 29aH=@H"n2HmD2.Hl: nf(g(/aXJ@g=n-n=|0.S@=@Sn`p n-P`: nfz"b n/( HybN9Pp n(R @b"p n(T @bB n(@3eTp3e3e(@3e nf n(f nfl n&/HybN9P n(f(6Jg(& "gHyZHybN9P n6/HybN9P`p"n i"R/HybN9P nfN n(g@HyZHybN9P n&/HybN9PHyZHybN9P n(@3eT(@3e(gV6/Hyl^N'P#ln @ "n&/ /N'Pr n(t @($-@ಂfr3e3e n(@3eJng 0.R@ n00.N^NuNVB.09eR@29eTAAgp`p.HH09eR@49eTBABgp`p.HH09eR@49eTBABgp`p.HHAg209eRgHyZ/.N9P`HyZ/.N9P.g209eRgHyZ/.N9P`HyZ/.N9P.g209eRgHyZ/.N9P`HyZ/.N9P3eTeRN^NuNV0Sn B.809e2. @ov09eT29eRA=@0A3eTHn8a~X30eTHyZHn8N9P0. H/Hn3N8PHn3Hn8N9PHyZHn8N9PHn8a$X09e2. @3eJyegHyZHn8N9P`RJyegJHyZHn8N9P09eH/Hn3N8PHn3Hn8N9PHyZHn8N9PHybHn8N9PJyegHyZHn8N9P09e29eR/Hn3N8PHn3Hn8N9PHyZHn8N9P09eH/Hn3N8PHn3Hn8N9PHyZHn8N9P09e @do,J gHyZaVXHyZaJX` HyZa<H@HB8F@BBDGmzBm. fJgN鈴Gm" fJg "NNhJf,Jf&HHyNNXOL <@rH@NuNZGm" fJg "NN:Gf0Jf JfJfJfNhNN`@ @Bf(Jf Jf``@AEN@AE`B BG?GhNDH@.音G@HB.| GBHD8"DHB8HA0BAHB:HC<HC>HGFHGBFHF݅dSD҃тBCHD,HBhBD HBH@HA0BA`*8HA0BAHB<.HGHGGHFBGGHFdSD҃тeSD҃т,HBhBE HBBH@HA0`:HA0HB<ŐdSEЂeSEЂHEHBhp: "( :HDNH?aLNuH?aLNuBH@HB<<><8F@:G@BBBBGf Ef.Bm.f.g "N鈼DgNhJEfFH@f*Jf$HBfJf FN "H@@@H@NuHBfJfH@@@H@Nu~G@BH@HBDg(f fNujD@8NNZ҃т m~ӇчE EeNDH@EDH@Nun @ADE Eg0JGfBHBfJf @@H@NuփՂJEf*H@ҁр`&JfJfNZN BHB @H@EFGGE G4nҁр G o &tG t`4EH@EDH@Nu Go6HCBBHBG"F,, Df>҃тE m E~ӇчH@E EdDH@NuND mD҇~чEH@EDH@NuH<xr`H<xrJg8j8<D d:<H@HB8F@BBDGmVBm. fJgN鈴Gm fJg "NJfJfNhNZGm4 fJg "NJfJfNhNZ:GfJfJfNN`@ @Bf*JfJfN@AEN@AE`BBE?GhNDH@.៳G@HB.៷GB.HG,HFކBGGHGHA,BFHFކHC,BFHFކH@HB,ރv݃ށ݃"HA&HCт$B@@H@HBBBނц҇tтNH B"Cv$j> edHHyNNXOL`JH B"C&<$jRH@4B@B?m @H@BBn2DBJk@`>p`8HHyNNXOL ` B n޳婳bJjD$& LNu mJElN` ElBDEMXE E9oN$2B@H@HAEnE$ꩱtӂтH@@H@Nu$艱tӂтH@E @eND@H@NuJk8Jj JfhJfbJf\ fRNuf eDf8NuJkf,Jf&Jf fNuf efNuJ9NuJ9NuH@HDz lH@HA0BAE mBD lPDH@J@fXD|C1FH@,龳F@LDH@HDNup"@H@NuHHyNNXOLpr@H@NuHHyNNXOL <@rH@NuHHyNNXOL <rNug HHyNNXOL@H@Nu l4H@HA0BAEl`fv lPCH@J@fXCt;BH@$纳B@KCm H@EDH@NuDEM$ꩱH@@H@NuNV#+lN^NuNV/.NXHn/-@N$P .N^NuNV n (S!@Jk "PRp` /.NXN^NuNV n (S!@Jk"PR. r`p. /. /NP" N^NuNVp. /a"XJfp. /a6XJfp`pN^NuNVp. Ae Zbp`pN^NuNVp. ae zbp`pN^NuNVp. 0e 9bp`pN^NuNVp. /aVXJfp. /aXJfp`pN^NuNVp. r0k@fN `* `" ` ` ` `pN^NupN^NuNVp. e gp`pN^NuNVp. /aXJgp.  `p. N^NuNVp. /aXJgp.  `p. N^Nu o"o / oe  SfNuSfNuNVBw wlp nR"@["gR` nJgX 9wRw @w p nJgR"@["fR` nrR@JftNqHyx8HyZHy+,NO 9+<-@ >g"HyxRHyZHy+ . o o <` .z@Hyz@N~XBp-@p9z@".dJ nz@R@ f n R ` .fB` n R`p /NX .N^Nu-|b-|`-|-| ng4B .l n R/H"nN o` .N^NuB .l nN@r kfN`x`@ ` `p / nNXp / nNX n .R N^NuJgzp/ nNXp / nNXp/ nNX`Rp / nNXp / nNXpN^Nu n R. d&p^/ nNXp.@/ nNX`p./ nNX` .N^NupN^Nu/./. n/(NO -@J+hgp#]pN^Nu ng .N^Nup-@-@ .l\ n R@ g f$ .Sr///.aO .N^Nu n R`JfJf< .N^Nup#]pN^NuNVJk/.aX-@Jfp#]pN^Nup n( d N`````-|`-|`-|B .l@ n R@ f nf p / nNXp./ nNX` .N^Nu ngp/B/.atO ng8/./. /(NO -@J+hgp#]pN^Nu .N^NuB.p-@-@-@ .l n R@ f . g | S nz@ .R.-@A m/Hyz@ n/(NO -@갮gp#]pN^NuJ+hgp#]pN^NuB`XJgJ/.Hyz@ n/(NO -@갮gp#]pN^NuJ+hgp#]pN^Nu .N^Nu .N^Nup#]pN^NuNV/.aFX-@Jfp#]pN^Nu n(JgpN^Nu/./. n/(N O -@J+hgp#]pN^Nu f`JgZ nfN .S-@Jk4B/./.a^O Jgp/Hn/.azO JfS` .RN^Nu .N^NuNV/.ajX-@JfpN^NuB n(Jf"/(NXJ+hgp#]p-@ nB .N^NuNV/.NNAXHj#+hNup#+h /"/ o//??<?NAO Jj#+hpNup#+h /"/ o//??<@NAO Jj#+hpNup#+h / o"/??/?<BNAO Jj#+hNup#+h //?<ANA\Hj#+hNup#+h /"/ o??/?<CNAO Hj#+hNupNup#+h /"///?<?<VNAO Hj#+hNupNuNV .+\opN^Nu y+X .ѹ+X+\ N^NuNV/.aX-@JgN^Nu | N^NuNV 9+X+Tѹ+\#+T+X#]#]#]#] N^Nu Ar/jAJlADÈJlD/aJ_gDJ_gDNu$ BNu"B$g n0@B@H@"2H@0BAHA$ Nu"BAHAH@B@ BtЀӁnR@Q$ Nu /"/??NAXHNu /"//?NA\HNuA"!o "o1Q8!oBh.1| 21|,N"A"CD!ICD!I "o282< "o CX/ ED2Q$_HNuA"1o8Bh.Bh21|,N"HNuA"!o "o1Q8!oBh.1| 21|d,N"A"CD!ICD!I "o282< "o CX/ ED2Q$_HNuA"1o8Bh.Bh21|e,N"HNuA"1o8Bh.Bh21|,N"HNuA"1o8Bh.Bh21|,N"HNuA"1o D1o8Bh.1|21|w,N"0(DHNuA"1o D1o8Bh.1|21|x,N"HNuA"!o 1o D1o81|.1|21|,N"A"CD!IHNuA"1o 0!o01|1|1|1|N"A"0(0HNuA"1o21o 0!o01|1|1|1|N"A"0(0HNuA"1o21o 0!o01|1|1|1| N"A"0(0HNuA"1o21o 0!o01|1|1|1|!N"A"0(0HNuA"!o 41o 0!o01|1|1|1|"N"A"0(0HNuA"1o:1o81o61o41o21o 0!o01|1|1|1|*N"A"0(0HNuA"1o61o41o21o 0!o01|1|1|1|+N"A"0(0HNuA"1o 0!o01|1|1|1|,N"A""o 22"o240(0HNuA"1o 0!o01|1|1|1|2N"A"0(0HNuA"1o&@1o">1o<1o:1o81o61o41o 21o01| 1|1|1|3N"A"0(0HNuA"!o01o01|1|1|1|4N"A"0(0HNuA"!o0Bh1|1|1|6N"A""o22"o 24"o26"o280(0HNuA"1o">1o<1o:1o81o61o41o 21o01|1|Bh1|GN"A""o$22"o(240(0HNuA"Bh1|Bh1|MN"A""o22"o24"o 26"o280(0HNuA"!o01o01|1|1|1|NN"A"0(0HNuA"Bh1|Bh1|ON"A""o22"o24"o 26"o280(0HNuA"1o81o61o41o 21o01|1|Bh1|dN"A"0(0HNuA"1o81o61o41o 21o01|1|Bh1|eN"A"0(0HNuA"1o01|1|Bh1|fN"A"0(0HNuA"1o01|1|Bh1|gN"A"0(0HNuA"1o 21o01|1|Bh1|hN"A""o 22"o24"o26"o280(0HNuA"1o:1o81o61o41o 21o01|1|Bh1|iN"A"0(0HNuA"1o01|1|Bh1|kN"A"0(0HNuA"1o:1o81o61o41o 21o01|1|Bh1|lN"A""o22"o 24"o$26"o(280(0HNuA"!o0Bh1|1|1|nN"A"0(0HNuA"Bh1|Bh1|oN"A"0(0HNuA"1o 21o01|1|Bh1| 1|pN"A""o "0Bh 0(0HNuA"!o4!o0Bh1|1|1|xN"A"0(0HNuA"!o4!o01o41o 21o01|1|1|1|yN"A"0(0HNuA"!o0Bh1|1|1||N"A"0(0HNuA"!o 1o .1o8Bh21|,N"A"CD!IHNuA"1oF1oD1oH1oF1o D1o81|.r"oRJf1A2p"o/ EH4Q$_h21| 61| ,N"HNuA"1oF1o D1o8r"oRJf1A2p"o/ ED4Q$_1|.1|,N"HNuA"!o1o81|.Bh21|r,N"A"CD!IHNuA"!o1o81|.Bh21|61| ,N"A"CD!IHNuA"1o D1o8Bh.1|21| ,N"0(DHNuA"1o F1o8BhD1|.Bh21| ,N"A""o 2D"o2F"o2H"o2JHNuA"1o D1o8Bh.1|21|k,N"A""o 2D"o2F"o2H"o2J0(DHNuA"1o D1o8Bh.1|21|,N"0(DHNuA"1o D1o8Bh.1|21|,N"0(DHNuA"1o D1o8Bh.1|21|j,N"0(DHNuA"1oF1o D1o8Bh.1|21|',N"A""o2D"o2FHNuA"1o D1o8Bh.1|21|,N"0(DHNuA"1o D1o8Bh.1|21|,N"0(DHNuA"1o D1o8Bh.1|21|,N"0(DHNuA"1o D1o8Bh.1|21|h,N"0(DHNuA" / 1@2!o1o8Bh.1|p,N"A"CD!IHNuA"1o D1o8Bh.1|21|q,N"HNuA"1o D1o8BhF1|.Bh21|,N"0(DHNuA"1o D1o8Bh.1|21|,N"0(DHNuA"!o>!o:!o 1o D1o81|.1|21|m,N"A"CD!IHNuA"2<"oC/ EF4Q$_!o>!o:!o 1o D1o81|.1|21|y,N"A"CD!IHNuA"!o >!o:1o8Bh.Bh21|n,N"HNuA"!o 1o D1o8Bh.1|21|f,N"A"CD!I 2< "o CZ/ ED2Q$_HNuA"!o 1o8Bh.Bh21|&,N"A"CD!I 2<"oC / ED2Q$_HNuA"1o8Bh.Bh21|,N"A""o2D"o 2Fr2<"oC/ EF2JZQ$_"o2Dr2<"oC/ EH2JZQ$_HNuA"Bh1|Bh1| N"A"0(0HNuA"Bh1|Bh1|N"A"0(0HNuA"1o41o 21o01|1|Bh1|N"A""o22"o24"o26"o280(0HNuA"1o 21o01|1|Bh1|N"A"0(0HNuA"1oFN1oBL!o<01o:J1o6H1o2F1o.D1o*B1o&@1o">1o<1o:1o81o61o41o 21o01|1|1|1|N"A""oH22"oL24"oP26"oT28"oX2:"o\2<0(0HNuA"1o D1o8Bh.1|21|,N"A"2<"o C/ EF0Q$_0(DHNuA"!o 1o8Bh.r"o/ EDR4Jf$_1A21|t,N"A"CD!IHNuA"!o 1oL1oJ1oH1oF1oD1o8r"oRJf1A2[p"o/ EN4Q$_1|.Bh01|61|,N"A"CD!IHNu0NAXHNu /"/ o //??<?NA Nu /"/ o //??<@NA Nu //?<ANA\HNu /"/ o ??/?<BNA Nu /"/?/?<GNANu //?<HNANu //?<INAHNu /"/ // /"/ /??<KNAHNu /"/?/?<NNAHNu?<ONAHNu /"/ o //??<VNA HNu"0<sNBNu"0<NBNu""$&("*"&$(V1.04Lattice C 2.10Invalid stack size $Invalid I/O redirection $Insufficient memory $Error releasing memory to TOS $ ((((( P    !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~cueaaaceeeiiiaeooouuyouaiounnaoaaosAAEEEIIIOOUUYAIOU "1-,!&02$%&13457:;<=>@A \[3][Fatal Error !|RSC File Not Found][ Abort ]-f UUUUUUUUUUUUUUUU""""""""""""""""""""""""3333333333333333 COUNT   clip.brdclip.brdclip.brd SUPERBASE PROFESSIONAL FORMS EDITOR V 2.01 03 March 1988. (C) Copyright 1987 Precision Software Ltd. All Rights Reserved. Unauthorized Reproduction or Transfer Prohibited by Law. Design and Programming: Brian C. White Additional Programming: Simon D. Tranmer Additional Design: Dr. Bruce Hunt Developed in England. 1l11122 2;2e2g2223.sbv.pg.sbp.sbfi.imgand.**g3H3M3Q3V3[3]3b3d3f3h3l.sbf.sbdforml.rscform.rscJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberMMM3333333333344 JanFebMarAprMayJunJulAugSepOctNovDecMMM4F4J4N4R4V4Z4^4b4f4j4n4r4vSELECTHEADINGBEFORE REPORTAFTER REPORTBEFORE GROUP AFTER GROUP FOOTINGEND HEADINGEND REPORTEND REPORTEND GROUP END GROUP END FOOTING4444444445555)54 FE Project Page Edit Set Report Font FORMS EDITOR ------------------123456 New Form Page Open Form Page File Close File Save Form Page Remove Form Page Directory D Print Status Quit Go to G Next N Previous P Clear Erase To front Swap > Swap < Attributes Cut Copy Paste Undo U Replicate Crosshairs X Align Y Reduced Z Field F Calculation Validation Text T Image I Line L Box B Area A --------------- Move M Size S Order Function Link Heading Select Report Group Footing Options ------------ 7 point 8 point 10 point 12 point 14 point 16 point 18 point 20 point 24 point 28 point 36 point5x5|555555555555555566 66'646A6N6[6i6p6x6~6666666666667777.7>7O7]7j7{7777777788 888&8-868?8R8e8x8888888888999 Reduced Z Normal ZStatusOpen filesDirectory: Pages in form: Disk space free: Memory: Attributes RField optionsAuto field bordersAuto field namesPrint optionsZoneField namesField characterDraftGraphicsFieldsTextImagesLinesBoxesAreasColoursSelectionSelectedResetSet fieldSelect groupFile: Calculation for Validation for ValueSet functionSUMMAXMEANVARCOUNTMINSDOKClearCancel[3][Out of memory error][ OK ][3][error freeing memory |sorry][ OK ].sbv.pg Untitled: Page For your information...Can't do this...Do you really want to quit?Existing page will be clearedExisting page will be erasedThis form has been changedAre you sure?Error opening fileError writing fileError reading fileError loading fileDirectory changeOpen formSave formOpen pageSave pageRemove formRemove pageDo you want to proceed?This action removes the formThis action removes the pageOpen fileClose fileSelect imageCalculation nameGo to page #Number of repetitionsReset entry order?Form includes unlinked filesSave form now?Not enough report space on pageMax 1400 linesCan't find SBPRO.PRGEnter pathname or insert diskThis file exists and would be replacedSelect master file fieldSelect primary fieldSelect secondary fieldSetReport optionsPage on groupPage before reportPage before totalsSummarizeREPORT TO PRINTER?Undefined errorClosing parenthesis missingOpening parenthesis missingDOS can't open file: DOS error reading file: Insufficient memoryNo SUPERBASE files openFile is required in this formCan't open the printerUnbalanced string delimitersName must end with '%' or '$'Memory allocation errorDOS error deleting file: Can't access directoryNot an open fileName too longCan't find this fileCan't find this fieldNo file selectedFile data in wrong formatDOS can't open input file: Invalid parameterImage file not foundImage file not compatibleString too long??@@*@@@Y@m@@@@@A A'A>AOA]ArAAAAAAB  P P ,        & LP        #"             ! "  ,$+ %&'( )!*"+##$6-5 .%/&0'1(2)3*4+5,,-E7D 8.9/ :0 ;1<2=3>4?5@6 A7 B8 C9 D: 6; LFK! G<H=I>J?K@EA M](NBOCPDQERFSG TH UI VJ WK XL YM ZN [O \P]QL Rselb. / EJECT80132.dNOPQ0%Q0 txN O YxQ8 Q8 Q8 > A A  A A A$A-A6t>@1 *@@  @ 3 &qaFEDFFEDPFCLPFREPFARAFBOXFLINFIMGFTXTFFLDselbdTXTNUMDATTIMEXTDELCALVALCLCCONCLVCOVREQRDORDQIXDIXUO0O4O8O<O@ODOHOLOPOTOXO\O`OdOhOlOp @ `@  rb-a+-*/<>=>=><=<^ANDORLIKEMODCONTAINS+ABSATNCHR$COSEXPINTLOGRNDSGNSINSQRSTR$TANDATE$FIXFREEROWCOLPROWPCOLERRNOSPACE$ERR$++LEFT$MID$RIGHT$ASCLENVALDAYSDAY$DAYMONTH$MONTHYEARTIME$TIMEVALHRSMINSSECSTHOUSECSLCASE$UCASE$INSTRDISKSPACERECCOUNTEOFFOUNDLOOKUPFCASE$TRIM$REPLICATELTRIM$SER+++++NOTPITODAYNOWFIELDAPPENDASASCENDINGBUFFERSCOUNTCURRENTDISKDESCENDINGDOWNDUPLICATEELSEERRORFIRSTFROMLASTLINEMEANOFFPAGINGPREVIOUSPRINTERQUERYRECORDSTEPSUMSUMMARIZETABLETEXTTHENTOUNIQUEUSINGALLPOSTGOSUBGOTORESTORERESUMELIST?ADDAFTERASKBELLBEFOREBLANKBREAKCALLCHAINCLEARCLOSECLSCOPYCREATEDATADATEBASEDEBUGDELETEDIRECTORYDISPLAYEDITEJECTENDMAXENTERERASEEXECUTEEXPORTFIELDSFILEFOOTINGFORFORMGETGROUPHEADINGHOMEIFIMPORTINDEXINPUTKEYLABELSLETLOADLOCATEMAKEMEMORYMENUMERGEMODIFYNEWLINENEWNEXTNUMBASEONOPENORDEROUTPUTPASSWORDPOSITIONPRINTPROTECTQUITREADREMREMOVERENAMEREORGANIZEREPORTREQUESTRETURNRUNSAVESAYSCRDUMPSHOWSELECTSETSTATUSSTOREUPDATEVIEWWAITWHEREFGBGULBFITATTRDIMWHILEWENDMINVARSDPGPFPHPJPLPNPQPSPVPXP[P]P_PcPfPkPoPxPzP~PPPPPPPPPPPPPPPPPPPPPPPPPPPPQQQ QQQQ Q%Q+Q3Q7Q<QAQJQQQXQ^QhQqQuQ{QQQQQQQQQQQQQQQQQQQQQQQQRRRRRR$R)R.R3R7R>RGRORUR\RaReRoRuRzRRRRRRRRRRRRRRRRRRRRRRRRRSS SSS!S+S3S8S>SBSFSLSRSZSaShSmSuSyS~SSSSSSSSSSSSSSSSSSSSSSTTT TTT$T*T2T7T<T@TGTNTYT`ThToTsTxT|TTTTTTTTTTTTTTTTTTTTTTrff.E.imgDD"".imgHfFORMCALCSfa "" [3][Print command failed.|Check printer has paper, |is connected and on-line ][RETRY|CANCEL] selbselbselbselbfFORMCALCSfa ""ii.ii..OPEN FILE "" SUMMARIZE EJECT REQUEST "","",1,a% IF a% THEN PRINT; REPORT , EJECT ? ;; ATTR OFF ? ;; ATTR OFF ? ;; ATTR OFF GROUP ., . ? ;; ATTR OFF EJECT ;; ATTR OFF; NEWLINE ; ATTR OFF WHERE . = . AND ASK ORDER ,. ASK . AS "" BF OFF ; BF ; IT OFF ; IT ; UL OFF ; UL ;@; MID$ (& ,,) ; ? .erwaCan't open stdin file Can't open stdout file ((((( H ((((( H con:CON:prn:PRN:lst:LST:lpt:LPT:lpt1:LPT1:aux:AUX:com:COM:com1:COM1:rdr:RDR:pun:PUN:nul:NUL:null:NULL:a:*.*>,D   *.      88    $"                      *   "2    < .n *    &       &     $         P 4"($         "         4 6:    444.0$@ fZ*"$ 0D .    "$Nz 2@@@@   >                         &hv*&*  "**HL                .   F, 2r"F L(, j        $     8         $             $                 (         H            2      2    *         . <         &   (        (            (    * .     >    (   "       4           4   " Vd(   $                   $  Z0           J                 ^     D   x  $&&&0H . V  F 4&   ( *2 ,@            * "  $ (6,,,,  ( 44(         8 $&8484& & & >" 0 ,  : ,4 ,<.4 *d@ 8 (6$$6&$<6&$< $6&4 (" Z:$ 6&: (*L B"<   .@$  $ 6             h           N     $        (*  *   ($  * 8 8$ .                 N  >  ,(  ,4,0  "  " 0 "   80   .4&: 0&(R j N ""*H&&*J$$"$$ ` VVR`nn "  LP        "  "  "  "  "  "      @@@@@PL            2 6,  J d(46  2 6  < 4"$$(  (& 4D2r    ,  @ " DP     " ,       8" r   8<D:&N2    $ 0&  " , V D (   >  &"6  ," H"x"x"| "2 2$$R6"Z<6  *"   .*$$$8   $  $ "$"$"4   8($$"$*" 6,8 4 4  :  2     @HN  z     ",2N 6 6 LN& " b Th P(  6 6 6* .2 4 6 V(    ,  *  ,4L* D   , ,"  v &"D* $"D4  ~$   >>T:L**d>*v2Z: zJR"j  @ ZP"66*    (H  ,4(*~ 4 @ (B@F ,& .4( @( xxxxl"0$&", f   n0 ,4:JN$"&$ &        ,R\$$4"              4 "2  &64"  bB" X      (v     &          &           6 r   R           *     (P F<4(T* :.^ 0R&"$  ^ >$ >@ >T v* 8 "  Fn&>  RX* $\*  ,4(ZPNP$NH2@ 2            8 *            @V>  * (  XD&x$*p R.     &^F  42 .* >$ <6( `R 24 *  & " :"d$6p. "2 $" ":.4 "$  4>4   >0*0v 0.  ""& *  ,4( (*( 4 *R *""& *H4J  4 H "$4*8 *2,  * *.  0 >(&$"  &.4,RD"R422V`   @ 8    r D>">& * N>& *6,>& *, R  *">& ("< L:6   &.,    tFD~0.$(  " ,              F  T 8  &, n &V*^bN  " *hdN|L8 $(4> .    ZNJ    R. 2 :":V:h("<Z,   :0$ , j\J  *:  ^$  $.  " .&:P(N.P   & & &  &$ 4*< *<   "" **0000H<* *T*"0L0*0::""(.@"@.".(<""h J "("&,"0"""(""""&" &"6P& (. .`.0(>"*8n, * tX*|8@77788 888&8-868?8R8e8x8888888888` @0V o#"h"(pVSk"Q#ErSk g$ =gT g fQ`G`GtSAk g g RB Bg``"<`*tSAk4 g, g&0e*9 d"&ԂeԂeԃeԂeԀe `#L`x"<` Ld #L 9LRЀ (e^###$9g ԉe@e< $##///?<?<JNAO "Jg"< `L"<`B"y$ZBJB.I/ c JAkSQBNp/ /??<LNA/?< NA?<?<LNANVp. @PfN^Nup. d  N^Nup.  @PpN^NuNVp. @PfN^Nup. d  N^Nup.  @PpN^NuNV nPpN^NuHyBaPNuNV#*#*.#,.#///<,Hy/-HNO Bp/Hy&vNO Bp/Hy&NO p/p/Hy&dNO p/p/Hy1NO p//<"Hy*NO p/p&/Hy/ NO #%Jp#&"#^#%&`#r#jBy131BN?XNljN'4B9!B . l @1BR`BNUXp .&,&HyHy&N8PB9&N* &&p &&0&, B9     p##N-Hy2rNrXJg BN0XNzp /NX l BN0XN5Hy2rNrX#JjD/Nx X`Jf@Jg/.NRXNWBHy N:PJfn# NU"`JgRJg(#&& y&#& #B`hN^ cgB/9&NjPp#.N/p/HyHy!N6O Hy!HyNP#p/Hy"/9N O #" yJg :fR`N`Jf`j y&Jf N^`V"y& Q#& #`NVH p-@-@-@Jgp n @Pg(p n"@PgP"n RR `(np @PJgR` :f n R "nR :f n  R nJg "f"n RR Jfn`Jg n"n RR ` n fR` n 'f p-@-@`p n @Pg. n"n RR p n @Pf`J n ?f&p"n R "n {R R-@`~ l(n " A8*Pp/NXrRf`RJfp @PJf _f lp n R n R "R-@ f-@-@-L`R`fp n"@PJf"n RR ` n"n RR p n @PJf _g n .f"n RR n "f8 n"n RR n "f n RR `R nJf`H n"n RR p n @PJf` n f"n RR n`j n B .L0N^NuNVH *n(n p-L-@-@.gJg R fNqJg "fRRJfn`JgRR` fRR LRRr-A f p-@-@` . vm8 yn0Jg 'gz :gr f - ^g`RR` . LmJ Nn@RRRRRRRR`$ 'fp-@-@` fR` :f RR`p @Pg.RRp @Pf efRR`~p @PJgpL-@p @PJf g _f RR oNqp $g %fpN-@ RR6x fS`B6x op/HnNPJgR LR . Nf@HnHy/ NP-@JfHnN8X-@~ lxRR` .fpR-@ "fRR~xJgLp @PJfJf`. "fR`"R mB6xp/HnNPR`B6xHnHy*NP-@Jf*.fp/HnNPBHnNNP-@ n:Hn/NP-@|M`R y*-Hf p,/NX.gBHnaP-@` n:Hn/NP-@Jfp/HnNP~ lVxRR`RR`BB L0N^NuNVH *n p-@-M nJgZ fRp nS"@8(Q NfHB.. dr.R nR.` nPp/// NFO B`p n Lg Mf\ nPRHnN8X @-HPr/// NFO .Mf"n iP// aP*@SB`hJWDHHRJg RRJgR` n g4 R`, nRp n g :fp`p-@R`B L0N^NuNVB-y* n g n:/./NP-@Jf"n Q-Hf .N^NuNV-n p n"@PJgR` n.R nJg n"Rp//. /.NFO Ѯ nJg n"R nB N^Nu yJg" 'g :g f ( ^gp`pNupJg oJgR`Nu o"ofNup o"o l gR`BNu oJfS"ofNu / oJjpJgR` oJg fBSfNuNVBJg 9r`p".Ү-@-A n (,mh//((/NaO n 0(Hl n!@,`^ n!n, nS, n (,o n  g nR,`" . n"(,l//((/NaO n ($"(,-A$(m Ө$/</NNPJj* . nѨ$lB$/</.NNP/.NuX n/(,/((/NaO Jgp//.NvP/.NenX-@"<kpfN```\R` `M`G`~K4`<K```^`PP`H`` ```````` ` ``Pa`4`,``ymNYf`6-|a/.NvX .N^Nu/.NvXJgB/.NvP .N^NuJgJjg`&-|P n!n,J$gp //NNP/.NvXJgB/.NvP .N^Nup-@ n!n,f* n (,lp /NgX` n!n,`$ n Bh` nf0-h, n (,lp /NgX` n!n,` n 0(H"n"),l1A` n (,oS,`Jg` nJ,g (,S-@m!@,`Jg -|K` n!n,`v n (,lR,``JgX` n (,P-@l!@,`2Jg -|M`l n 0(Hl n!@,` n!n, nS, n (,o n  g nR,` n (,oS,`Jf n (,lv n-h, n 0(H".lnR/H ."o  o"o o0(H-AfS1@` .f n  `R` f n 0(H n"(,l n  g`< .Jf NaJ` . n"(,l n 2(Hm\S  gLJg< n (,m f -|M`-| n 0(H-@`(NaJ`B .U n -@R2(Hf-@Jjg` n .R/H "o ". o"o o0(HfR1@S . n,l n /H "n ),". o ),". o0(H"),mL n 0(H/H"n"),o$  oR o1@` n 0(R@1@ nR,/.NvX . fN^Nu-|/. /.Nk P 9VJg/9VNl*X`p#6BJ2fp#2 2f. y*(g h^` "y* i:"y*#HxB|` y*B/<NDFXNWNJfN=B 2fP <#7#7Hy/9*NNP 97"97 y*֒//NP`Bp/NPNuNVBN~09*@3*/. N?XB/.N PHz/.NNP-@SgNNAN-@ g n(g hR/NXJgX/.N=\X/.N X`p9 fp9 f~S` *R  o:pC/NX`*Jg F "fS FBJgH-| nJg"p g f n R`/Hy/.N9O LN^NuNVN~p//. /.NuO Rf`p//.N?PNJf@BaFXHzB/.NNPHy NJ g/./9*/. NO `/9*/.N:DP/.N?XN^Nu/<NDXJf p(/NXHyN?XN:r/<HyN=xPJgNJfHyNP. f B`X. fp#~#`<. gR 9mB. g4 fp /aLXp /aBX`p/HyNt>PR~Jzg" 9zй~fHy/DNbX 9~mB~ fp9;/aX`PJg"/<p//HyHyNO09,gNx`"09, gp/NJXp/aXN^NuNV/.HyNޔPHyaXN^NuNV/.aXp/aXN^NuNVH*n fJg$pR/aX`JgpR/aX`L N^NuNVH*n.. Jg( SJg(JgpR/avX`p /ajX`/ axXL N^NuNV .SJgp /a>Xp /a4X`N^NuNVH|za. g g l r0kfN `< `"` ` `` nBR LN^NuR  o pC/NX n R Jf`RpB/NXR  o pC/NX*  nR` opC/NX` nBpLN^NuLN^NuNVH~ lp nR/aXR`LN^NuNVH,. Jg*av. f p@/NX  nRS`LN^NuNVJgap//.N09*f2/<p//HyXHy NOJf p /NX.g4p//.N l6N` `````a `a`ab`ah` an`atNqN^NuNVH 09,gJo`"y* ixJgR"y* ix"P$y*%Ix*g-i` y*-hx n0(,@J@f y*R|S`Jjd"y* ixJgT"y* ix"h$y*%Ix*g-i` y*-hx n0(,@J@f y*S|R`a`09,g . y*Ѩl y*B`D y* (lB`, 9 y*"(Ҁ o"< y*!A-y/Jg nB( Bh n-P` y* (R//(NG(PHz/9*aZPp/NlXLN^NuNV 96 o6N` NJy$g/<ANVX` 2fH09,@3, y* (R//(NG(PHz/9*aPBNlX`^ 2fJg$BN:Xp/N=NXp/aX`$J6g\Na6 y*(g (` y* (/ y*/(|NG(Pp /aXNj:09,@3,`p/aXBN:Xp/N=NX`Jft-yBp/anXBN:Xp/N=NXJgp/HyNt>Pp# y/#/09,@3,#Ba XBN:Xp/N=NXNN^NuNVp n(5"y*֐-@Jknp(6//.Na\Pp./NiPXp)/NiPX nP/N`Jg y**hx` y**h:gR0-,@J@f6/././ aBO Jg Jg 9gp/N=NXJg*m`*U`L0N^NuNVH*nJ gVp./NiPXp)/NiPX MPp-4//N=Pp /N:Xp-/NiPXp(/NiPX`/ aX-@Jgp./NiPXp)/NiPX MP/NXr-AJo/N:RX MP/N"y*0)H(o y3: ((/ y*/( y3:/(0NFO `$ y*"y3:#h$#h(0),@3@, y3:#3:/<NDX` .g/.HyN~P`p y*/<-@NDXHy/936N,P @B$B(-@Jf$1|,./HA&"opQ` f& n1|,./HA&"opQ`\ f0 n1|,./HA&"opQ n|2`" n1|,!y32(|//N,$X y36 (R n@5/NMZX`/<NDX.g4/. /932HyBNJOJf/932N:RX`/.HyN~P/932HyN=P`bJfZ/932N:RX`H y*Jf$/(/(N8P/932/N=P`p y*/@ Jg\ f y&| y* ("(NHy/N˜P y&B(/932HyN=P`J32f" y*Jhgz0(H//(N=P`d y*0(H"932n//(N=P`> y*Jhg0(H//(N=P y*0(H"932/N:RXJ3*g p/N=NXB32`P.g . /r///NJO#&& y( ;gJf p/N=NXN^NuNVJ32fp n(7#32J3&g93)g93)gbJ3:gb y3:0(,g"n/)$/(0N8P`" n"y3:#h$$#h((0),@3@, y3:#3:` 93(f nP//936N,P n2(,A"@3A,-I..pQg n"n#h((|// N,$X` nB$B( nJgB hpRB/NFP n!@"n ipR/"n/)/NLO nJ gB h pRB/NFP n!@ "n i pR/"n/) /NLO y36 (R"n@5/ NMZX y36Jpf"n0),g/./NP y36!@p"n0),@3@,` n0(,g Jfv93)g@ n0(,g /93&/932B/NJOJf>/932N:RX`,pU/NorXJg&/<NDX/932HyN=P` nP/932/N=P` n0(,gfJg^09*@3*B/N|P09* gp/BN0*P`p/BN0*P09 XHr//N,P`fJ3*gBJ3.gp///.NLO `/93*B/.NLO p/N=NX`/.NN`X/932/N=PB32 n0(,g!h0$pN^NuNV0p-@-@-@-@Jg209,@3,-y!rD-y!v@-y!~<-y!z8`009,@3,-|eD-|e@-|e<-| e8Hy`Hy Hn~N24O HygHy HnHN24O B!n6N` yp//.@/.D-H-HNlO # nDJg-H`-| f09*@3*-y*N"#*36#*/</.aP y36Jpf*"h:/ /NP y36!@p"h:0),@3@,/936NXp#p-@`B36Jg, nPJg"n Q-Hg (gp//-HaPSf` n@Jg/NXRfNJg p /NX fNB/936N P y36#:3:/</.a~P/936N=\X/936N X`6.g .".ܲfPSg4"n i-Hf .g@Jgr .".N#3NJfN3No/.N&XB/93NNFP#B-@-@ .İlF y"P3VB-I .Ȱl n"nRRR`R`/93JHyNP/93FHyNP`< .DHnHHn~/././NO .ѮNHn~N?Xp-@ f:#p4/NDXBHyN?P09,@3,NxB .İl-y*JgZ n(gNJgAp//N>P` n-PX . n"(g!@/NX n-P`J/g/./.Hy/NO BNJg p /NXJf B/.aPR`:N@J/g2p//.Hy/NO J9/lg#//2Hy/`NbX` y/#/.p //.aVP y/0(Fgp//.a8P y/0(Fg`-y/.JgD y/ (BN>/@ n ( /A"($$/&/Nx!@ !A$ n-P`p//.aP y/0(Fg,HyNRp nrpkfN``q`~````^```pt`RN`DM` L`.g$RHnN8X"@ i-@`0X`pX`j.gb y*`T.gLS n N^Nu.g6R`0JfS n N^NuS`.gS n N^NuR` n "fR nJgR "g` n :f.gR`lR`d .N^NuNV y f (. gpN^NuTpN^NuNVp. /aXJf p. S @8pn//NPN^NuNV#3>#3B# yJgp (g "g fRp yr(kfNN`h `\O`TM` L`RHyN8X y-@ f^p(/. //.aRO `DN^NuXR`0R yJgR "g`N^NuR`N^NuNVH pr.-@-@mV lNN``"`(`.`6`<`:`8`p-@Jg2p-@`*p -@`"p-@`-|`p@-@`LN^Nu y( frJgTp( Lg Mf y*!@"y*#A .Jg n/H y*"op Q` nX/H y*"op QLN^NuNVB-y3>Jg4"n if"n if n-h` .N^NuNVH J g"n i$n g:"n i/Hy*N(P"n i"y3>/ /Hy*NJO n#3>R3BLN^NuNVp-@B/./. /.aO JfB n(g"n iR/NXRgtJfB/.N P`^ . g fp-@` fp-@ .R olBNJg\B/.N PNq .N^NuNV n(g n "nf .m lN````````& n (1Jg /N ^X".// n/(/NjO-@Jf n (0Jgp-@ .N^Nu n(!g/N ^X".// n/(/NjOpN^Nu/.B/. /.NjO-@ n(!g //.aPJg0B`* n (Jg//.aPJoB .N^Nu/.B/. /.NjO-@ n(!g //.aXPJg.B`( n (0Jg //.a.PJjB .N^Nu/.B/. /.NjON^NuNV n Sf."n i"h n 0(H//(/)0NӘO N^Nu"n i"h )$")( n $(&(NNN^NuNVBR!n09,fxJ!fg N9-@HyNX-@Jg>"9 rN-@Jo/N:RX .ѮHyN`&m` y/0(F@1@Fp-@`B -y/`p-@ B/9/ Hy/NpO @-HPp/pD//NO R y f ( Lg y( MfPTHyN8X n!@6"@2),g")(RB/NFP n!@: @BS`p)//9ìNP`p-@`p-@` n0(F@1@F`RHyN8XS @2(,-@frW//N?*P nP"nP/ /NP-@Jf& nP"nP/ $n/* /NpO -@ nB B$!n .@ n2(FH1AFR` y "f|p/NDXJg nPHy/NP-@Jf$ nPHy"n/) /NpO -@ nB B$ .@ n2(FH1AF`(R` .LN^NuNV-y/JgL n-hJg2 nJfP/./NPJf n!n  n-P` n-P`N^NuNV-y/JgH nP/N|X nJ6g$"h60),g: )(R//NP n-P`Hy/N|X#/2p/P/B/l/^#z09,@3,N^NuNVB fp`p n#/2-@"y/2 Q#/2gpJfXJfR"h60),g/)0/(:NPJg0p-@`("y/2 i6 ):")>$($&((Ngp-@ . y/21@H`| n#/2"n Q"y/2g i60(,g`JiHfJg g y/2(/NbX y/2/(:HnN8P"y/2 i6/(0/):N8P` y/2JhHfJg g y/2(/NbX"y/2 i60(,g0.#& y/2/(>/(:N8P/HnN8P`. y/2 (:"(>N h6./Hn/NrO "y/2 i6#h$:#h(> y/2JhHg|#/. y/2J(4fJWDHHRJgp//. NQP y/20(Fgp//. NQP y/20(Fgb-y/.JgD y/2 (BN>/@ n ( /A"($$/&/Nx!@ !A$ n-P`p//. NQP y/20(Fg:HyN .Y y"P .Y$y $ .-INq lR .op`FLN^NuNV-yJj ."93VҀD-@-A` B-y3V/.aXJ gPp-@-@` p-@-n p//.-@-@N?PJgJfJf0Jf` . y/93V//93RNO Jo6 . y"P/./ N>PR .mR` y3R/./N>PR . l/93V/93RN>P`JR`BN@N@/.NX# . N^NuNVH .^-@J3^fA3Z#3Z3]#3^B*y3^&MfxR . oh.<?/NTX(@f pL8N^Nu MX"g *Y*L M"(A*(3Z#"f*K-fX&M (@,f*` L" "M $ . .e(c * @ #3^ MX L8N^Nu *@`NVH nY*H-f pL N^Nu#3^pL N^NuNVp/NTX-|3Z-@ n -@(f"Ѯ-n n3Zf .N^NuNV/. /.aTP-@Jfp/aX/<NX .N^NuNV/. /.aP-@JfBaX .N^NuNV/.aX-@JfN^NuJ gB/./.NnO .ѹ .N^NuNV nJg(/aXJg p?/NX nB .  N^NuNVAH/p/N`PN^Nu y*JgpNu y* ("($<vNfpNu y* (fpNupNuNV/.aXaSfpN^NupN^NuNV yJfprN^Nu/9aX# y*Sf r/NXJg@ y* ("(tvNm .N>$(&(Nl p/NX y* ("(N^NuNV yJfpN^Nu/9aRX# y*Sf 2(Ho p/NX y*0(H//(HyNFO N^NuNVH*n##**/ a XL N^NuNVH$*nA~|-H (f$R M/aX*@R )gRp/NX`D f0- OfJGWDHH.T` fDFT` fT`/ NX*@ H gT y*Sg:N>/@ (/A"($/&/N y*!@"y*#A` p/NX|JGgL y*Sg2 ("($ y*!@"y*#A` y*BHnN~X .N> y*!@"y*#A`Z y*BHnNX .N> y*!@"y*#A`z l nXRR`Jfp$/NX` n (fB/.HnNO S* n($"y*Jf$"h " y*!Q!i`"n i "/H"y*#P o/NX y*1@`L n($"y*Jf#h#h`( n"h$y*%I/(NX y*1@`p/HnN8P @2(,-@g<"y*"h$$y*%I/($NX y*1@ n!h0$` n0(,g y*`" n0(,g y*` y*B n"y*#h$#h(`J y*J/2g y/2J6f y*!|: y*Bh`"y/2 i60(,g> y*"y/2 i:"y*#H y/2/(:NX y*1@`"y/2 i60(,g y*`("y/2 i60(,g y*` y*B y/2"y*#h:#h>`Z y*B 9!nN> y*!@"y*#A`. y*BJ/2f y*BB` Xf( y/2 (BN> y*!@"y*#A` n f ( Lg n( Mf@THnN8X y/2-h-@Jg"n igz n-P`/.NX-@ y*Sg r /NX y*0(H//(HyNFO y/2PHy/NP *-@Jf p)/NX r0k䰻fN``d`Fl`$` ` y/2 Bl y*BB` n ( "($$( &($N/@ y/2 (B/AN>/@ //A "/$/&/ Nx/@ n ((/A"(,$/&/N y/2$(BS/@ /AN>/@ //A "/$/&/ Nx y*!@"y*#A f )//Nz*P y*!@"y*#A` n"y*#h #h$`~ y/2 (BN>/@ n ( /A"($$/&/Nx y*!@"y*#A`4 n"y*#h0#h4` n"y*#h8#h<` *  e Kc" S @8p"//NPS n/NX-@` n "fT"y*R y*!n y*Bh nJghR "gZ y*0(R@ y*1@` y*BzK nr APgF .f RJg0p'/NX`" Aꐈ"Rm p&/NXRR` efR MR"nR f,"nR fR-` gp'/NX`S| nr APg l RRR`Jg o p'/NXBAf pS/NXHnNߜX y*!@"y*#A .L$N^NuNVH$*nRR (g p/NX/ NX*@ rPk .fN?` G` `,`0-`(+` D``` 7` y*Sf p/NX ,fR M/NX*@ y*Sg p /NX y*0(H//(HyNFO HyHnN.HP * y* ("(NHnHy/NrO `@ 7f y&| y* ("(NHy/N˜P y&B(HyaX` y*Jg p/NX ,f\A&CpQR M/NX*@ y*Sf<0(H//(HyNFO HyHnN**P *` y*Jf ("(tvNl p /NXB. y* ("(N@ * ,f^R M/NX*@ y*Jf ("(tvNl p /NX y* ("(N@ *p.r.Ё c pJ/NXJ.f| A#& y*/(/(N8P/a X`R ,g p/NXR g p)/NXp Lg MfR` p)/NX-MHnN8X*n @2(,-@f p/NX/. n/(NzP/9*-@N ^X/<//. n/(NjO-@Jg< n0(,g."y*Sf"0)H//(0/)NO JgBJf"n i y*BB`$"n i y*!|!| y*B` y*Sg p/NXR ,g p/NX/ NX*@ y*Sg$ ("(tvNm$<@ovNo p /NX  ,g -gP +f * y*0(HN>$(&(No "N y*1@` * y*0(H/@ N>$(&(No "N"/ Ө y* ("(N y*1@`V )f* * y*B y*!|@o!|`b ,fNR M/NX*@ y*Sg$ ("(tvNm$<@ovNop /NX` p/NX y*0(HN>$( &(NlBh` y*0(HN>$( &(N$$/ &/NN y*1@ ( "(NSѨ*` y*Sf p/NXR ,g p/NX/ NX*@ y*Sg$ ("(tvNm$<@*vNo p /NX * y* ("(N//(/(a4O y*!@"y*#A` R ,g p/NX y*Sg p/NX/ NX*@ y*Sg$ ("(tvNm$<@ovNo p /NX y* ("(N * y-H"y*2)H-@-@N ye p!/NX .SJg* y*0(H//(/9NFO ѹ` y*!n y*0(H".N y*1@` p y*-@Sg> ("(N *R-@ ,g p/NX/ NX*@ y*Sg p /NXR ,g p/NX/ NX*@ y*Sg p /NX * y*B y*0(H2(H/.//(//(a ON> y*!@"y*#A`  )g p/NX +d y*Sf>p/NX`0 y*Sg$  1e y*!@"y*#A` y*B y*0(H//(HyNFO p9/N*XH/NXN> y*!@"y*#A` y*B /N%hX y*!@"y*#A`d 9RN> y*!@"y*#A`> 9RN> y*!@"y*#A` y* ("(tvNoD 9N>$(&(No( "$ y*!@"y*#A` y* ("(tvNoD 9N>$(&(No( "$ y*!@"y*#A` /aXN> y*!@"y*#AB` /aXN> y*!@"y*#AB` /aX-@Jg @/aX`Hy:aX`r /aX-@Jg @@/ajX`DHy:aZX`4 y*/(/(NP y*!@"y*#A` y*/(/(NmP y*!@"y*#A` y*B y*0(0(HN> y*!@"y*#A` y* ("(tvNn p/NX y*/(/(NRP y*!@"y*#A`N y* ("(tvNo.Nf y*!@"y*#A )#T#X` y* (f!yT!yX` y* ("($<vNm$/@ ./A". $/&/N$/@ //A "/$/&/ NxN^NuNVJg .opN^Nu .".SӮ-@B . n"nfR . m .N^NuR .RmpN^NuNV"n#H"#H .3@#n N^NuNV n-P"n Q-HgP/. /NPJkNqJf n-h` n-h/. /./.aO N^NuNV/././. /.a"O-@JgN^Nu/<NXN^NuNVJj/.NXR-@ n ( Юr//-@NP-@JgB @ /./N8P n .S1@ ."n 1@/. // aO .N^NuNV/./. /.a"O -@JgN^Nu/<NXN^NuNVJgb n0(g/.NXR-@`B n ( Юr//NP-@JfN^Nu nP/./N8P` p/ n/( NP-@JfN^Nu/. /./.a O .N^NuNV n"n #Hg" ` n"n " n Jg"P#H` n!n  nRN^NuNVJ f . N^Nu n -P//.alP n0(g"n P/ NXR-@`" n0(g n 0(H-@`B n ( Ю/Hn NP .N^NuNV n Jg h"n ` n "n" n Jg P"n !i` n "n#h nSN^NuNV nJg/(/aP`N^NuNV/. n/aPN^NuNVJg* nP/. /NPJf .N^Nu n-P`pN^NuNVB/<Hy/nNO .SJg"B/9/rHy/nNO -@JfNq#/vN^NuNV-y/nJg/.aXX n-P`Hy/nN|XN^NuNVH*y/ng -f - g*U` L N^NuNV nJgt (HB//( NO n g pM/NX n (H//</NO g pL/NX nB!|N^NuNV-y/nJg( n (f/aVX nB n-P`N^NuNVH nJf^ .HB//.NO g pM/NX .H/. /./NO g pK/NXL N^Nu .-@/./.apP*@f*y/r/ aXp+@ .HB//.NO g pM/NX .H M//</NO +@ @l pK/NX - l M"<B//NnO +n+n M/Hy/nN(P MB/Hy/nNJO .".Ҁ oT"< M//. /-ANLO .Ѯ p/Hy\-@NP` M/./. /NLO L N^NuNVH .-@ n".//.aP*@gh M/Hy/nN(P MB/Hy/nNJO M/.//. NLO p+@ g/ aX` .HB//.NO g pM/NX .H/. /./NO g pL/NXJg" g/././. /.aOL N^NuNV# &B/.aP#&&N^NuNV-n y&J(f .gp/p/HnaO -@Jkp/p;/HnaO -@Jkp/p;/HnaO -@Jkp//<HnaO -@Jkr n fR`p n ag pf0 n< n( mf, n pf HnHna PP`p-@ . lr y&(f"p/p /HnaO -@Jn`p y&(".вfNp//<'HnaO -@Jn` dl< n( 0f ( 0g$l`p/p/HnafO -@JoFR`2HnHnaPHnHnaP .f .N^Nup^//.NPp//.NPN^NuNVp-@-@"n Q fR` f"n Qp @PfB"n Q".r$.6( APJg R nR` .B6p-@ . @@/HnNPJg0 . @/HnNPJg lR`"n Qp-@`P"n Qp @-HPg2 .Rڰl$ .r N".0Ё nR-@` .ް opN^Nu . g( /g ,g -g .g :f nR ,f"n Q fR .N^NuNV n (S @j "n Щ-@ o ` n S-@rN/@ .rdN"/ ./A"<N"/Ҁ n S/A"<mN"/ҀӮ . *l n ` . n N^NuNV#&/. /.aP#&&N^NuNVp-@p-n -@ y&J(fJop-@` p-@BHnHnaPp-@ . lr y&(/Af /-@ f//.Hn aO ` f0R .S @p///. NFO Ѯ ` .S @Dp///. NFO Ѯ ^`Tp y&(/@".Բf" /Ѯ//.Hn -@a,O `p//.Hn aO f( n R "y& ,fR n  R f* n R "y&) ,fR n  R R`Jj .rN-@p-@p-@HnHnaP y&(g(p-@ mR . o p//.Hn a,O n :R p //.Hn a O y&(gZV n :R p //.Hn aO y&(g&X n &R p //.Hn aO Jg> n  R n R /H fpa`pp o n mR V n B . n e"@SS `Jk nS `Jf nJg  R`N^NuNVAӡ/. /-HNޔP-@.g .".l SR` .SoR`"n Q"nRJg nR`N^NuNV n  *lS` n  S-@"<:N"<N n ."<:N-A :f Sp-@`B ."<NrdN n ѐ ."<NҮ -@"<NR n ѐ ."<N-A mB n rdNJf n "<NJf fp`pS-@`B ."<mNW n ѐ ."<mNRp-@-A . @j lR` . n !@ @f .Ю n !@N^NuNV n "<6N/@ n ("<`N"/Ҁ n (/A"<N"/Ҁ n Ҩ n N^NuNV n -@"<6N n "<6N ."<`N n !@"<`N ."<N n !@"<N n !n N^NuNVH. *y* *p y*/@ rgj / gQfNSfHB0-H//-HyNFO p y*/HyNPN>+@+A` p/NX y*Sf m lN`````.`*`&`"```````` y*B/ /9*NJP, fJFg: fJFf0 f Fg$ f Ff  f Fg  f Fg y*!|!|`$ y*BB` y*B y*0(H2-H///-/(NTORf y*!|!|` y*BB` y*B y*0(H2-H///-/(NORf y*!|!|`d y*BB`T/ /9*HyN؜O A"y*#H/NX y*1@#` p/NXL N^Nu m lN`:`j``` ```B```F`@``n` y* ("($-&-N y*!@"y*#A`6 y* ("($-&-N y*!@"y*#A` y* ("($-&-N y*!@"y*#A` -f y*BB` y* ("($-&-Nx y*!@"y*#A`~ y*/(/(atPJf/-/-abPJg p&/NX -"-NJf y*BB`$ y* ("(N/@ -"-N"/ /@ "/N N> y*!@"y*#A` y* ("($-&-Nfp`pN> y*!@"y*#A`F y* ("($-&-Ngp`pN> y*!@"y*#A` y* ("($-&-Nop`pN> y*!@"y*#A` y* ("($-&-Nmp`pN> y*!@"y*#A` y* ("($-&-Nlp`pN> y*!@"y*#A`> y* ("($-&-Nnp`pN> y*!@"y*#A y*B`8 y*/(/(a.PJf/-/-aPJg p/NX y* ("(N/@ -"-N"/ € N> y*!@"y*#A` y*/(/(aPJf/-/-aPJg p/NX y* ("(N/@ -"-N"/ N> y*!@"y*#A`4/-/- y*/(/(N|O y*!@"y*#AL N^NuNV .". $<vNm$ n p/N*X nr//@N*X"/fp-@R` .".JfDpN^Nu n p/N*X nr//@N*X"/gpN^NuRR`0 .g n  *fpN^NupN^NuNVH*n(n &n~| l 0,HJoA"lRR`| l 0+HJoA"kRR` f p!/NXABHn/ N8PL8N^NuNVH B~ y&(|(K3t І-@ lp -@HnHn/./. /.NmPO(@Jg&S L 0fJfR LB`BJf y&gp`p y&-@g/./ aP*@JfJg y&g .-G-@ D".l p-@-@`v .".lh .І".o"S L . 4cS LR`S L . 9c Jf 1R`S LR`R LB .o Їr AӦ(H-G` .lo"JgS Jf` y&J(gR` y&gNJ(gHp(SrN".S/@ rN"/-A .SJg y&R` y&f/./ arP*@Jfb0R`Z . n". l .Sr-A-@ y&f/./ a P*@ l Jg0RJj&RJj0RSR`-n . oW` .SJoF .SJf y&g&Rp-@ MR/HJgpR`p0 o`Jg &R`&Jg" y&J(g( fR`&RRJgSR` SJo y&J(gR`Jf y&gveRJj .rN-R-@` y&J(gR y&J(g& dlR l y&R/./ aPA r-AB-@-@ l/.aXRfBR`NAN`fAp//N>PA-PA  -@p/aXJf  `S .JgNAN`pC//.NPHnHnNP-@Jf*"y* iL-HgXB/(/ NO `Jg:/./9*NP n0(,@ n1@,Jg@ n1@,`B"y* iL"y*#Hpfp/BN$Pp-@ g@/9*NX09*@3* .SJg/9*aXRg NJgNqN@/9*NX09*@3* y*-h:Jg/.NMZX n-P`pN^NuNV fhA/HR-HNAN o fpN^Nup//.N>Pp.r.t.A/Hn-@-A-BN8P`XAp//N>P. gJfpN^Nup.r.t.A/Hn-@-A-BN8PA-H nJg :f_R`Hn/9*N,PJgHyӾHnNfPHn/9*N,P-@ .r(kfND`N`ZM`RC` L` n0(,@1@, .!@(Jf p)/NX n|//N,$X` n0(,@@1@,B(.p @/@2Jgp0`p n@3 .".A0@1B$B(`6 n0(,@@1@,./HA&"opQ nB$B( y* (R n@5/NMZX . n@4pN^NuNVB/9*N PNAN-@ fpN^Nu n-h:Jg( n0(,g0p(4//($N>Pp n(4//($NzP` n0(,gNp(4/HnN>Pp n(4ABHnNߜX n!@$!A(0(,@1@,` n0(,grp(4/HnN>Pp n(4ABp n(4/HnNzPJg0HyӸHnNPN> n!@$!A(0(,@1@, n-P` . gN^Nu/9*N XpN^NuNV/. /.a6P nLB"n/)P/-@NpO @!n !n N^NuNV n-h:p-@ . n g0Jg,R @0(,@J@g n(gS n-P` .N^NuNV/./. /.NO #.-@SfR. y..Jf-|: n ( .f" (.m/.NXX n Ѩ/.aX .m /. aX` /. axX .N^NuNVH p-@-@ . Jl( y.Jg-@ y.RJfV` .S y.1@ 9.-@-@Jk( y. S"y..S.` . y.1@/.aRX y. y."y.#h 9. y.!@ n ( .f" (l "y.!Q ` . n y.p "y."//</$n/*NO y.0(H Rr $9.///"n/)NO y.Jg*"y.p "X/p// n/(NO` 9. n8f y."n#P0B .R y.RJfJ.gfJ.g|/.N.XHnNXJf. y..R.Jf y.//9.NP` y.#.HnaX .l/.aX`B . y.6JgR`R . y.//NPV y.R y.RB .R y.X"//NPR . y.1@p y. y.!@/.aX n!@,R8"y.p "(,//</ /(NOLN^NuNV-y./.NX y.2(HҀX y.1AH#.-A ..m y.S"y.S` y..R."nRJfA.//9.NPN^NuNV n ($-@Jg.$"t /t// n/(NxO nS(` n (4R4-@p n!@ .N^NuNV y. 9. r $9.///"n/)NON^NuNV n-hLJg"n i g-Q` .N^NuNV/. /.aLP/. aX/.aX-@ 9. n 8lR.#..`Jfp`pN^NuNV/. /.NPB. n #,.N^NuNVS. 9. @3#./.aXN^NuNV y.p "9.//</"n/)NxO y. #. y.0(H#. 9. @3 .N^NuNVp-@A-@-H#. y.RJf y.R"nP y.RP y.RPJg,#. y..//.NҖP-@Jn| .N^NuNVp//.N Pp-@J f/./.NPN^NuJg8.f/./. N P-@/./. /.aO -@`B fpN^Nu n /(/alP`( n /(/aP` n (#./a.XJ.g, n !y. !y. n!y./NX`B .N^NuNV y. R JfV . .l$ y. g . #./aX`* y. (#.Jg/.aXHyaXN^NuNVBJ f. y. #.Jg/.a`X 9.R-@ `N^Nu#. y.RJfV . m/9.aXN^NuNV-|. y.RJf y.R"nP y.RP y.PN^NuNV y.R"n  y.R y.N^NuNVH n-h:-y. y.X(H y."n )/H&H")N/ n/(///(NxO ng pG/NX nf pH/NX n0(,@1@,g* g"*h0p(/-@"((NЮS,` K|B~TRfx n JgJ y."n")/HN//// n/(NxO ng"pG/NX` y.X(HgBR` y.X(Hg RR`BRJ.ffJf n0(,g"/A n"(N/r/// n/(NxO nS` n (R-@p n!@ .N^NuNV  fp n!@#3 n (-y.R-@3fR . ndp"y."(/IN/r/// n/(NxO n  f&  n!n/#3aXpN^NuR`pN^NuNVHA-H .". tvNl~ l nFR` n p n/@ /(~ n: G W"nr t"U"nr੄R`p n(A LN^NuNVHp n/@ /(~ n: G W"nr t"U"nr੄R`p n(A LN^NuNVHR n p!@ . l nR`p nr(≀ n ~ l8 R n T"np"$V"ntv䫀R`LN^NuNV n0(,g(/ c-| Bn0.Hr n(/dJ ((R2.HN"n i0-H nJg"nRR` n RRn`S nBA N^Nu n (0N^Nu n0(,g A: N^Nu n$ /aXN^NuNV n ((Rr(/N"n i0-HSS n "n n "n0bBn0.Hr n(/dl ((R2.HN"n i0Bn-H nJg4 g&2.H n(l n R R=AR`RNq n BRn`N^NuNVp-@ n JfN^Nu/.NXp//.N P nC0<!Qp/Hn/Hn/. NOJ.f nP/HnN8PBHnNPB/N:PJfp+/HnNPl n-hLJg nB -P`HnNX/.NX n (Hr//BNO -@ gr n"(N-@ n"(m"(N o@ . nn n ( n!@/<p//HyHyoNOp#ӴHy2NrXJg*/<p///HyXNOSf^p-@`/.NX/./.NPJg6p-@Hy2NrXJfBHnN XNJgjNqBӴHnNX/.NX n (g"/<p//HyHyoNON^NuNVH p//.aP n-hLJgf"n i0(, gJ nJg g: n/(aX//./.NO Sfp9/ n/(N?*P n-P` nJg /NX/.NLX-@ nJfRR n-hLJg nJgP$n"j0), gd/(/*/ /NO n/(aZX/.//./.N&O`& n/(a2X/.//./.N&O"n i0(,@1@,-Q`^ n!nLN^NuNV nJf p:/NXp//.aRP n-hLJg2 n/(aX n/(//./NO n-P`/.NX nSp!@p/B/. /NjON^NuNV n-h: n0(,@1@, g/N=X`J fz n0(,gT!h0$(/@=@0.SnJ@g$ n ((R2.HN"n i$B` n0(,@1@,` nB$B(0(,@@1@,"n Q-HfJ nBN^NuNV n(f ( Jf nPp//NP n#*/NXN^NuNV n(fPp//NPN^NuNV n0(,g/(0aHXN^Nu n0(,g A N^Nu n/((/($NVPN^NuNV nSfB0( @dmpd` n0(H/ n/(Hn-@NFO HnaXN^Nu n/(/(NVPN^NuNV"n i0(,g/. aXN^Nu"n i0(,H -@Jg$//. NPN>//NVPN^Nup9&/Hn/. NO Jg/./.NVPN^NuHy:aXN^NuNVH nJfA LN^Nu~ dl0 G3p"n$@PJWDHHRJfR`A3 LN^NuNVp//.aP/. /.NP//.-@NP n 0(,@1@,"n#npp/p/// NjOSf n/(aX n/(//./N&O-@JgBSf>B/. NNX/<9/N$PJfp//. /.NO N^Nup/p///.NjOSgp/./.NxP nP/NXJg n 0(,@1@,/.N`XN^NuNV n/a4Xp@ n!@-| . l( n"(orN n!@ .-@`B/.a^Pr//aLP n!@!|@p!@!@p!@!@B/N P n/aX n B n/(//(NO n/aX nB/a X n-hLJg/./.aP n-P`/.N>X nNN^NuNV/.N Xp//.abPB/N?Pp;//.N4Pp/N=NX n-h^Jg"n iP/NX n Br9// n/(NxO n/aX"n iL-Hf p/NXJ o . n`J fJ.f nJ(f J(fJ(g|B9 nP/<p /Hy/HyUNOSfJ-|p /HnHnN$O p /HnHnN$O p /HnHnN$O Hn/.aPJgP/./.aTPB/aP n!@$ Br// n/(NxO n!h0 -P` np/B/(p/NjOJf n .N^NuNVp//.a\P/N?X/<6HnN=xP-@JgJ.fvp/HnN=xP-@Jg n:Hn/NP-@Jg n^B"n/)b/NO -@Jg n!n nR`UA >f$/<HnN=xPJg\ASBA >f /<HnN=xPJg(ABHnHnHn/.N&O`N@N^NuNVB . !l nJg R`N^NuNV n"n / /NҖPJf n` nJ(gJ"n / /NҖPJg n"n / /NҖPJf n`J nJ(g@/. /NҖPJg n"n / /NҖPJf n n(f p/NXN^NuNV n/Hy4DN8P nP/Hy4DNfPJ gHyEHy4DNfP`Hy@Hy4DNfPA4D N^NuNV n J g ( ` n /(/.NP n/Hy4y-@N8P nP/Hy4yNfP/.HyNޔPHyHy4yNfPA4y N^NuNVJ g&B/.aTP-@Rf8p4//.NP`&p//.a,P-@Rfp4//.NPR. .N^NuNVp//.aP=@H g/NXpN^NupN^NuNV/. /.BNO J@g p[/NXpN^NuNV/.NXJ@jp5//.NPN^NuNV nJfB/aPB/aP n!@N^NuNV n Jfr//.a@PB/aP n !@J fN"n)fB$ Br// n /(NxO n !h0 /(/.NP n !@ N^NuNVJ f4 nJg\ Br// n/(NO nB`2 n Jg($ Br// n /(NO n BN^NuNV n gX fJ.g 9.R#./9./. NP y..JfJ.fB .R y..R.Jf/./. aP/. a^X-@J.g HnN*X/. N>X`N y.Jg,X r y.$X/r// n /(NO y.Jg"p "(/p//"n /)NO n $ r $9./r// n /(NO 9. n !@$0f "y.!i0 n R(p!@J.g"y.Jg/./a P`N^NuNV-y./.N.X/. NXJg p=/NX ..g p>/NXN^NuNV 9.-@-@ y.RJfV 9. n8f y..Jg ..op y."( /p/Hn n/(NxOJ.f .YB-@ . l y.RR`/.N>X y.#./.NZXp#.r-A-@` . y.JfY-@ ..op`p y.-@JfB ..n y.R"y.R`JoS .#. y.1@ .N^NuNVpQ/NDXHnHnHyalO Jg p+/NXHy@HnNfPBHnN:PJf p+/NXHnaPX#* @-HHn/N8P nHn/N8P nHn/N8PN^NuNVp/Hn/Hn/.NOHn/9*Hy*NpO @-HHn/N8P n!|:p/p8//NO nLBpN^NuHyHy*NP-@Jf p/HyNP` aT-y* .r kfNC`hB`BA`"I` n (N>-@-A`R n (N>-@-A`: n(g.-|-|` n(g-|-| .".N^NuNV/<Hn HyN$O Hy/.aP/<Hn Hy-@N$O #-@ yJg fR`B . ld @4p///9NӘO Jf:T . @Լ"n2),H3A, @ FH€3A,`R`R`h/<Hn HyN$O n2(,H-@-Ap(krfN`n`h`,`$` n.Hy/N**P` n.Hy/N.HP nB$B(0(,@@1@,`Jfp)//.aPHyN"X n!@(Jf p)//aP# yR f y Uf"n|.R`> y Lf"n|.R` y Cf"n|.R y MfR y/N"X`p n@//aX`p-//.aP n0(,g //.NP-@ nJpf!@p/.NMZX/<Hn HyN$O -@Jg,HyN"X n@5r(5"neR#A/<Hn HyN$O -@JgHyN"X n@6/<Hn HyN$O -@JgR#` n#/NXR-@ n0(,@ J@gbJgB .RB/NFP n!@ @R/.//9NLO "n i . n#/NXR-@ n0(,gHJgB .RB/NFP n!@ @R/.//9NLO "n i .N^NuNV n-h:Jg& n/a(X n /aX n-P` nN^NuNV nJg"PRBHn/ N6O p/Hy HnN O R"n QrR// -@NP .RB/NFP n "@R/./ Hy NLO "n Q .N^NuNV n ((R(/A=@B/=ANFP n!@$!@00.SnJ@g0."n i$B`N^NuNV/. /.aDP-@Jg//. NP n:/. "n/)>/NpO @!nN^NuNVp//. NzP-n n fR` . ng //N8P n Jg*p"@PfBHn/N6O Jgp.N^Nu-n nJg.p"@PJf g _fR`p.N^Nu n:/. /NPJgp*N^NupN^NuNVH Jg"/.aXJg nPpz//NPNljN'4 n(gN/.NX n$n"jpR//NP n^/N|X"n i>-Hg/aX n /aX n0(,g,0"n )(Rr)//HN///NP n0(,g/. //.NO n:/./NP`ZJ g2B/.NP/NXp//.NP/NX/.Hy*NP-@Jf-y* y*ֱf#*NLN^NuNV n-y*Jg ngp n-h:JgN n0(,@J@f4 nJgp //(NmP nJ gp //( NmP n-P` n(gpN^Nu n-P`tpN^NuNV nJg"PpR//NP nBN^NuNVN:rHy8NXHnN|Xp/N=NX-y*JgNNJfDHyN/N:X . Jg p>/N:Xp/N=NX . Jg: nJg$ hRHy/NPHyN,HJg S l fS`0-,g8(o/<// aP.-(p-.///,/-$NюO`0-,@ J@gj//,HyNFO 9Jf0-,@@;@,B$B(`0-,@;@, M./HyNPN>+@$+A(`zp0// atP`l0-,gp1// a\P`T-1Uf p//,/,NO +@$+A(` +l$+l(Uf0-,@@;@,` 0-,@;@,0-,@;@, m0-,g /- / a PL0N^NuNV n  cR/NX-@NBSg n ft( ^fjT/NX y*-@Sf 0( @op//.a\P y*0(H//(HyNFO p3/HyNP`p3//.aPN^NuNV"n i c*-yR#p/// N(NO #N^NuNVp9//.aP/.aPXN^NuNV . S Jg4 n-h:Jg n0(,@ @ f/adX n-P`N^NuNV n-h:Jg n0(,?@@J@g40/g"h0B@1@,`n nB$B(0(,@@1@,`T n0(,g,g "h0Jg n0(,gp2//.aP n0(,g /( /aP n-P`RN^NuNVp n!@!@-h:Jg" n0(,@J@f nR n-P` n-h^Jg&"n i0(,@J@f nR n-P` nB|(g h^`"n i:"n#HxN^NuNV nP/HnN8PHyDHnNfP"n iP/HnNfP/. HnNPN^NuNV n0(,g!h0$N^NuNV y&`J(g:Jf2/<p//HyXHysNOJf p /NX y&`B(Hy1N|X/9&`N|Xp/p//9&`NO y&`B(, y&` f-h`P y&`/N|X y&`Bp //NO y&`p///NpO -@ n1|1|K B/ y&`J$f p!@$NYfJg y&`,//9&`NPN^NuNVp-@-@-@-@Jf*p0/NDXJf p(/NXpT/a ,X-@HnHnHnHnHyNOHyTHnNPJfp-@`&J.f Jfp-@HyTHyNfPHyN?XJf^BaXB y&`,Hn/N8P y&`,/HJgC`C/ //NfP y&`!n$` y&`-h-h$Jgp-@`&p-@BnNYf"y&` iBh1| Hn/./<HyNBTO-@Jg9 fJg4 y&`B/./NO -@JfR`p-@` y&`-hp/HyHnNFO nHn/HN"X o1@ nHy/HN"X o1@ `0/.Hy y&`/(/NO-@JfR`T n .@ B`N@ y&`J$g* h0( H2(Hr// y&`/NfO y&`Jg "hJi g p/Hy: y&`/(/NO y&`,//9&`NPJg/<NXN^NuNVp-@p0/NDXJf. y&`J(,g,/HyN8P` p(/NX y&`J$gHyTHyNfP`Bp/HyN?P y&`J(,f.,Hy/HNXY/Hy//NFO y&`-P-hJg8 n( fJgBp/N:X n0(H/HyNޔPp/HyN=P n0( H/HyNޔPp/HyN=Pp/N=NX nJg-P n( g p/N:X n( g p/N:X n( g p/N:X n /N f n+RB` n-R nRRR` y/0(HC<0( HA>=|HnHy NkJPp#n#@N^NuNV#&`Jp#^/<Hy NNP/.HyN8Pp/aXpN^NuNVNJfNR p9 yJ"(N#RNL-yB 9@29 H$9 ԁ#@"9$R=@=Aa-y/-y/J^f Bn0. @lHARn`Jng"JgS`ap9ѹ@Sn0.SnJ@gBnJgJgS`JVg" n/fHy/Hy Nk P`\ n/H p"o) "n2)H//Hn/aOJgHnHy Nk P`HnHy NkJP np( /Nl*X"n Q-Hg.( g$ nJg-P`BnHnHy NkJPp9ѹ@`0.H#@#NN^NuNVB n /H "o-H-IJ^f//.NP o1@` n .1@ .SJg n R nR` .p-@-@ nJglp g g f n`n`nRR` n"nRR . nR n 0(R@1@` nB .N^NuNV yJ#/ yJ&`f "y&` i`A1-y,-H .SJg.J/g&"y/ Q#/( g nJg-P`#//#/ 9n-@ .4l. y/Jg$R"P#/) g nJg-P` . y/g0#/ @2(H#b2( H#fJngq .N^NuNVa*Jg ./NorXJg .N^NupN^Nu y ,f RpNupNuNVp-n n-P-@-@ .lp nr(kdfN `>`*`` `^n`n`nR`-n-n-nRRR`t nJg gJg n Jf n n .N^Nu n n .쐮N^NuNVN~p/ n/(p/NuO Rf@J gp#Nsa.BNtp/ n/(p/NuO JfNqN^NuNVH0 y*-Hf p,/NXN:r y% r"@) -y&EG-K-@-A-JJg\ n( g nJg-P n -H nJgV &f6pCR-@-@-@-I nJg &fR`r n .f"nBR-nR n -f RR` n"nRR .R o nBp./HnNP`x nBJg*/.Hy*NP-@Jfp//.NPB-|/9xHnNPJf HnN~X/./.N˜P`/9|HnNPJf4HnNX y&|/./.N˜P y&B(`> n:Hn/NP-@Jfp/HnNP/.NNX-@JgF .TѮ nJgJg"nRRS` .SJg& n R` nJg"nRR` nαc/.HnHn/.aO-@` n"nRR` nB/.HnHn/.aO-@ n( g A"nγfNJf"n Q-HgC$nεfp( -@` nR n( g nR n( g nR n( g nR`N:L N^NuNV n0( H2(H-n-@/HnHn/.-@NMO-@ n@JgB n0(H/N:RX-n/.BNG^P nJgpmn lfN```.`Bp//.NG^P-@`Tp //.NG^P-@`>p@//.NG^P-@`( .//NG^P-@`p n/N:XR`d .//NG^Pp/N=NXJ.gd n . n  fR` n/<//.NFO -@ nR n"n "` n  .N^NuNV y*0(H//(HyNFO JfpN^NuHyN?XHnp//<HyNBTO-@Jg0S/././. HyNORfN@pN^NuN@pN^NuNJf Ba< gN#&d&#:Nb^N^fNup#aNupo/NorXJgp/N?X`:pi/NorXJgNlj`"/<NorXJgN'4`p/aXNuNVJg:Jf2/<p//HyXHy VNOJf p /NXHy&dN|Xp/p/Hy&dNO B9I#&d&#:p##~NhNb^JgHyIHy&dNPN^Nupo/NorXJgp/BNjP`Rpi/NorXJgN%RNN`4/<NorXJgN%RN"v`N^p//NjPNu/<NorXJgN^`Ppi/NorXJgNi`8/<NorXJgN$z`po/NorXJg BN@X`aNuNVBp0/NDXJf p(/NXHyJHyNfPHyN?XpT/NMRXJf0BaXHyNXY/HyHyINFO /<HyN=xP-@Jg"HyHyFNҖPJfp#~-@J^f&NJn`HyHyKNҖPJfp-@Jg"/<HyN=xP-|-@`-|J~gBHyaxPJf p/HyHyN6O p-@/././9&hHy&dNOJf"HyIHy&dNP/<NX/<HyN=xP-@JfdN@HyIHy&dNPJgaN^Nu/<NorXJg N"`/<NorXJg N2`pi/NorXJgNj`f/<NorXJgN$`Lpo/NorXJgND`4/<NorXJgUNyv/N`X` /9~aXNuNVp0/NDXJf*J9IgHyIHyN8P` p(/NXHyJHyNfPp/HyN?PJ9If(HyNXY/HyHyINFO po/NMRX-@JgBJf$JgHyON yJg4pp/NorXJg yJfR`#:`R` ^fTJfN y& p/Hy"/N O #"p^/NorXJfTp"//9¬NP`@ fBJf`,S`2p(//9NmP#r^/NorX yJgNN^NuB/9NmP#NuNV y ,fR yJg  :f y f ( gnB/9NmP# @JfH"y&Jf r/NX"y& Q#& #Jg yR g`R`|THnHnHnN'~O /9NX#Jg/./9*/.NO `/9*/.N:DP/.N?XNMJfN^NuNJga2`.N\^#&"@ i#&g #:`aNu#&d&#:NuBa&XNuNV/<NorXJg/9NX#BHnNX-n y*Sg\ ("(tvNm$<@vNo p/NX y* ("($<@@vNNnѮ-@`8 y*0(H//(HyNFO p/HyNP-@ .c0BHnNXNJgp /NX`p/aXN^NuNVAHnHnHn-HN'~O -@JygR-y7~Bn092.@l(H/A A7~ /R"@7~ Rn`09S@3`ZHyNeX-@RfJfJf8 n"R`*HyNenX-@ fp/BN0*P`JgZ nPf8Jg*HyNenX-@ fp/BN0*P`p0-@` . nR`&p" nR . nR n"R nBHnNXJg /9*/.N:DP/.N?X`/./9*/.NO N^NuNVBp y ;g| @fRNO` y &f R/<NXN-@`/<NDXJgHyN: // -@N(P n:"n$n/*/ /NJO n/(FHnNP n` p)/NXLN^NuNV/<NDXJf p)/NXHyHnN8Pp@@NMJgj/<NDXJgHyHnN8PHnNXNMJg0/<NDXJgHyHnN8PHnNXHnHnHn/.N&ON^NuNVp/NDXJf p(/NXHyHy*NP-@Jfp/HyNP n(fp+/HyNP"n iLf p/NX/.N+@X/.NXN^NuNVpQ/NDXHnHnHyN$$O -@Jfp/HnNPp//.N P nHn/N8P nHn/N8P nHn/N8P n/NX n Br9// n/(NON^NuNVarq/-@NorXp4/NDXHy/.N8PN^NuNV/<NorXJg6/<NDXJf p(/NXHyNRXNW`/<NorXJg$BNX/9*aX y*!@p`/<NorXJgaN @-H^/N|X n!h:xp!@|!@pL/NorXJfpM/NorXJgpHyN8X-@"@ igPpx// NP n^B"n/)b/NO -@Jg n!n nRNM`r nJg!h^x hb/(NMZX`/<NDXJf p(/NX/<NorX/<NorXJgHyN?X`v/<NorXJg4NtN@BHyN?Pp#p##~`0pT/NorXJgp/HyN?P` p)/NXN^NuNV y fRp yRr8kfN`T`~`vt```<``N`bUar/B/-@N-O `@a @!h:xB|-@`$p/NX`N@`N@`UN^NuUa#*BNXNuN%RU/9*aX y*!@pBNXNuNVH /<NorXJgFUaH/-@N X nP/HyN8Pp///.N-O `/<NorXJgvUBaxX"@ i$h/ -@-JN X n Tl p/NXp/ n/(/.NO /.N`XBNX`Bpa/NorXJg2/<NoXUa\/-@NX/.N!XLN^NuNV/<NorXJgUa/-@N1X`N08N^NuNV/<NorXJgNp/NDXJfp(/NX`NHyHy*NP-@Jf2p/HyNP` y*-Hf p,/NX .N^NuNV/<NorXJgpL/NorXJfpM/NorXJfp)/NX`HyN8X-@ n0(,fp//N?*PJg/./.NzP-@`$/. n/(NzP-@` n-hpJf p/NX .N^Nu/<NorXJg"Jy$f pr/NXp/NrX`NyvB/N PNuNVBNMJg$p/NXN-@Uf NxN^Nu/<NorXJg*Jy$f pr/NX ./NX`2Nyv/-@N=\X/.N XJf /.NXN^NuN%R09 XHr//N,PNGNuNVp/<-@-@-@NorXJgR y f p(-@ .rHkfN```n]`\Y`Jg`8`&b```p-@`p-@`p-@`p-@`p-@`p -@` yT/NX#/9*N ^XU-@`PTNyv/-@NzX//.-@N *PN^NuTNyv/-@aXN^NuBJgTNyv/-@NzX-@JgZJg/.//.a :O -@`/././.NuO -@Jf n` n`/</././.NjO-@JgB/./.a O Jf n`\ n`NaNp/Hy!raP#XNJg`/<NorXJg /<NorXJg`U`/<NorXJgNp/Hy!vaP#\p~/NorXJgp/Hyz/<Hy\Hy!vaO`b/<NorXJgRp/Hy!za2P#`p~/NorXJg(/<Hy/<Hy`Hy!zaO`/<NorXJgp/Hy!~aP#d`pq/NorXJgTph/NorXJgp#Ns``/<NorXJg p#`Dp#p##~`,/<NorXJg p#`p)/NX`B oHp4/NDXJf p(/NX-y|"HyHnN8PA#`-yp/N]Xa #N^NuJXg 9XR/Hy!rNPJ\g 9\R/Hy!vNPJdg 9dR/Hy!~NPJ`g 9`R/Hy!zNPA:#!~#!z#!v#!rp#`#\#X#dNuNVA:-HB-H y/. /-HNmP#А".Ҁ-@-AJg .RB/NFP-@Jg/.//.NLO n/.//.NLO nBJg .R/HnNP-n-n yJfF y&Jg<"y& Q#& #p/Hy"/N O #"` n .N^NuNV yJf< y&Jg2"P#& #p/Hy"/ N O #" n R/Hn n/NLO -nHn/./.HnN6OSfR n Jg R//.NPB/.NFP n /./HnNLO .S n N^NupN^NuNVpL/NorXJfpM/NorXJgFHyN8X @2(,-@fr`//N?*P"n i!ItB/ N|P`8NJf/<NDXJfNR<`Ap//N|PN^NuNVBNJg-nB-y` p~/NorXJgHy/.NPN^Nu/9NX-@-@ nJg@ 'g8 :g2 f ( ^g" n f ( sg pT/NXNB o pU/NXNl np//9NmP-y* n(gR-H"n Q-Hf g p\/NXR/./9/.NFO #N^NuNVa4NJfp/Hy!raP#X/<NorXJgp/Hy!vaP#\/<NorXJg/<NorXJfU-y/9XN"Xa#N^NuNVp4/NDXJf p(/NXHyHnN8Ppq/NorXNyv/-@a`XaHn/.NPN^NuNVNyv/-@NzXrq/-@NorXp4/NDXJf p(/NXHyHnN8P/.aXa&Hn/./.NO N^NuNVNyv/-@aXps/NorXJg|B . ll @<"@xp//HNXN o n<"nhd p)/NXNM yJgR`B/.N PN^NuNVNyvro/-@NorXJg BN@X y&` o/.aXp//.NNPN^NuNVps/NorXJgBp/NDX-@Jg  Uf  `B9 NMp/NDX-@Jg  Uf  `B9 NMp/NDX-@Jg9 1fp#N^NuNV/<NorXJg /.a>X` nNN^NuNVH p-y*-@-@Jg" n(g R n-P` n-HJg././. /NuO Rgp/N\XpLN^Nu nR .䰮mp/N\XpLN^NuB 92X".첀l y2T"P$ifX$y2T-R-I`8 ./@X y2T"P$ifZ /$y2T-R-INq"n i(f2"n i(g&"n iB/)N PR`/. n/(NzP/.-@N X/<//. n/(NjOJf&"n iB/)N PR`"n i(glJgf"hR/ NXJfRp //. n/(NuO Jf4 . g f p-@` fp-@`"n iRT`D n-y*Jg" n (@ @g n-P`LN^NuNVNRJng4Jf" 9b"9f rNйb-@".l#b .o#f-y/ nJg h( f n-h` n( f\JgV y/0(Hbf0( Hfg4 y&`B/9//NpO #/ n( A y/ 9b1@ 9f1@ 9fbr///.aO BNIX-y4 J fR /./. Hy NaO -y4NL:". gNaJLN^NuJ^f(B . l @0R`B` y&`-h$ y//H p"o) /9b/Hy//NK(O9qgNG 9fb y/r( -A#V-@Jg-n`,/9^B/./9bHy/Hy NO-@p#V-@-@-@.gHy1N|XJ^fhp/HyHy/N6O Hy/HyNP3/Hy/Hy Nk PHyNXr-A#-@` HnHya .Pr y&`!A(-@R yJ ("y/fJJ9g/.Hy"@/)/NO#/Jf#/p9ѹR` y/0(H".вo8/Hy//9J-HNO#//./9JNP`* y/ Hy/N8P y/ .S1@ JgR y/ .@ -y4 ."<k fNa` H`  ` K``d`bP`j``l@`rM`B` ``*``` `#//` Jg -y/-n nJg$ h( f n-hJgS`p//./.a O /.NIXp-@` Jga zB8 9n#4r-Ar /Hy -@NNP` bJga 8#8#$4NL:#4r-Ar /Hy -@NNP`  y/Jg Jg y/( @ a `J^fN y/ Hy/NP-@"y/ Q Hy/NP".Ҁ-@ l y/0( H-@ PR2( HЁ-@ nl y/0(H".вo:-H ///9//9JNO#//./9JNP y/ $y/"R / /N8P y/ .S1@ y///9JNP .Rr-A-@`J^gJ^f-y8 y/ Hy//NP n/r/Hy/-@N6O p/Hy/9//9JNO n/B y/ p//Hy/N6O y//H /NX o1@ `B y/ 98b/HnHn/NMO y/ r///9//9J-@NO y/( A "."@A /H ".B o1A -@Jg.fB/./.a NL: .RB-@`(#8JgapJgNL: .R-@ y/Jgn( g> y/Jg2"h#/0)H#b0) H#fJngq y/#/ 9n".oSp-@JgS`Jgp-@`0 9n#p/Hy NbhPBp-@S,p9 `NL`J1gd y1/Hy1-HN(P y//(/./9JNJO y/#/Jga/.NIXp-@` p-@`JgaJg .R-@/98/.Hy NaO Jg .S/NIXJg2 y//H p"o) /9b/Hy//NK(O f0Hy/Hy Nk PJg y/p( /Nl*XB fLN9.-@ gzg"й0".?-@-A `-y4 -y8-nJ g/./. Hy NaO NL:-@". g-@ `#LN^NuNVH yb/"yb0p$n -@p-ybB-H-I09/H".lp n".gX-Ag nRR.g nRR.g nRRp n-@ n"nRRRRR`f nB .LN^NuNV09,gJ%gN^Nu yJfhJg\J^fA`A/HnN8P/. HnNfPHnNHX/<Hy NNPNJ`NJnN^Nu 9fbB//9/aO NuNVH BJg np( -@ . -@ /HnHn/NMO n -@-@Jg n .  f RR` n p///./9JNOp-@ n/H .B o1@ ( @ "n Q "."@A -@` .R". o nJg n( g, l`"n Q "@) -@g`"n Qp( -@ . -@ S/HnHn/NMO"n Q/H -@Jg" o  gJgv-Q`V n0( HЮT-@"n Q/H .  f o BR`"n Qp( ".䱁p-AJg"gR.gR.gR n0(H".貀oX //"n/)/9JNO n"@h -@$y/f#//./9JNP-nJgT.g n R.g n R.g n Rp n/H R o $n"R / /-@N8P n .S1@ P .@ /H "o $o0* H// /NFO o1@ J@g n-P`p"n QJf .LN^Nu y/"nfB/ n//9JNP.g( n( @ l .LN^Nu n-P` n-P` .LN^NuNVNJg p /NX y g pl/NXp y(-@ vl ^g N'D` yб"f#&4Ba&-@Jf#4&py/NX` ^f/<NorX` f> yJgpp/NorXJg yJfR`#:`R` fpJf`BS``#:`. o p/NXT . @Ӱ"PN yJg> :fN^Nu y 'gp^/NorXJgN^*` pm/NXN^NuNVB/9NmP# @JfL"y&Jf#:pN^Nu"y& Q#& # yJg$R f` y :fR y gpN^Nup y(-@r k`fN`M`NL`FN`>T y f(Rp yR-@`T .N^NuSp yS @8p"//NPNuNV/<NDXJf p(/NXA-|-H nJg g"nRR` nBN09 @H/NX nR/NX nBHnN:P-@Jf"Hy:/.HnBN~OH#09 @H/NX09 DH29 FH//t//////t/NO$NJgp4/HnNPN^Nu/<NorXJg p#`pe/NorXJgBNu/<NorXJg p#.`pe/NorXJgB.NDNuNV y fRp yR-@r@k찻fNj``n`h`f`v`fW``NA`pc/NXN-@Jf p)/NX .gND/.NX`a`6y9/<NorXJg p#6`pe/NorXJgB6NW`b/<NorXJg:Nsp#NMJgp/NXN##`dpe/NorXJgBNtN`@/<NDXJf p(/NXHy HyNfPHyNXNW`B`p-@`p-@/<NorXJg3$/.N>X`jN^Nup4/NDXJf p(/NX yJg p]/NXHyN?X/<HyN=xPJgN]`N@N^NuNV/<NXN-@Jf p)/NX#NMJgX/<NXN-@Jf p)/NX#NMJgp/NXN## 93 93 3 N^NuHypaXNuHyD"aXNuNV/<NDXJf p)/NXHyHyN8PNMJf pq/NoX/<NDXJf p)/NXHyHy nNPN^NuNVNJfVN-@ @J gPph//NP##**p//.HyNO NM`N^Nu yJgp]//9HNPaNuNVN_.-y/ Jg@/.aXJy$g n(%g-P` n/Hy/ NP-@`NhN^NuNVN_.NJfBN/-@a8XJy$g n(%f n/Hy/ NPNM`N^NuNVH n($Sf*"n/)/HNXR///NP` nBB nJ gB"n i .l^)$Sf6/H"o//HNXR///NP`"n i .BBR` n $n"j //NPLN^NuNVN:r-y/ Jg8 nP/N n!@!AJ~g"p/Hn n~/(NO n~!@N^NuBNXNu/<NXN/N=NXNuNtN@a|NuN@p#NsabNuNtN@pq/NoXp4/NDXJf p(/NXBHyN?Pp#p##~aNuNV y fRp yR-@r0kNfNi`xo`J`8`&z``N,`2N[`(Ny>`N`/<NorXJg NO`NF<`N@-ypq/NorXJgph/NorXJgp#Ns-y`h/<NorXJg p#`p#p##~-yp4/NDXJf p(/NX y#-H` y4!@"y4#A . N> y4!@"y4#AN_.N^NuNVBn0. @lDH @1Jg. @1"@1//HNXR///NPRn`B2LN^NuNVp/NDXJf p(/NXHy HyNfPHyN?Xa\B lf/<HyN=xP-@JgJ . @1B/./HNFP o . @1Hy/N8PR`N@N^NuNVp/NDXJf p(/NXHy HyNfPp/HyN?PB . l2 @1Jg @1/N/<NorXJg,Jg/mHy/`aX`/_Hy/RaXN^NuNV nJ( g pj/NX n &| N<-@ }f n( gJgp n( ".fN^NuNV nJ( fN^Nu n( g pj/NX n( @ !y&!y#&"y& Q#&g y& #p/Hy"/N O #" yJg :fR`/<NorXJfp}/NorXJgp n( /NorXJfN` n| h#& #p/Hy"/N O n#N^NuNVp-@-@-@-@Jy$f pr/NX09 XHr//N,P09,gR/<NorXJgR` JgNNJg.Jy$g/<ANVXJg JfN"N^Nu/<NXN-y2\-@ .S o"n Qg-H` n2PgB/.NNXNMJgHpB/NXN-@JgSNMJg /<NXN-@JgSp9".N3$p9".N3$Jy$f3$NW/<NSXJg JfN"JgNN^NuNV09,gN-y*Jg< n(g& . g Uf*gB/.N P n-P`-y2nJg. nJg"h c /("N>X n-h&`N^NuNVBp/aBp //NO nPBph//NO nbBpB"n/)B/NO -@JgL n  n2(H//aP n(R@r(p//NP n!@Jgp n(//(ahPp n(29$Hc@3$` FFLDf nbB"n/)f/NO -@Jg nP  n2(H//aP nB(Sf2/Hy*NP-@Jf n2p//N$P`* n:"n"/ /NP-@Jf n"p//N$P` n!n""n#H2#H6` n(Ufr"/Hy/ NP-@Jf n"/N8X-@ n(%@%"n#H"Bi:B&Jf#2n` n!n&-n` n"p-//N$P`8 nJ(gp(/HnaPp#ӴHy2NrXJfBHnHnN6O p/Hy HnN O R-y#  n(-@Uf: y f*pu/NorXJg n1|:p}/NorXJglpL/NorXJfpM/NorXJg( n0(:@1@:HyN8X n!@*` n0(:@1@: y :fR/<NorXJgF n."n2$n6/ / /N'~O n0(:@1@:p/NoX`( y f( ve n0(:@1@: 9A .RB/NP n!@JgT"n iR/.//9NLO "n i .#BӴ`apr/NX`BӴa/<NXLN^NuNVp-@ n2Pg29,g RN#2PJ2Pg`Bn0. @lJg& nPp"n)//NP n-P` y2P>/N|X y2P-hbJgN n(Uf h"(%@% nJg$n"jpR//NP n-P` y2Pb/N|X y2P-hPJg* nJ g "n/)/NP n-P` y2PP/N|X y2P#2P`Hy2\N|XB2PJ2Tg 92X/Hy2TNP-y*Jg n n-P`NWLN^Nu09 @Hr//NP09 @H9$HH Aלr///NO 09 @H9$HH Aל2H//N,P09 @Hr//NP09 @H9$HH A$"H//N\P09 @Hr//NP09 @H9$HH A$"H//NPNu09 @Hr//NP09 @H9$HH A4r///NO 09 @H9$HH A42H//N,P09 @Hr//NP09 @H9$HH A$"H//N\P09 @Hr//NP09 @H9$HH A$"H//NPNuNV09 @Hr//NP09 @H29$H A% 2H//N$P09$H @%00=@ @ f09$S@gRn09 @H2.HA//////NO09 @H9$HH A$"H//NTP09 @H29$H//NPN^NuNV n02.A00(A1@0(A1@0(A1@0(A1@0( A1@ 0( A1@ 0(A1@0(A1@0(A1@N^NuNV. g09,g 3 %H` .3%HHy%np/N`P09$=@29$=A49%rBS@=@09%t@SA=AHnaXHy%nBN`PN^NuNVN09$29%nA29$49%pB n4H3737 oW0 n0(H oW1@ n0(V@1@0(V@1@09%HgN`09%Hg$ y2P-hJg nJ(g09%H f nP //.a>PJ@g n$$$$0(297A=@0( 497B=@0( A=@0(B=@09%H g(Hna#XHna$ XHna#XHna#X9$gN09 @HHn/N\PN09 @HHn/N\P n-P`09%Hg y2P-hJg nJ(g09%H f nP //.aPJ@gf n$$($$$9$gN nP /aTXN nP /a>X n-P`X09%Hg y2P-h,Jg nJ(g09%H f nP //.aJPJ@gf n$$($$$9$gN nP /aXN nP /azX n-P`X09%Hg y2P-hPJg nJ(Ug 09%H fl nL //.aPJ@gR nZ/HnN8PHy٬HnNfP nP"nLB </// /HnaO n-P`l09%Hg y2P-h>Jg nJ(g 09%H fl n$$$(@3$(@3$(@3$0(H2(H4(RBH//(//a O n-P`l09%Hg y2P-hbJg nJ(g09%H f nP //.a&PJ@g/.alX09%Hg n(g09 @H9$HH"A$"H//NP09 @Hr//NP09 @Hr//NP n0(U@=@0( U@=@0( T@=@0(T@=@Hna X n-P`3$By$3$$N09 @Hr//NP09,@ 3,NN^NuNV n 0( n2(Ao n0( n 2( n4(=@Bo n2( n 0 n4=ABn n0 n 2( n4(=@Bn n2(=A0.nm 0.Amp`pN^NuNV9$HBn=@0. @lH n=Rn`0.H2.HJjD`0.H2.H2.H4.H’/@JjD`0.H2.H" /o=n`=n0.2.AfBn0.R@2.A=@`p2.RA4.B=@=A=|0.HJj D=|=@0.29$?@A=@0.29$?@A=@0/297A=@0/497B=@0.A=@0.B=@09%H g(HnaXHnaNXHnaXHna:X9$Yg09 @HHnr//NpO 9$HH dN```` `f`V9$@S$J/g0.H/@26SA= /T26SA=09 @HHnr//NpO `09 @Hr//N,P09 @HHnr//NpO 0.H/@26SA= /T26SA=Jno0.H/@ 9$Nv/@ //AN>$/&/N49%nH/@ /AN>$/&/NN=@=@0.H/@ 9$Nv/@ //AN>$/&/N49%pH/@ /AN>$/&/NN=@=@JngS@=@0.S@=@`0.S@=@0.S@=@09 @HHnr//NpO Jng8p92.H/@N2.HҀ=A0.H"/=@`p92.H/@N2.HҀ=A0.H"/=@`h0.H/@26SA= /T26SA=09 @HHnr//NpO 0.H/@26UA= /T26UA=09 @HHnr//NpO 0.$N^NuNVH p-@ n(gV h"0(,H29%H-@ g JgLN^Nu n/("NNX"n i"2(,A1A,-@`N09%H g"n i"(%gLN^Nu n/("NX"n i"(%A%-@09$29%nA29$49%pB n$$$(B3$3$B9$3$3737N09 @Hr//NP9$gt09 @H9$HH A$"H//N\P09%H gJ9$HH @$ Jg*09 @HB/N\P`09 @HB/N\P n0(297A=@=@4( 697C=B=B8( A=D2(C=A(gS@=@SB=BRD=DRA=A09%H gdHna`XHnaX0.S@=@0.S@=@0.R@=@0.R@=@Hna$XHnabXHnaXHnaNX09 @HHn/N\P n(g@Jg2"h2P0) H2)Ht$n*///// /.a`OLN^Nup n(/@ 9$Nv/@ //AN2$/ &/N4.H/@ /A N>$/&/ NN=@(gFJf#2&`BN?X#%&`0.H2.H///.aO LN^Nu nJ(g|(Sft/.NX=@Hr n(dTp(2.H-@(Sf rN-@NBn-@0.HlR n0 TRn`p n(".沀dp(-@Bp(/HnHn/.NMO-@NBn-@ nJg&0.Hl@"n2RTRn` nBP n fR09 @H2.H4.H6.H////NdORp9/@ 9$Nv/@ //AN2$/ &/N4.H/@ /A N>$/&/ NN=@`BnN-@ nJg.0.Hr"n)d@"n2RTRn` nBP09 @H2.H4.H6.H////NdOLN^NuNVH0. y7=@ 0.y7=@0.J@kN` 0.D@=@09%H gHn abXHnaXHnaNX09 @HHn/./NO =n9$g nJg09 @Hr//NP9$ o09 @HB/N\P`209 @H9$HH A$"H//N\P09 @HHnA/Hn///N,O09 @HHn/./NO 0.2.4. =B6.A=C8.DSB=B@SC=C49 @HHn/=@=AN\P09%H g809 @H2. H4.H6.Hx////.///NO`bNBn-@ nJg@"n2RTRn` nBP09 @H2. H4.H6.H////NdOLN^NuNV9$H n2497B=A2(697C=A2(B=A2(C=A29%H=@ g(HnaXHnaNXHnaXHna:X0.=@=@0.=@=@=n=n9$Yg09 @HHnr//NpO 9$HH d8N`.``` `N`9$@S$J/gp/HnNP09 @HHnr//NpO `09 @Hr//N,P09 @HHnr//NpO p/HnNP09 @H/X n(g/aX n-P`09,f p /N?XN^NuNV n(@#2&`BN?X y&`/N|X n2pb//NP#%&`N^NuNV n(@ h2-H/HJgX"o//NP n2pD//NPN^NuNV n(g/aX nJ2f"p/pb/NP n!@2JfpXN^Nu n(@#2&`p y&`!@$BN?X/. NHX#%&`pN^NuNV n(g/aX n(f4p/pD/NP-@JfN^Nu n!n2( @` n-h2 .N^NuNVH09$ @lB`09$ @lpP-@`-| .3$Jg@٦=y @=y%n=y%p=y$By$09$HJoS`09$H=@29$=A@=@09$@=Ap3%p3%nB09* g&N  @l09 @HB/NPRJyٲfp-@ . lAr0R`=|r=|HnHyٲHnrN@O JnFgp` < 2.H37 <NNv\2.H#7 <BNNv\#7 97Nv4.H/@ /AN>$/&/Nl0.0.HN>$& "N"#7 97 Nv4.H/@ /AN>$/&/Nl0.0.HN>$& "N"r9#7 pPN/@ 97Nv/@ //A N2/@ //A"/ $/&/NxN"#7 97 Nv49$H/@ /AN>/@ //A"/$/ &/NxN"#7 09ٲ3 @J@gdp"97#$$97 #$=@=@v9=@ rPN/@ 97Nv/@ //A N2&/(/ $&NN=@09$H/@ 97 Nv/@ //A N>$/&/ NN=@09 @HB/NP3%HHnp/N`PHnaX09 @HB/NP097@h3%HHnaXHnBN`P09 @H/NX09 @H/N`XN  @l az`=|0.3 @JgHB/NP -@Jgb nJ(fN n0(Hm>l80(Hr9Nr n(//<//(HnaO n-P` y2P-hbJg nJ(f n0( Hr(Ё-@మnr(t9 N".Ҁep-@ n0(Hr9N n(-@g/("NNX-@` n/("NX-@ nJ(gT(SfL/.NXr n(-@d.p(-@(Sf rN-@ .Ѯ`p n(".dp(-@Bp(/HnHn/.NMO-@Jg4 .మm*l$p n(//././.HnaO .Ѯ n fRRp9Ѯ`Z/.NX-@JgPp n(".c r(-A .మm*l$p n(//././.Hna|O n-P` ."9Ҁ o "<`"9A//-ANzP-@Jg//.HnaO p/HyٴNt>PR`|p/Hy;Nt>PBNt/<NSXLN^NuJyٲg,09ٲHB/NP09ٲH/NXByٲNuNV n0H/@ 9$Nv/@ //AN>$/&/NN0N^NuNV n0H/@ 9$Nv/@ //AN>$/&/NN0N^NuNVH*n ..,.p-@.g-@.g.g SJg&Jg" n R nR .`L N^NuNVB n . "np@-@-H-H-I .SJgd n.gJJg/./.Nt>PB-np.r n//.NG^P nP-@RRR`Jg/./.Nt>P .//NG^PN^NuNVH "n i2-P-hp)-y^R^-@ .SJg Jg n/H p"o) "n2)H//Hn/NK(ONKIr*E, n(G=n-@AJg.gJFgT09 @H2.H4.H&H////NdO Hr9N2.HҀ=AN|-@r@=Ag=A.g.g09 @H2.H//NP`FGl@ n0TRFRERR`&JFg*09 @H2.H4.H&H////NdO09 @HB/NP"n Q-Hg( g nJg-Pp9/@ 9$Nv/@ //AN2$/&/N4.H/@ /AN>$/&/NN=@`#^L0N^NuNVprHy%n/-@-@-AN`P n(g h"0(, f n(g""n i"0(,g /N=X` t n(0Jg(HnHnHnHnp/BNXOp9 2.H=AB n0( @ 2(A2(A 4( Bt9=@ =ArN2.Hd=@p9rN2.Hd=@0.2.@o=@0.2.@o=@09$ n2(Ao 3$R09$ n2( Ao 3$R n0(n=@H29$H/@2.Ho /3$R n0( n=@H29$H/@2.Ho /3$RJg/<NSX n(gn h2J g$ /NXHyNenX-@ . g g fA%N/NX/92PNNX . N^Nu n0(29$A29%nA37@0( 29$A29%pA37B37D37FHy7@N-X n#2&`Hy%nBN`Pp/BNjP y&`J(gn/<p//Hy bHysNOJgH-y#:09*@ 3*NDJf09*@3*# y&`B(#%&`NJnBp/NP`<"n i"0(,g p(/-@p-@"n i"0(,@1@,/)"NNX/</HnNFO "n i"r(7-@-A`` n(gB/NPP`"n i"(%@%/)"NX/</HnNFO -|-@p-@Hy2NrX-@Jg&/<ANVXHy%np/N`Pp-@p#Ӵ.g-n-@p n(S".沀d"p(".ep n(R`p n(".eS-@-A` B-n .".g -@p n2(H49$H’t9-@ ./A"N"/Ҁ09%rH-AlJj*09%rHrN".09$HЁ3$R n0( H29$Hr9$.ԁЂ29%tH-@lJj*09%tHrN".09$HЁ3$RJg /<NSXHy%np/N`P n0(H29$H29%nHЁr9/@ .N"/Ҁ n0( H49$H49%pHЂt9/@ .=A"N"/Ҁ=A.gNA"n0)29$A29%nA2) 49$B49%pB49 BB=@=A-Hp n(".dNBn-@0.Hr n(d0 nJg@"n2RT` n0 TRn` nBP09 @H2.H4.H6.H////NdO0.Hr9Ё=@R`NN0.H2.Ht///NQhO HyNenX2.H4.Hv///-@ NQhO  . "<kfN````\`P`HR`0G`a``K4`n `@P` H`M`K`` `" ``` `JfJg n(Sf^p#Ӵ/.Hn/("N9O nJg/(/("N n(Sf(/("NNX/</HnNFO -@`* n/("NX/</HnNFO -@p-@`B`-n`B .".޲oABr-A-@`JgS .lz-@ .lACR`S  f .lA fp-@`( . Jf NaJ`Jjgd .nZ .ްm&A g NaJ`SAB-nA .CS .lRA .". m .".oAR `R .Rl-@ABp-@`JNVVBy hN=@tJ@j p/N?XHyHyNPJg^HyNX=@JnkF0.H @ \g @ :f0.HR @BN90`Sn`NBn0. @ lH=Rn`=|NT@=@HnrHnnHnpHnlNhO3 @HnvHy @HnNO 09*@@3*0.p0.l0.vR@3 D2.xRA3 F09 D @Xl&NA/p/N`Pp/N?X09 F @,oAx`An /-@^NXJ@f&NA6/p/N`Pp/N?X09*@3*09 @HHnvr//NO 3~ H09 @HHnHnbHnvHndHnf/N,O3~ B%~09 D3%3 F%@3%By%3 H%abp/HyHyaO p/HyHyaO A# Jp//N&P09*@3*BHyYN:PJfHyYN?Xp/HyN=xP9 -fV9 pf p#`,9 sf p#`9 zfp#Nqp/HyN=xP`N@aP=@J@g H/N?X09*@3*09 @HHnhHnjr///NOp#<###HyaXND4Bn 9T2.Hl.B/9/Hy/NO Jf p/N?XRn`/<NDFXN` BNXN=2BNXp<#3 pP#3 BHy|arX3%03%23 %43%63%83%:3%<3%>3$%@3 %B3%DBn0. @l0H/@ @%Np////H NJP o0Rn`09 F @,l09%4S@3%4Bn0. @l H @4"@ל0F@0Rn`09 @HB/NP N3$Np//9 JN&P09*@3*09,@3,BaXa|NuNV09 Z2. @fJ%fJ^g -|`-|09*g, . Jg B/9 JN&Pp//.N&P# JN^Nup//NPNuNVBn0. @nH @ٸ0=@H".f H/aX`V y N0.H/@r/HN o /U"@7 ( g0.H @ٸ0H/aXRn`pJg NrBN^NuNV y N0. H/@r/HN o /U"@7 ( f //aX`0. H/a|XN^NuNV0. U@HA//r/NO y N0. H/@r/HN o"n!Q Hn///9 NNO HnBaLPN^NuNV y N0. H/@r/HN o /U"@7!Q Hn///9 NNO HnBaPN^NuNVNNJnHy/N|X09* g09 @HB/NP09*gB/9 JN&P09*gN09,gNR<09*g609 XH/NX09 XH/N X09 ZH/N X09*g09 @H/NXNuNV-y .r`k䰻fN``V``` `z`b`J`8`& ``p-@`pB`f[`\Z`R 9ꑹ`B 9ѹ`209 |H"<N"<N#` پop ` 9پ-@Jg D/NEXN^NuJپg p/NEXN^Nu 9R"9’پ-A op ` .-@Jg /NEXN^Nu 9R"9’ 9پl p/NEXN^Nu 9R"9²o409 |H$9RN"<Nپ/NEXN^NuJjB <"9o#09 XH/@ 9"<N"<Nr////r///NO09 XH/@ 9"<N"<Nr////r///NO .g p/NlXN^NuNV 9R-@ .پf . f .g ."<N". N=@ @o=|09 XH2.Ht////t//NO09 XH/@ ."<N". Nr////r ///NO#پ# #N^NuNVHp(//.Hy7HNFO 09,f097DH297FH-@JfZ09 ZHHy7FHy7DHy7BHy7@r//NXO097DH37D37@/<Hy7@a /#Nr9 yJ (N#R2.H$9N2.H-@-B`# ``B \`p9 \`p9ѹ \`0.H \`0.Hѹ \`Jo09 |H".N"<N# \`h0.H ``Z0.Hѹ ``Lp9 ``//NO Jy$gp`pA=@H/r//NO A/9p(//NO N^NuNVB09* gN^Nu . @JPg4A .R"@0H".H///NO `N^NuNVBn0.H/@ @JPgBA0."/RH"@0H"y&`$)$H///=ANO `A/HJjgp`pH/r$///NO A/HJngp`pH/r#///NO A/H rfp`pH/r///NO A/H9ugp`pH/r///NO A/H9ugp`pH/r ///NO A/H9ugp`pH/r!///NO 09,g09 ZH/N=XN^NuNV09 lH Tm qn09 l @bf2 y1#2Lg@3 lR2L`P3  j`F09 lHI @1"P#2Lg@3 lR2L`3  j09 lH ;mR DnJ09 lH: @1"P#2Lg@3 lR2L`3  jN^NuB . l @09 lHf09*gA 9 Jf6 fp-@ fp-@ l,3  j` l 09* g 3  j`| y J ."@/I r/HN o0( Q@g6 oR 3 z o 3 |3  t3 j`3  j`R`N^NuNVBn0. @lFH/@ @24. Af&2.HR @0H///NP`Rn`N^NuNVJ g . @0HЮ S=@` . @=PJf0. @1| `@ f0. @Bh ` f0. @1| JgJ f .=@` . @0H]Ю =@0.H @Jf @Bp//HNFP o 0.H @p//./NFO N^Nu09*gB/9 JN&P09* f(BHyHyN&O 09*@3*p//9 JN&P09*@3*N>Nu09*gB/9 JN&P09*@3*09, gN=2NuNVa=|0. @l,H @Jg @p//NPRn`=|0. @Wl,H @Jg @p//NPRn`09* g$@3*p/HyHyN&O N^NuNV09 XHB/N,Papp//aP y/#/#/-HJg nB( Bh n-P`p#p#/BNG(P09,gNxN^NuNVN09 @Hr//NP09 @HB/N\PHnHy%nNP09 @HHn/N P09 @Hr//N\P09,@3,NN^Nup#//aPNup/p/NPNuNVJ k  lx 9".g//9/afP#/ .## 29 H$9ԁr9NԀ#JgaBHyaXa2N^NuNV nf/./. aTP`V09 H n"Ҁp9/A". N$/Ԁ n!B4!A(!n,J0ga/.aXaN^NuNVNp9 n"(N n"Ҁ-A otBnJ j . D` . r9N2.Hd* n (=@=@ ( S=@=@J o .R` .=@HU n"(Rt9/@ N"/Ҁ=AJ j .R` .=@HU n"(Rt9/@ N"/Ҁ=A=nJ o0.H` .=@=@=n09 @HA%~//Hnr//NO09 @HB/N\P09 @HHn/N PRn`09 @Hr//N\P` n (=@=@ ( S=@=@J op9".Ҁ`".=AHS n (t9/A"N&/ր=CJ j .Ё` .=@HS n"(t9/@ N"/Ҁ=A09 @HA%~//Hnr//NONN^NuNVH*nJ o( . S JgT*Uf*y/Jg*U` . R Jg,*mf*y/`/fJg*y/` L N^NuNV/.aXN^NuNV f /.aX` 9r#ByN^NuNV fjp /BaP09 jg,09 lH/@#Jf#By h`&09 j@J@g p#`p#By h 9N^NuNV/.arXRgBy h/.a,X`N^NuNVJ2Lg2 y2LJg"@3 lR2Lp3 j3 h`B2LJy hf| . A t".Hy rHy lHy nHy pHy Hy t/////////////t//t//NO\3 j09 j3 hg*09 t @ f09 zHr///9 JNO 09 jg>09 l@J@f009 l @2f09 @HB/NP3  j`N[N^NuNV . f B` . fapp#Jg*a  9f y/Bh`RS`Ha 9f& y/BhJ6g"Bp/N0*P`Jzg6 9йzf"RJ6gHy/DNbX`R` 9 l y//H .  o 9$9Jgt o0(H"9mX y/0(H/H"9o$  oR o1@` y/0(R@1@H BR` y/ 91@N^NuNVH Jg9g 0m0 np @z"n$npr-@-H .SJgFp nR/a @X`( np npLN^NuNV nJgpR/axX`N^NuNVN 9o4r9p/HyaPp//9/avP#/09 H"9Ҁp9/@/A"9N"/Ҁ 9d0"/ӹp/HyaPp//9/a P#//9/Hya PNN^NuNV n 0(H BN/. /.aP/.aXNN^NuNVN n!h8 n 0(H"n")$o -HNBn-@ nJg.0.H nn n@"n2RTRn` nBP09 @H n"(H$(4H6.H////NdO0.Hr9N nѨ8/.a4XNN^NuNV. gJ 9W=@ 9S=@09 H"9@X=AXA=A09 @HHn/N PN^NuNVNHya lX-y-y-y/JgB09 H"9Ҁ#Jg/./9/aA/p/N`PS@g p/NX09, g~N=2`tp/HnHyNO -@JgJjD` ./HnaTP09*@3*p#~#p#N^Nu09*gJf@3*BNuNVH f/.NX-@ . S Jgp-@ n:Jgz n: nf\ np @z"n$npr-@-H .SJg*p nR/a*X`R`zp n/aXR`PLN^NuNV . f| J7rg@p/NX-@Jf NJgNqJg4. @H/r/NP`. @H/NXH-@JfHNN>A/p/N`PS@g p/NX09, gNN=2`DN^NuNV nJ0fR0/avXaN^NuNV nJ0gB0aN^Nu09 @Hr//NPN09 @HHy7v/N PN09 @Hr//NPNuNV n (,$r9N nШ37vr9 ((N nАS37xHЁ37|Jjg 097vHR`097vHr9ЁS37zN^NuNVJ gp`p".-@ -AJkl 9Vr9/@ .N"/Ҁ=A=Ap9/@"9NйS=@H"/ЁR=@09 @H". H//NP09 @Hr//NP09 @Hr//NP09 @Hr//NXPN09 @HHnr//NpO NN^NuNVN< g09 XHr//N,P .m lN`&`n`H`R`2` ``~`P`p/aX`p/aX`p/aX`p/aX`N` p/aX`~J2g99f8 2g,p#JgNr 7g p/a8X#709*@3*09 XHr//N,Pp/aRX09* gp/BN0*P`p//N0*P` 7f p/aX#709*@3*09 XHr//N,Pp/aX09* gp/BN0*P`p//N0*P`aB9p/pd/HyBHyVNOJfp /Hy2rNPBHy y*/(p/NjO-@Jy$gB y*/(p/NO NG09,gN"09,gB y*/(taLPJfp/HyNP` y*(gNN` `\Hy/9*aPSfDN` p/aX`009,g009 XHr//N,PNJy$gNG`Jy$g 09 XHr//N,PN"`09,fBaXJfp /NX`09,gN09 ZHA///Hnr //NXO0.29 ZAf09 X`09 Z=@Hr////r //NON0.H/N=X`B y*/(taP#7N=BN^NuNVJg y*Jtf y*-h:` y*-htJo n-P`Jj n-h` Jfp-@Jg n0(,gJfpN^Nu n"y*#HtB/aPpN^NuNVJf NRN/< p//Hy Hy FNOSf/9NXN^Nu n-P`N^Nu y*(gVN/< p//HyDHy&NOSf*/9*N=\X/9*N X/9*NXN^Nu y*(gBJf:N/< p//HyHy NOSf/9*N`XNuNVH "n iR$ip/Hn/NLO -|Hnp//. HnN6O-@Sf/.Hn/.aO .LN^NuNVH n$n"jpR//NP .RB/NFP n!@"."@"hR// /. NLO "n iB i c` nN-y "n#H#H iRB/NoP# LN^NuNVđp-@ 9Ѯ09,@-H-HJ@gz-y#HyNf4X-|PHy2NrXBӴ/./. -@Na\P09,gfA"y/ p// /-HNFO n fR` y*:/./NP-@Jgp-@p-@`b#7 . y*Ш#7Hz/NNPJg-y7p n(6TP//@NX"/ҀB-A n0(, g@g(/N=X/. /.a4P/./. Na\P nf^p-@`Vp n(7B/.//./9/HyNO-@ fJgp/BN0*P`-y n-H af/. /aP`8.fJgz y/ p"n)7//HyNFO r#Ӵ/Hy/.-@N9O BӴ n0(,g /N=X/. /.a P n0(,g(/ c . g: g fNp n(/".̰cBR`< . o0S`*.gp n(/".̰c RB`p-@ n ((R".SN"n i0#H$/. / aHP/./. Na\P09,g . Pg fN . lR ` y*-h|p/NDFX f| . y*ְ|fj` . Hg fJ gS `Bp/NDFX`2B7 . g Pf <#7#7 fHz j/9*NNP`Hz /9*NNPJ7g6p y7(5 y*֐-@"9氁o/NEX` f` . g Hfp#7#7 fHz H/9*NNP`Hz \/9*NNPJ7ghp y7(5 y*֐-@Jj /NEXp y7(5"y*֐r(6TP/-@ /ANX"/Ҁ-A` f#N^NuNV09,g$B/. Na\Pp/B/.NLO ` /.NIXNj:N^NuNVH .й#7-yBNR09,gJ . y*Ш#7Hz /NNPRfp y7(6r9NйS=@p y7(5"y*֐r9NйS=@ y7P/NXr y7(7ЁVBr/=@NPHy%np/N`P0.Hr9/@ Nt9Rv y7(7(/ U=@ N2.H=BH=@H&9H(9H*<///////HnHnaO$Hy%nBN`Pp//NPp9/@ 2.HЁ"/ Nйr9/A 4.H҂-@ "/ N y*Ш2.H///./97-@ a OJfH . y7@5r(5"y*ֲc "y*#@ . y7@6N` NG`NaJ`09,gB7Hz /9*NNPRfJ7g 9R7Jgp y7(7r(4=@`p9/@ "97N=@t y7(4R$/ Nr y7(4R=@ N2.49%nB=ABr/=@NP0.H29%tH4.H69%pH89%nH:.H؅H<9%rHƜ܀HHnHn////////NO(r//=@NP0.29%nA=@9AH=AHN7=@Jng6p y7(42.HЁ@4 97Ҁ//a$Pp/NlXNv#LpN^NuNVH n=P n =PJngp`pHnHnHnHn=@NO09 @Hr//NP09 @Hr//NP09 @H/````````````z``N` &` >p /p//.BHyLNOSf(NRNOSf y*:/./NP-@Jfp//.NP/< p//HyXHyKNOSf`p//./9*NO /9*N`XBNX`,#%&`p/BNjP`/< p///HyNOSfBN0X`0.HrHk̰fN-`,`*`+`P`H'`)`&`d(`yNWJgA `A /<p///Hyo-HNOJf*Nx` N~Jy$gp/NX`B/9*N PN` y*Jf p/N~&Xp/p///HyNOp//9*N PJy$gp/NX`N`p/N~&XJy$gBNX`^N`TJy$g/9NXJg8`/9*N=\Xa nm$/<p///HyDNOSf y*-h/N XJf/9*NXJf` y*(gp/N~&XJy$g p/NrXa /<p///HyNOSfb y*Jfp/N~&X`L y*/(p/N *PJfp/N~&XNGp /NXJf/9*NXNG`p/N|VXJfp/NX`p/N|VXJfp/NX`0.H/m lN`\`*`r`````F````H/<p//.BHyUNOSf2N$zNqN"vSfBN"Xa` /<p//.BHyaNOSf N$` /<zp//.BHyNOSf NiNqNNSf NRHyI/.N8Pp /p//.BHyNOSf/9~NZX`Nsp#N[N:BNt`/< p//.BHyNOSf/< p//HyXHyNOSf~HyJ/.NfP/.NX`\0.HmL lBN`````>``BN?XJvgb y&`Jg "hJi g p/Hy: y&`/(/NOHyNHX/<Hy NNPNJ`p/BNjP`/<:p//.BHyNOSft#%&`BN@XJvgV`>p/N?XJvgH @NR09 ?@R@3 Jog09 2.@m29 09 =A2.@m29 09 H49 HЂ4.H6.Hԃ=An0.H2.HЁ2.H29 H49 H҂4.H6.Hԃ=@n0.H2.HЁ"0.H3 3 3 3 =A`3 3 3 3 `t09 S@3 J@fb09 H29 H49 H69 H////x////x/NO$Bp/a"P09, gN=2NvLN^NuNVp /p /Nf\P09 jgB09 t @f6Jg09 zHA |//N-P09 j@3 j3 hJ gp//N0*PBy h09 j @ f|N^NuNVB .lJJ g$rN".Ҁ n P "A" n -P ` .rN".Ҁ A :R`N^NuNVH A&CpQA&CpQp@p@a@@@@@?I=|p-@-@p-@v@B~HyV/9*HnNO -@p-@A/p/BNO . @"Aa"A"-A A0 . @-Pp!//.HnHnHnp#/NOp//./.NڊO HnHnHnHn/.NO0.H2.H4.H6.H////x/NXO0.H2.H4.H6.H////x /B/.NTO0,,H/r //.NO 0,,H/r //.NO 0,,H /r&//.NO 0,,H@/r//.NO 0,,H /r//.NO 0,,H/r//.NO 0,,H/r//.NO 0,,H/r(//.NO 0,,H/r//.NO p//.NP@=@H//.NfP0.HHn//.NO 0.H m@ n80.H2.H4.H6.H////x /x//.NTO`:0.H2.H4.H6.H8.H////z///.NTO0.=@Hm 'l N`` t` p` <` 8` 4` 0` ,` (` $``(` H` D````x``` ,` (` $` ` `^`>` ` ` ` ` ` &` "` ` `b`x` `FHna/9*N,P-@zJg"/HnaN$Pp/p/NFP` p#ӴHy2NrXJgp/p/NFPBӴ` pHna/9*N,P*@p#Ӵ0.@;@, M$/HA"opQ M./HA"opQ y* (R@50-,g4p.RB/NFP+@ p.R//- HnNLO 0-,@ J@g4p.?RB/NFP+@p.?R//-Hn?NLO 0-,g / N,$X`B$B(/ NMZXp // N6P//.HnNO JfB0.H2.H4.H6.H////BNXOHnN|XpL00N^NuJf-n y*p//./.NڊO .^l$"n Q-HRp///.NڊO `0.Hr!//.HnHnHn/NOHnp//.NO 0.H2.H4.H6.H////x /x//.NTOHnp!//.NO 0.H2.H4.H6.H////x /x!//.NTOB.a=|p-@v@I`0,,g"pR/BN$Pp/p/NFP` y*0,,@9@,`0,,g @9@,`0,,g*@J@g"pV/BN$Pp/p/NFP` *HnvHnHn~a O SfX nfp`p=@HL00N^NuNV n gZ0(,g,0"n )(Rr)//HN///NPJg4 n!n( .@//N,$X`Jg .`p n!@(N^NuNVH A/p/BNO n-P n-P n ./HnNޔP/.HnNޔP .\ @"A"A" . @$A"B"/.-BN&X fp/p//.NO `B fp/p//.NO ` fp/p //.NO HnHnHnHn/.NO0.H2.H4.H6.H////x/NXO0.H2.H4.H6.H////x /B/.NTOp//.NP@=@HB//.NO 0.Hm\ lRN```@``8`4``N``$` ``/.N&Xngp/p//.NO `/.N&Xngp/p//.NO `/.N&Xngp/p //.NO `pR`lS`hHnN"X.`XHnN"X.Jn~ m.<HnN"X n Jk op n n n `VJn~ m.</HnNޔP0.H2.H4.H6.H////Bx//.NTO0.H g[f0.H2.H4.H6.H////BNXO nfp`pLN^NuNVHA/p /BNO -n n-h< n BA"n"B.HyX/9*HnNO -@Jf pLN^NuJfHnN|X <LN^NuBp//.HnHnHnp/NO n r//./NڊO HnHnHnHn/.NO0.H2.H4.H6.H////x/NXO0.H2.H4.H6.H////x /B/.NTOp//.NP@=@HB//.NO 0.H op lh0.HHnHn//.NO0.H2.H4. nt4(9CH////x /x//.NTO0.Hm lN``````````````````4p/p//.NO Bp//.NO n B``p/p//.NO Bp//.NO p n `,B.`&0.H]rN n"P/ HnN8PBp//.NO `0.Hr//.HnHnHn/NO n r//./NڊO HnHnp//.NO0.H2.Ht n4(|v6(~////x/x//.NTOHnHnp//.NO0.H2.Ht n4(v6(////x /x//.NTO`* y*:Hn/NP n =|`Bn0.H gJf0.H2.H4.H6.H////BNXOHnN|X0.HLN^NuNVH p-@-@K nC-@pQHnN~XHnNX#&J-gHn/.N˜P`Hn/.N˜PA/p/BNO . @"A"A"HnHnHnHn/.-ANO0.H2.H4.H6.H////x/NXO/ aX0.H2.H4.H6.H////x /B/.NTOp//.NPH.-gp`p<-@ mp lfN`p````2`H`D`P`d`x``````````4``B-R`|R`J-g- @f:@`0-@-A-@-@~d`J-g - @g|@`p-@-A-@-@``:```````(`$` ``````````f``>`=| y*^/N|X n-Hȱg y*^B"y*/)b/NO -@Jfh y*/9*N>X0.H2.H4.H6.H////BNXOHnN|XHnN|XpLN^Nu y*:"nP/ /NP n!@"n Q-Hȱf8 y*"y* ib/(NMZX` y*/9*N>X`LHnN|XB-n-n`FJg> . nȱf/HnNP-@-@`/.HnNP-@Jf-nJg .^o"n i-HS .r//"@/NڊO `0.HHn//.NO 0.H//.NHP0.H2.H4.H6.H8.H////B//.NTONh0.H//.NfP0.H2.H4.H6.H////x /x//.NTO0.".Ҁ "A Q"P/ /.-INP-@Jf-n`0.HHn//.NO 0.H//.NHP0.H2.H4.H6.H8.H////B//.NTONh0.H//.NfP0.H2.H4.H6.H////x /x//.NTO0.".Ҁ "A Q"P-I-IJg/./.HnNO -@JfN0.H2.H4.H6.H////BNXOHnN|XHnN|XpLN^NuJf-n .r//. @/NڊO nıf: .^l."n Q-HR .r//"@/NڊO `0.Hr//.HnHnHn/NO .r//. @/NڊO HnHnp//.NO0.H2.Ht n4(lv6(n////x/x//.NTOHnHnp//.NO0.H2.Ht n4(v6(////x /x//.NTO`0.Hr //.HnHnHn/NO .lr//. @/NڊO HnHnp //.NO0.H2.Ht n4(4v6(6////x/x //.NTOHnHnp//.NO0.H2.Ht n4(tv6(^////x /x//.NTO`Bn0.H gJf0.H2.H4.H6.H////BNXOHnN|XHnN|X0.HLN^NuNVH pr-AA/r//-@NO n-hC$n$p0(r9-HN=|r=A=A". A }". A p". A w".$ A  xHnHnHnHn/.=@NOHnHnp//.NO/.N&Xp/p//.NO p/p//.NO n0(@1@p-@ @1Jg @1/HnN8P`B.HnNX=@0.H2.H4.H6.H////x/NXO0.H2.H4.H6.H////x /B/.NTOBn~cA HnHnHnHnHy Hy p/////////////p//p/p/NO\=@g0.@J@f0.H ;m( Dn B0.H:~d=|-@`j0.H Tm\ qnT0.@I@=@Hr N-AJfp -@0.H".萁-@[f f p-@-@~d=|.gZJngT0.H2.H"n iHnHnHnHn/t//./Hn/NKO(=@S@f Bn=|~v.gJng&0.H2.H4.H///NQhO Bn dl,09 H29 H//t /B/.NO.H "<k,fN`` v`n`@`d````` ` ` `r `b`R`B`2`"``p-@`hp-@``p-@`Xp-@`Pp-@`Hp-@`@p-@`8p-@`0p -@`(p -@` B`p -@`p-@-@`p-@/.N&XJfp/p//.NO ` .THr///.NO .r NHr///.NO .Ю-@ @1Jg @1/HnN8P`B.p=@=@HnNX=@Bp//.NO `<09 H2.Hr9N=@H2.HЁ4.H°o=B0.H2.H4.H///NQhO HnHyN8P=|`B.p=@=@=@Bp//.NO . @1Jg. @1"@1//HNXR///NPJngH . @10.HRB//HNFP o . @1Hn/N8PBn` ~`~`~c gJf0.H2.H4.H6.H////BNXO LN^NuNVH 0p=@=@A/r /B=@tNO -n n-hT "n ".t=B|H=|Cv=C=C=C=C=C=@=|=|+=|vCC-@>-A:-BJ-IJg0(@1@` n0(@1@.gp` < n1@.gp` < n1@.gp` < n1@8.gp` < n1@( .Jg <`p n1@!n $-y**HyHnNN8P n*P/HnNNfPAN"n#H0.S@2.@=@=A`&SnlSnp=@Jnj=@`Bn`Rn0.H2.HҀ4.H²oS=@0.H2.HfRnS=@`Bn`Bn=|JnoSnlSnp=@Jnj=@`=|Sn`Bn=|JnojRn0.H2.HҀ4.H²oS=@0.H2.HfRnS=|=@Sn`0.H2.H4.H///a"O p-@`n n m0.H2.HЁ2.HlNR0.HgB=n0.H2.HЁ2.Hm$0.H/@R n /"n Sn`0.HR2.Hgj4.H6.H/B ԃ n 4. R=CH4.H=@f / րgSnRn0.H2.HЁ4.H°fSSn=A`BnJf0.H n BJng". 4.H҂ n PoP`0.H$=BH n PB0.H2.H4.SBH6.Hx9TH////B//.NTO0.H n `0.H2.H4.H///aTO 0.H2.H4.H///a6O =n n 0 n$0 n(0 n,0 .LN^NuNVJnjBn-yj`p-@0.Hr9N2. HҀ=A0.S@=@JgHR`0.Hr9ЁS"=A0.Hr9ЁR=@09 @Hr//NPN09 @HHn/N PN09 @Hr//NPN^NuaB09,g N\NJn09,f p /N?X09,@3,NuJ%g$/9%NXJg p?/NXB%NuNVa09 ZHA:"tH$Hv////v//NO nJgZE&&<$bN$.&.N$N$.&.N$ON^NuNV .".$Ү&t&$.&.Ng(BB///. /.Hy p/NO N^Nu/. /.N8P-@-A .g|/. /.NRP/@ ./A".$/&/N//NP-@-AJ.gN-@-A .".N^NuH?LN}p o$HLNu,.*HE8E EC0m0D Dm nJf rNuH@NL,.Nu6C?l ~Nu,.DCClDCt̂~gENztp‚Jg ENz0H@Nu l F`H@J@fF @lF @@lFJkFH@JFlDFN܆rсNuJFgH@ @@HFF@H@NuR܆NuNPNQH0$h "NBiBi/f$h&( S`RB3BHB3BBF4)g\jVBk Bia`Ha,Ri`tiaaSiJkSi`BBBF/gaJFf BfSi`0 RB Bkv$( Jg xiSBk:x Bl281  9o"0 R1 1( SBjRiSCzgR$hG0 gSD6CkxQJCk0Q$hBJigS$hB2)H$L NYNXNuSBfNu|H0$&҃тdRL Nu/t?<@ B m RSWfO$NuNPNQH~0pr3@3@3@3@av 0fi ` -f iaX 0m> 9n8i 3F <)i/gRi`a:<) ҆Bц` .f JifbRi` Eg efPa +g -f ia 0m0 9n*:)iFi im`?)_ f $hB`4)?)_gDBi/gT3|?Jk Si`Jig ktia\abSi`aRi`t4)?)_gN$h$$$h$p0)L~NYNXNu,(g !|NuH$hN<L?3FS fiNu?)_g|Nu/ DH@8D@@8 @ml @m @GmH@H@@` @l f eHHyNXOL <@H@r` @l(@8glHHyNXOLp`P"E:@ @H@ETElDEzх`BAREс* H@@H@`H@сH@@H@( _NuNV/. /.aP$-@-A$<+&<\a N$.&.N/@ ./A".$/@ ./A".$/&/N$-@-A$R&<H@HB8F@BBDGmzBm. fJgNLGm" fJg "NLN,Jf,Jf&HHyNXOL <@rH@NuNGm" fJg "NLN:Gf0Jf JfJfJfN,NNx`@ @Bf(Jf Jf``@AENx@AE`B BG?GhNH@.音G@HB.| GBHD8"DHB8HA0BAHB:HC<HC>HGFHGBFHF݅dSD҃тBCHD,HBhBD HBH@HA0BA`*8HA0BAHB<.HGHGGHFBGGHFdSD҃тeSD҃т,HBhBE HBBH@HA0`:HA0HB<ŐdSEЂeSEЂHEHBhp: "( :HDNbH?aLNuH?aLNuBH@HB<<><8F@:G@BBBBGf Ef.Bm.f.g "NLDgN,JEfFH@f*Jf$HBfJf FN "H@@@H@NuHBfJfH@@@H@Nu~G@BH@HBDg(f fNujD@8NzN҃т m~ӇчE EeNH@EDH@Nun @ADE Eg0JGfBHBfJf @@H@NuփՂJEf*H@ҁр`&JfJfNNL BHB @H@EFGGE G4nҁр G o &tG t`4EH@EDH@Nu Go6HCBBHBG"F,, Df>҃тE m E~ӇчH@E EdDH@NuN mD҇~чEH@EDH@NuH<xr`H<xrJg8j8<D d:<H@HB8F@BBDGmVBm. fJgNLGm fJg "NLJfJfN,NGm4 fJg "NLJfJfN,N:GfJfJfNNx`@ @Bf*JfJfN@AENx@AE`BBE?GhNH@.៳G@HB.៷GB.HG,HFކBGGHGHA,BFHFކHC,BFHFކH@HB,ރv݃ށ݃"HA&HCт$B@@H@HBBBނц҇tтNbNV .". tvNl .". NN^Nu ELH@:EfT*EJfJgH 80DNx@ @LP`,*E fJg0NL` Egػ@EHگ nDR 5o*8DN(`nHE:E@HE @H@ Eo2B@H@HAE En"B$ꩱtӂт$ BE`$*8DN(` lM@H@*NuH B"Cv$j> edHHyNXOL`JH B"C&<$jRH@4B@B?m @H@BBn2DBJk@`>p`8HHyNXOL ` B n޳婳bJjD$& LNuNV n  g f p!# .`p"# .pN^Nu mJElN` ElBDEMXE E9oN2B@H@HAEnE$ꩱtӂтH@@H@Nu$艱tӂтH@E @eN@H@Nu/g@NuJk8Jj JfhJfbJf\ fRNuf eDf8NuJkf,Jf&Jf fNuf efNuJ9vNuJ9wNuH@HDz lH@HA0BAE mBD lPDH@J@fXD|C1FH@,龳F@LDH@HDNup"@H@NuHHyNXOLpr@H@NuHHyNXOL <@rH@NuHHyNXOL <rNug HHyNXOL@H@Nu l4H@HA0BAEl`fv lPCH@J@fXCt;BH@$纳B@KCm H@EDH@NuDEM$ꩱH@@H@NuNV#N^NuNV/.NBXHn/-@NP .N^Nu o"o / oe  SfNuSfNu oH!opNu /fR oL/hNuNVp n-@-@-@ -f r-A-A` n +fp-@ . nrR A ,g* .r N nRr0Ё-@`JgD n .N^NuNVp nR"@ ,gR` .N^Nu o /o "/ SfNuNV/. /.NPN^Nu B$"B$HBHAЂH@B@$ ЂHA$Nu Ar/jAJlADÈJlD/aJ_gDJ_gDNu$ BNu"B$g n0@B@H@"2H@0BAHA$ Nu"BAHAH@B@ BtЀӁnR@Q$ NuA!o "o1Q8!oBh.1| 21|,NACD!ICD!I "o282< "o CX/ ED2Q$_HNuA1o8Bh.Bh21|,NHNuA!o "o1Q8!oBh.1| 21|d,NACD!ICD!I "o282< "o CX/ ED2Q$_HNuA1o8Bh.Bh21|e,NHNuA1o8Bh.Bh21|,NHNuA1o8Bh.Bh21|,NHNuA1o D1o8Bh.1|21|w,N0(DHNuA1o D1o8Bh.1|21|x,NHNuA!o 1o D1o81|.1|21|,NACD!IHNuA1o 0!o01|1|1|1|NA0(0HNuA1o21o 0!o01|1|1|1|NA0(0HNuA1o21o 0!o01|1|1|1| NA0(0HNuA1o21o 0!o01|1|1|1|!NA0(0HNuA1o:1o81o61o41o21o 0!o01|1|1|1|*NA0(0HNuA1o61o41o21o 0!o01|1|1|1|+NA0(0HNuA1o 0!o01|1|1|1|,NA"o 22"o240(0HNuA1o&>1o"<1o:1o81o61o41o21o 0!o01|1|1|1|/NA0(0HNuA1o 0!o01|1|1|1|2NA0(0HNuA1o&@1o">1o<1o:1o81o61o41o 21o01| 1|1|1|3NA0(0HNuA!o01o01|1|1|1|4NA0(0HNuA!o0Bh1|1|1|6NA"o22"o 24"o26"o280(0HNuA1o">1o<1o:1o81o61o41o 21o01|1|Bh1|GNA"o$22"o(240(0HNuABh1|Bh1|MNA"o22"o24"o 26"o280(0HNuA!o01o01|1|1|1|NNA0(0HNuABh1|Bh1|ONA"o22"o24"o 26"o280(0HNuA1o81o61o41o 21o01|1|Bh1|dNA0(0HNuA1o81o61o41o 21o01|1|Bh1|eNA0(0HNuA1o01|1|Bh1|fNA0(0HNuA1o01|1|Bh1|gNA0(0HNuA1o 21o01|1|Bh1|hNA"o 22"o24"o26"o280(0HNuA1o:1o81o61o41o 21o01|1|Bh1|iNA0(0HNuA1o01|1|Bh1|kNA0(0HNuA1o:1o81o61o41o 21o01|1|Bh1|lNA"o22"o 24"o$26"o(280(0HNuA!o0Bh1|1|1|nNA0(0HNuABh1|Bh1|oNA0(0HNuA1o 21o01|1|Bh1| 1|pNA"o "0Bh 0(0HNuA1o 0!o01|1|1|1|rNA0(0HNuA!o4!o0Bh1|1|1|xNA0(0HNuA!o4!o01o41o 21o01|1|1|1|yNA0(0HNuA!o0Bh1|1|1||NA0(0HNuA!o 1o .1o8Bh21|,NACD!IHNuA1oF1oD1oH1oF1o D1o81|.r"oRJf1A2p"o/ EH4Q$_h21| 61| ,NHNuA!o1o81|.Bh21|r,NACD!IHNuA!o1o81|.Bh21|61| ,NACD!IHNuA1o D1o8Bh.1|21| ,N0(DHNuA1o D1o8Bh.1|21|k,NA"o 2D"o2F"o2H"o2J0(DHNuA1o D1o8Bh.1|21|,N0(DHNuA1o D1o8Bh.1|21|,N0(DHNuA1o D1o8Bh.1|21|j,N0(DHNuA1oF1o D1o8Bh.1|21|',NA"o2D"o2FHNuA1o D1o8Bh.1|21|,N0(DHNuA1o D1o8Bh.1|21|,N0(DHNuA1o D1o8Bh.1|21|,N0(DHNuA1o D1o8Bh.1|21|,N0(DHNuA1o D1o8Bh.1|21|h,N0(DHNuA / 1@2!o1o8Bh.1|p,NACD!IHNuA1o D1o8Bh.1|21|q,NHNuA1o D1o8BhF1|.Bh21|,N0(DHNuA1o D1o8Bh.1|21|,N0(DHNuA!o>!o:!o 1o D1o81|.1|21|m,NACD!IHNuA2<"oC/ EF4Q$_!o>!o:!o 1o D1o81|.1|21|y,NACD!IHNuA!o >!o:1o8Bh.Bh21|n,NHNuA1o D1o8Bh.1|21|z,NHNuA!o 1o D1o8Bh.1|21|f,NACD!I 2< "o CZ/ ED2Q$_HNuA1o8Bh.Bh21|,NA"o2D"o 2Fr2<"oC/ EF2JZQ$_"o2Dr2<"oC/ EH2JZQ$_HNuA1o8Bh.Bh21|61|,NHNuA1o8Bh.Bh21|61|,NHNuABh1|Bh1| NA0(0HNuABh1|Bh1|NA0(0HNuA1o41o 21o01|1|Bh1|NA"o22"o24"o26"o280(0HNuA1o 21o01|1|Bh1|NA0(0HNuA1oFN1oBL!o<01o:J1o6H1o2F1o.D1o*B1o&@1o">1o<1o:1o81o61o41o 21o01|1|1|1|NA"oH22"oL24"oP26"oT28"oX2:"o\2<0(0HNuA1o D1o8Bh.1|21|,NA2<"o C/ EF0Q$_0(DHNuA!o 1o8Bh.r"o/ EDR4Jf$_1A21|t,NACD!IHNuA!o 1oL1oJ1oH1oF1oD1o8r"oRJf1A2[p"o/ EN4Q$_1|.Bh01|61|,NACD!IHNu0NAXHNu /"/ o //??<?NA Nu /"/ o //??<@NA Nu //?<ANA\HNu /"/ o ??/?<BNA Nu /"/?/?<GNANu //?<HNANu //?<INAHNu /"/ // /"/ /??<KNAHNu /"/?/?<NNAHNu?<ONAHNu /"/ o //??<VNA HNu"0<sNBNu"0<NBNu4LLLL4LLLLLV1.04Lattice C 2.10Invalid stack size $Invalid I/O redirection $Insufficient memory $Error releasing memory to TOS $  #  ((((( P    !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~cueaaaceeeiiiaeooouuyouaiounnaoaaosAAEEEIIIOOUUYAIOU+-*/<>=>=><=<^ANDORLIKEMODCONTAINS+ABSATNCHR$COSEXPINTLOGRNDSGNSINSQRSTR$TANDATE$FIXFREEROWCOLPROWPCOLERRNOSPACE$ERR$++LEFT$MID$RIGHT$ASCLENVALDAYSDAY$DAYMONTH$MONTHYEARTIME$TIMEVALHRSMINSSECSTHOUSECSLCASE$UCASE$INSTRDISKSPACERECCOUNTEOFFOUNDLOOKUPFCASE$TRIM$REPLICATELTRIM$SER+++++NOTPITODAYNOWFIELDAPPENDASASCENDINGBUFFERSCOUNTCURRENTDISKDESCENDINGDOWNDUPLICATEELSEERRORFIRSTFROMLASTLINEMEANOFFPAGINGPREVIOUSPRINTERQUERYRECORDSTEPSUMSUMMARIZETABLETEXTTHENTOUNIQUEUSINGALLPOSTGOSUBGOTORESTORERESUMELIST?ADDAFTERASKBELLBEFOREBLANKBREAKCALLCHAINCLEARCLOSECLSCOPYCREATEDATADATEBASEDEBUGDELETEDIRECTORYDISPLAYEDITEJECTENDMAXENTERERASEEXECUTEEXPORTFIELDSFILEFOOTINGFORFORMGETGROUPHEADINGHOMEIFIMPORTINDEXINPUTKEYLABELSLETLOADLOCATEMAKEMEMORYMENUMERGEMODIFYNEWLINENEWNEXTNUMBASEONOPENORDEROUTPUTPASSWORDPOSITIONPRINTPROTECTQUITREADREMREMOVERENAMEREORGANIZEREPORTREQUESTRETURNRUNSAVESAYSCRDUMPSHOWSELECTSETSTATUSSTOREUPDATEVIEWWAITWHEREFGBGULBFITATTRDIMWHILEWENDMINVARSDPG %,135;@GKOSX]ahnsy  '/5=BMR\agmrw| !'-28>DHMTYbhoy  %+2:>CKNSY`irx  $)-14SBSB-p-s-zN M HtSB SUndefined errorNot an indexNo more images for this recordPrint command failedCan't open the printerNot an open fileAccess to file not allowedA file must have at least one indexNo record with this keyNo external file field definedEnd of file Can't access directoryCan't access disk informationName too longCan't find this fileCan't find this fieldInvalid statementOut of dataInvalid dateData types don't matchOperator not allowed with textFunction not allowed with textFunction not allowed with numberCan't divide by zeroCan't 'AND' -- illegal valuesCan't 'OR' -- illegal valuesInvalid numeric parameterInvalid text parameterClosing parenthesis missingOpening parenthesis missingFunction syntax -- comma missingFunction syntax -- invalid parameterString too longMisplaced commandFormula too complexVariable not definedField not definedNumber too largeInvalid numeric formatNo file name givenInvalid parameterField already existsFile already existsNo file selectedInvalid field typeInvalid field nameData too long for fieldField requires numeric dataField requires text dataThis field must have some dataField does not match validationDOS can't open file: DOS error deleting file: DOS error writing file: RETURN without GOSUBNEXT without FORDuplicate entry for this indexNo record selectedSUPERBASE error deleting key: 100SUPERBASE error deleting key: 101SUPERBASE error deleting key: 102SUPERBASE error deleting key: 103Memory allocation errorDOS error reading file: DOS error writing file: File contains non-text charactersFile data in wrong formatDOS can't open input file: DOS can't open output file: Undefined program labelSUPERBASE error reading block: 200SUPERBASE error reading block: 201Invalid date formatInvalid numeric formatDOS error reading data: DOS error writing data: Problem positioning in data fileEnd of external fileExternal file not foundExternal file not compatibleProblem reading external fileRemove index before deleting fieldIncomplete -- field or value missingStatement has unrelated sectionStatement does not give TRUE or FALSERemove index before changing field typeCan't total Non-Numeric fieldsInsufficient memoryDongle missing from games port 2Dongle missingError while renaming fileThis WHERE statement must be single fileCommand must be at end of lineInvalid timeInput file not openNot an external fieldRESUME without errorProblem with narrator deviceProblem with console deviceField already has an indexArray variable not dimensionedInvalid subscript for arraySubscript not numericArray already dimensionedWEND without WHILENesting depth exceededProblem loading overlayInvalid statement beginningInvalid statement endingRequired in statementVariable required in statementTHEN or GOTO required in statementGOSUB or GOTO required in statementInvalid form fileGroup not definedProblem opening Font libraryFile open in another directoryProblem opening window1.2 System software requiredAmbiguous referenceELSE without END IFIn use by another fileCannot re-open &;Rc~Ţź*?UgsƀƗƶ )F`wǓǯ+@Rczȍȟȴ3Lkɋɡɻ,Npʒʴ :Vsˋˮ.Od|̷̙Em͌͠2?Si~Λη #=Pgϛϴ 0BTqАЧ3ZAcross cache;Zx0Nm000yyyy############# "A_xxxxxxxxxxxxxxxxxxxx.c:*.**TXTNUMDATTIMEXTDELCALVALCLCCONCLVCOVREQRDORDQIXDIXU  $(,0 @ `@  .SBPPSBPSBPPSBPcccc``lh_)tppkaJzUjbv` log^-)8VP^6X]@Xw0cha6ewm'DWOr,DrpUxd* ^tX4so.[(gv^*x ^tVvbU"Y^8{y>{8{iXDDEFERE^Eja:aXXX = = 0"RBb :z6 UUUUUUUUUUUUUUUU""""""""""""""""""""""""3333333333333333 SBTEMP@.IMG.img   P P 4         % - XP        %$    ! " # $.&-'( )!*"+#,$-%%&</; 0'1(2)3*4+5,6-7.8/90 :1 ;2 .3 L=K">4?5@6A7B8C9D:E;F<G= H> I? J@ KA <BXMW' NC ODPE QFRGSHTIUJVKWL LM  Ya/ ZN[O\P]Q^R_S`TaUX V.10! -,&0 &'(+@ABNOPQTY! PP        "P             "!  ! #%$%"  !"&'()*+,-/0123456789:@ABDPR !# &/=MY --EF45-F5-F5  @߿ ;.dbf;.*  Say what !!!! --EF45-F5-F5> NOPQ%R t2  A A A A AAA@1@@@&q.sbp.sbfi.sbtand.sbq.sbu.sbk.**.*fo.sbv an foff , = ,@& AS "" NEWLINE ON "" .imgDD"".neoDD"" SUPERBASE PROFESSIONAL Relational Database System Version 2.01 25 Feb 1988(c) Copyright 1986,1987 Precision Software Ltd.All Rights Reserved. Unauthorized Reproduction or Transfer Prohibited by Law. Design and Programming: Simon D. Tranmer Additional Programming: Brian C. White Additional Design: Dr. Bruce Hunt Developed in England%V/Q Desk Project Record Process Set System Program Superbase info ------------------- New File Index Open File O Fields Index I Form Close File Fields C Form Edit File Form Save File Remove File Index Text Quit New N Edit E Batch B Duplicate Remove Save S External External Update Edit Load Save Query Edit Load Save Remove Import Export Print Mail merge Labels Screen Printer------------------ Table view T Form view F Record view R------------------ Paging------------------ Options Number format Date format Function keys Load keys Save keys Printer options Directory list D Directory change X Status file Y Status system Z Reorganize-------------------- List L Delete Rename Copy Command A Run New Edit Open Close Save Print Remove'9FSer+8ER_ly(1DN^l|&;CKQ]bgmsz Desk Project Edit Style Options Superbase info ------------------- New Open Close Save Remove Print Quit Q Delete line ^D Insert line ^N Plain P Bold B Underline U Italics I Ruler Insert ^V Help%9:;<=>?JPW]elw Desk Superbase info -------------------flReading directory Please open a file Superbase: indexed on SYSTEM STATUS REPORT ON Memory free: Disk space free: Directory: Files open: Files available: File: FILE STATUS REPORT FOR: File is Current index: Password: Privileges: Block size: Record count: Field count: Index count: File size: valid invalid Yes No None Read R/W All Bytes Contiguous: Field name Attributes Format Location FormulaDIRECTORY LIST OF NO EXTERNAL DATAPage: New filePasswordNew indexBuilding an index may take some time.Reorganizing a file may take some time.Open fileOpen indexClose fileField list closedSave file definitionSave queryRemove fileThis action removes all data in the file.Remove indexThis action removes the index file.For your information...Can't do this...Printer pausedNew sheet of paper?Do you really want to quit?Remove this record?New record created for editingThis file has been modifiedThis record has been modifiedSave this record?Record keyDatabase commandDirectory changeFile nameFilterThis action removes data from the file.Remove records filterImport filterExport filterPrint filterLabels filterThis file exists and would be replaced.Not available in demonstration versionDo you want to proceed?CancelClearOKField openingFields Open fieldsDeleteFile definitionTextNumericValidatedCalculationExternalRequiredAddDeleteFieldNormal indexUnique indexMMMMMMMMMYYYYYYNumber formatCalculation formula for Validation formula for Query filterQuery fieldsQuery reportQuery orderUpdate filterUpdate fieldsValue@FilePositionLengthHeadingCalculationseparatorAscendingDescendingQuery definitionDatePagePrintDiskFileTitleFieldsReportFilterOrderReportGroupSummarizeSUMMEANCOUNTReport count: Group count Label definitionFields per line Label dimensionsTestSingleIncreaseDecreaseLine 1Line 2Line 3Line 4Line 5Line 6Line 7Line 8Line 9Line 10First label marginLabel text widthSecond label marginFirst line next labelCopies per labelLabels per line#*18@SdxPrinter optionsPaper typePaper sizeColumnsLinesPrinter initialization sequenceFanfoldSingleNarrow tractorWide tractor U.S. LetterU.S. Legal CustomSystem optionsDisplay speedCurrency symbolDecimal point formatBuffer countField separatorRecord separatorUse quotation marksExternal file queryImport / Export$ DM F Fr. Pt DKr Kr SEK s mk Drs L. G R TL # |8=BGLQV[`ejoty~JanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberMMM &.7@JanFebMarAprMayJunJulAugSepOctNovDecMMMx|ThursdayFridaySaturdaySundayMondayTuesdayWednesday[3][Fatal error. |Cannot continue.|Resource file (.rsc) not found. ][ ABORT ][3][Print command failed.|Check printer has paper, |is connected and on-line ][RETRY|CANCEL][3][Cannot continue in Low-Res |Please set Preferences to |Medium resolution and reload][ OK ].sbf.sbd.sbp.sbq.sbtsb.parsb.srtsb.tmpsbpro.rscsbprohi.rscLoad queryDate / Time formatDate / TimeDay Month YearMonth Day YearYear Month DayText formatDestination$9,999.00$9.999,00$9 999,009,999.00$9.999,00$9 999,00$%[3][Out of memory. |Try to free memory by closing|files, images, forms, etc. ][ OK ]Open programSave programRemove programSuperbase program: Superbase text: Open textSave textRemove textDelete fileThis action will delete the file.Rename fileNew file nameLoad updateSave updateDateTimeSeconds Milliseconds AM/PM clock Upper caseLower caseCapitalizeRead onlyConstantConstant formula for ResponsesMoreAuto calculationSelective calculationCalculation countStart directory pathParameter file pathTemporary file pathCurrent text file has been modifiedMail merge filterOutput to printer?New file has different record countSource file size incorrect in headerBatch mode onBatch mode offCopy fileCONTROL KEYS FOR EDITING^B Beginning of text ^G End of text^W Delete word ^D Delete line^E Delete to end of line ^X Clear line^N New line ^V Insert on/off^S Split line ^A Join line^F Reformat paragraph ^U Undo , E o    Current program has been modifiedFunction keysLoad function keysSave function keysOpen formEdit Form quits from SuperbaseForm resolution is incorrectDraftGraphicSave this form?Can't find SBFORMED.PRGEnter pathname or insert diskForm data has been modifiedDo you want to replace it?.sbv.sbu.sbk.prtstart.sbpsb.prt"start"SBFORMED.PRG;SBPRO.PRGm cossintancot?R8-se?!TD-?R8-sesqrtapowlogexp ((((( H ((((( H a:*.*>,D   *488                    0(*\d>*v(T: 0tD< >B..x80  ( $( Vz((        <    $ 4     , .      ,      &   *  (  &          ",,$(       D& h4X*L                                    <$P  "  8H(&t$              <.*d"   @ f   $              $ N" B : 6  $   @ *BJ   &        ,   F      "  "        *20(        &    J.*"* $,     <              Z40 lf  :"   *,"   "&     B * TZF.&           \Z0, .F2 2 "D:Tb . $"t RL F tp<.      ,  ^  &4(8 602.  & 0 2     * "   J * 8.00 , J2 (NH8  VV$j0 d<4 D 0( $  @ ZP6:b*  <    ND   ^,       2$,$&         :4   V& "   " ,  "  $T0  4 x           "$   &   0 &                    *  (         $     J   "            ,,                   (R8b n0f(& D0"L  L<"*8" V688D02  <"0> JZd26$l4 ,2$,2$ D p N    n    .        . .  &"@&,:4&2$@0>*.R6N0  &"*$2V   .@0>0\*    .   0$ " Zr@* 6&  (Z26f  .BD4    4 0F. nr D&>* :6   B             @@f$     " &"2H:    * 86 RR  4,H84ZT2:BJ,J,H&6X~, 0 8  "n X&(PD"4N $:D$R  *.. "PZ2Z $~ 2 ("2DT04 &F4&Z6 . & ,  2(0">4,R<>|h "8       6  $    $,  "">^l   Jd    h8  @0 .,~ >X"0(6@ "`   LN      $    $    &, &  .   &"R4 >0dt  6J &(0   ,      ,& &$&""   0$     6   & " >"""h0     (2 D: . "   $    @,< F@"                        "   D&,           "         :     2        *           . *R      ,"              $". $     "   &  $*    T,      "        "         " $ 2 .     (      4   <     0        HX D8 `    $      B   2       `     $       " 0\>( f    60 D ,       (      P               "           0  (d f      4     *(,*&20 < . jv&" ^2  .*Z   &@L   4           T R"2(RRTl>L6*H :2(, " * ($        & N *   "          B .  4 ,  ",  "4 >82L  4  2 6 D:(N26$".    Fpd@8 dR" F"*  8 , 6" \  2   H8 L4 .   F" :6,            " >4F&"2Ldr&   (0,J F B0 2 J4 >4 ((     F4$          ,X"  @$6 * *                       $HHN$..@N22.28 8 vJ:8 .Bv<* 26.   * , " " *  0B*4 " & ( 2&  0  . "    R  &@ < .      &         8  (,6           "L*" &          $"B         R^L   02 & & 4      $                    0 "              "(                *                                    &             6  0&" ,"     $ $   (         >"Z : 6 2( 8  2$*   .          . " F 4        2J&    0    *  B4$  $  $  $ FH  $  $  $     *  $ p " H                        ^".>  (   $ ,"R&6  " ,0 8  (&: " 4  $       ,          & F L$   B (  (    0^<  z      "4 * &                 r     "   l  0             n   6   V    Z   J   ,4 (    x2 ,44J4HH &0    &$      $ P"P* $    "..4@z*$"&&* ",. *>&*zD4 @<  ."8 .$", X$j`*   $ 2 "  (@0    $  `"&: 0(( jR(""*\6$&", f    6:     ,(N X.4 L< F("0.(666 JX$X"b"l  (0& 2(0D:4`2>" 66*66FT "8&<"".4b&&&"L2@4. (2.44* ~$*:: PD 8.<z H2(, $ T>(.42:,$B   >8X,.""`0<4z & J( $ $ $ $ ,>, D * : * : * < *v>0$ D@&$B*@   *B4z,24   $        (  @,B   "B4T    0(@,.*  F4$    (4D$4$B42FD2J,: : " .4   * $  6R6 4.,6 4@4 4B( ::* ::F 6& "$ 040F@  <.   H64 ":.` 0 "  `6H|<~.::6 4"&         0L   $ "  RX&DF&      " ,rd*\n 0  "0      (    .2       @ "2 &"  bB" X   "     &"$J<,    , @   ":$(>  0n~  "H& L  (bZ~       ".,$,(8&2 "("""*R< """8":.2 T4.  F ""&.$ &  & $LF8 $" " (""J22 X  &, n &V*^bN  " :,4^BhR :NL8 $(N>*< *<   "" **000H<* T*T*"0L0*0::""(.@"@.".*(<""h "(""0"""("""""&" &"6P& " (.` .0(>"*8n, * t(." 8^8>* 8.00 , J2 (NH8  VV$j0 d<&6$vOrKPO11TEXTTEXTTEXTTEXTTEXTTEXTTEXT11111111_______________XXXXXXXXXXXXXXX1119.09.9*.00.0-+/-(-)(0)$9$ 9(,)E 99999.00 1 27 September 1986 ___________________XXXXXXXXXXXXXXXXXXX111111123___99911112__991S---------------------------------------------SS132___99966__99SS___________________________________________XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS1111111111111111111150,150_______XXXXXXX150,150_______XXXXXXX11110__99111_9111SS11111111111111111111S123456789012345_______________XXXXXXXXXXXXXXX1111111SSSS1111111S=<>AND+<>OR-<=>=NOT*()LIKE/+:-*()/STRINGSTRING +&-AS*()LINE/SSSONSSTSTSTSS&S111111111111FF1F2F3F4F5F6F7F8F9F10HELPAltS________________________________________XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXO________________________________________XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT________________________________________XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX$D1C1111111??????????????????????????????????????????? ?<??<? ????????~?`????????????????? ???? ???????????????????0??0???????????????x????x???xxxx~~xxxxxxxxxxxxxxffxxxx~~~~xxxxxx~~~~xxxxxxffffxxxxxxxx~~ffxxxxff~xxxxxxxxxx~~~00000?????CDEJKLQRSXYno t t+/3=@C| t t t,    !"#%&')*+-./12356AIQ tYai tx{~ t t t t t t tttttttttttttttt t 0 tCEFGIJKMNOQRSUVWYZ[]^ghi tmopqstuwxy{|} tWXY t_`q)q)  3@q)DM K 6 D(R (`(n(|  (& (- (3 (9 (?!(E  )=$7&'7  t7777 "7 >7 Z7v7 @ @$ Z \ @2 @@ @N& @\& @j& ^ ` b( d( f( h i+j4k"l  %!$9#""@1!@$@x @&q'@ ( )@    AA AAAA  A A A A  AA  AAAa@@@AA  A  A  A   A  A A/ A. A  A- A,   q@@ !# % @.@< ') *  PJ PX Pf 7 9 ;q F.  -H,J-xz:    -, -&-V++q 1   *  t@r@@@ @ @ @   @1 @@t @t@ 6@ R@ n@ @ @ @ @1@@@7 8"  9 ': $;t @ =  "?  @ ! q  s uw!2 @ q!N F (!j0! =! =! =! =     ?    > 5 %, *-            ! " ". "J "f "  "  "  " "  #!#*"#F##b$#~ %# &@ '@( )  * % %# @A Bt# # $  $& $B $^$z@1@@@@ @* _  a L-ce$ +j k l$ t @$ @$ @$ @% @%"@%>@%Z1@@8@F %v '&   !" #$%& (T2)1*+,-./01(B3A456789:;< =>?@A 2LCKDbEFGpHIJ~KBMRNOPQRL   2            ".'$(2 %   '*- 03 6 9 <  ?B" FJN S%.Z'[!\.]*%**%**%*@  \  ^ @  `  @  b d %e# . fhjlnpr't$ &'R'+-0:14B7Z9;?AIK MNL  2           ! )2 !   #&) ,/ 2 5 8  ;>" BDF K+.R'S!T.U*,**,4**,P*@#  T  V @#"  X  @#0  Z \ %]# . ^`bdfhj%l$ ,l-.42$468$:d=|@AEHOQS$T'bb!$j*QKPQJ11TTEXTTEXTTEXTTEXTTEXTTEXT11111111_______________XXXXXXXXXXXXXXX1119.09.9*.00.0-+/-(-)(0)$9$ 9(,)E 99999.00 1 25 january 1987 ___________________XXXXXXXXXXXXXXXXXXX1111123___99911112__991S---------------------------------------------SS132___99966__99SS___________________________________________XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS1111111111111111111150,150_______XXXXXXX150,150_______XXXXXXX11110__99111_9111SS11111111111111111111S123456789012345_______________XXXXXXXXXXXXXXX1111111SSSS1111111S=<>AND+<>OR-<=>=NOT*()LIKE/+:-*()/SS +&-AS*()LINE/SSSONSSTSTSTSS&S111111111111FF1F2F3F4F5F6F7F8F9F10HELPAltCCOS________________________________________XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXO________________________________________XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT________________________________________XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX1D1C1111111???????????????????????????????????????À?ǀ?π?ǀ?À????????8?x??x?8????????8?|???p???????`?p?x?|?x?p?`?????? ???π??? ?????????????????????8?0?0??0??????????????? ?x??????x???xxxx~~~~xxxxxxxxxxxxxx<ff<xxxx~~~~~~~~xxxxxx~~~~~~~~xxxxxx<ff<<ff<xxxxxxxx~~~~<ff<xxxx<ff<~~xxxxxxxxxx~~~~~~0000000??|xp`px|?><808<>????p0p?y99y?x??|??xx????????`p?????8|?j*J j *    * j     * J j   J j    J    *j *J j *J** *Jj*J j*J jft)+,-2349:;@ABGHINOPUVkl| t t&*. t8;> tw{ t t t,     !"$%&()*,-.01<DL tT\d tsvy t t t t t t ttttttttttttttttt + t>@ABDEFHIJLMNPQRTUVXYbcd thjklnoprstvwxz{|~ tHIJ tST} t) t)' t)DN  L  ( ((( ($ (,* (:0 (H6 (V<!(dB r )t> $7&'7  t7b7~77 7 7 7 7 @ @  W Y @ @  @& @&  @& [ ]  _) a) c) e f+g4h"i   &  %!$9#""@1 !@$@  @ &q'@( ( )@6    AA AAAA  A A A A  AA   BADARA`an @| @@ AA ^ A  A  A  A  A A/ A. A   A- A,    qAA p     @ @ "$%  z P P P 2 4 6q  A.    -C,E-su      -, -& - ++q  1   +  t!!"!>!Z !v ! !  @1 @@ @t@!@!@"@"@":@"V@"r@1@@$@22 3"  4 '5 $6t @ 8  ":" @@ "  l  n pr" @N | ~ q\  j  "      F ("0#=#6=#R =#n=      ?   > 5 %, *-               # # # # # $ $2 $N $j  $   $!$"$ #$$% %%. &@x '@ ( ) * %%   %J ; < = t%f % % % % %&@1@@@@ @ Z  \ L-^` &* +e f g$ t @&F @&b @&~ @& @&@&@&1@@@ '  '&     ! " # $%& ( 2)1 *+ ,-./01(B3A 456 7 89:;< =>? @A 2LCK DEFG H I JKBMRN OP. QRL  1             /'(2      !$ ' * -  03"  7;? D'&.K'M%O. Q*'B* *'^ **'z*@<  P   R  @J  T  @X  V X %Y$ . Z\ ^`bdf 'h$ '()^-N/F13N58;v=VA^CKNLNP. 2         %(2            "   $-x.+'-%/. 1*-* *- **-*@$  0   2  @$  4  @$  6 8 %9$ . :< >@BDF %H$ -/8/358 9;>AC`GhIQXRTV