`8NNNNpA`p NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNN@`  @`! #@%`')+-/1 3@5`79;=?A C@E`GIKMOQ S@U`WY[]_a c@e`gikmoq s@u`wy{} @` @ ` @ ` @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` @`!Aa   !Aa!!#A%a')+-/1!3A5a79;=?A!CAEaGIKMOQ!SAUaWY[]_a!cAeagikmoq!sAuawy{}!Aa!Aa!Oa!Aa!Aaǁ!Aaׁ١!Aa!Aa " B b  !"!B!b!!!!"!""#B"%b"'")"+"-/#1"#3B#5b#7#9#;##?$A"$CB$Eb$G$I$$M$O%Q"%SUb%W%Y[%]%_a"&cB&eg&&&wy'{@`  @`! #@%`')+-/1 3@5`79;=?A C@E`GIKMOQ S@U`WY[]_a c@e`gikmoq s@u`wy{} @` @ ` @ ` @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` @`!Aa   !Aa!!#A%a')+-/1!3A5a79;=?A!CAEaGIKMOQ!SAUaWY[]_a!cAeagikmoq!sAuawy{}!Aa!Aa!Oa!Aa!Aaǁ!Aaׁ١!Aa!Aa " B b  !"!B!b!!!!"!""#B"%b"'")"+"-/#1"#3B#5b#7#9#;##?$A"$CB$Eb$G$I$$M$O%Q"%SUb%W%Y[%]%_a"&cB&eg&&&wy'{DBMAN4 CSWDBMAN PRG:MHELP DAT:MVDBLABEL CMD:M^nERRHELP DAT:MoASSIST CMD:MTUTOR CMD:MuCV3REP TTP:M GCDB3REP TTP:M?CNVV3 TTP:M.;CHEKBOOKCMD:M=4UPDATE DOC:MKg"3TO4 DOC;MTLABEL DBF;MZ\ERR DAT;M`BRPRTI DBM;Mf CHECKS DBF ;MiFINDFILECMD ;MkASSIST1 CMD;MmZTRLABEL CMD;MnMAIL DBF;MoSYSDATA DBF;MpCHEKBOOKDBF;MqtTPMENU CMD;MrMAILLISTDBF;MsDBMEM MEM=Mt@CONFIG DBM#;Mu>TUTOR PRO=MvxASSIST PRO>Mxh DESKTOP INFE>M|LA_____DBF;}}` s1d*o m$m,B"HJgP"&J$YJf"Jg< Af Rf Gf Vf =f Jg#~B "&J$YJf"Jf&f2B "~EHB2 r ggSJ"g fB*`B" n#n.I+I/ ##//SA?/ / Bg?<JNA Jf.?<?<N.>N|?|BWN.>N|XON" ?N?<LNANVN/<3`/. ?.NP J@f6/<#/<1|N.PO/<3`/<1N.POp3@Nq(p3N`N^NuNV=yR=y-y-yJJy4^f p?NTONJy@gp =@By@` NȚ=@N3R3By3##JN0. | 2< `XHXW PN`Jy4`f BgNTOB@`VpG`PJygjNBf=@g\?.NTO`L?</<1|/<PNn N`(B91|NJyg?.NC TO`/<1|N$XO`p33 yf`Jy4g By4NJyfp?`d?</<P/<1|Nn Sy#Jp3RByN=@Jy4^f p?NTOJnfNvB91|N` ng ?.NrTONRy`&N^NuNV/.NXOJn g4=y3By3?.?./.NPO=@330.`?.BBBp?/.NRN^NuNV-| n-P n-hX n=P .T-@JfLBn0.nl0 n np1@ n -H n-HRn`# nBN^NuNV y hf y-P`-y3z4dBgp?/. y?(BgBgBgBgBgBg y?(?9?9HnN0 y hfnnp@p@3z4dHnHnNq>PO nf ng nf< nf4HnN(XO=@g0.`HnN>XOJ@gA-H`Ns(Jy4gJngp34Jy3gJnfp33By3p?HnN\ONXJy3g34 34By4By3Jy3gp `B@N^NuNV yfp/`( y-P n=h 3z4d09H-@Jy^gRyp?p?/. nB@( ? nB@(?BgBgBgBgBg n?( ?9?9/.N0 3z4d nBHnHnNq>PO nf ng nf nf|HnN(XO=@g0.`:HnN>XO=@gV 9NnR@y4nlHn/9NN.PO n!yN0.R@ yN#N`Ns(HnHnNq>PO nB nfp nyff n ( fp=@ 9Nny4nlL n!yN yNRNp-yN yN#N/.NMXO=@fND=@f nHh NMXO=@g` n ( fp=@ 9Nny4nl n!yN yNRNp-yN yN#NHnNXO=@fPND=@fBHnNXO=@f./.?.N\O nHh?.N\O` p6`BNs(HnHnNq>PO nf nWf nBHnNoXO=@fHnN>XO=@0.R@HйNy4nnHn/9NN.PO n!yN0.R@ yN#NHnHnNq>PO ng nXgNs( nB(` np@`Ns(HnHnNq>PO n f~ n)fvHnN(XO=@fHnN>XO=@gV 9NnR@y4nlHn/9NN.PO n!yN0.R@ yN#N`Ns(Jy3g p33`RyBy3Jy^gP/<$09S@??9N6POp?/.N\ONX/<$ ?9?9N6PO`p?/.N\ONXJy3g34 34By3Jy3gp `B@N^NuNVJyfB@`BnJn g&HnNDXO=@fN!=@fSn0.ym 09S@=@JnnBnp330.R@34X0.H-@ nJg n/(NXOHn/.NPO34\By334V nJg6 n-h n g n f/.NXOJ@gBy4V y4VfJnfN` y4Vfp094\ | 2<`XHXW PN`Bn`09S@=@`09S@noRn`Jno`09S@nf`v094Vn` nJ(gJngL nJ(g@ n/(N ZXO=@g(0.N^NuNV/./<N.POBgN3TOBy-y-yJ#JN2=@##JBgN4rTO0.N^NuNVJngN`NXByByB@N^NuNV nfNp?N TO`$ nfNd`N8p?N TOB@N^NuNVNByByBy4 NJy3g # V` #$VpP?NTO/<DNdXO/<@NdXO/<8NdXO/<Hn/<#NUBPO yJ/(NpXOHnBgp?p?N `:HnNpXONi=@Jng0.` yJ/(NpXON N^NuNVp33Jy4`g/. ?986/.N. `N nB?9zBg/.09yS@?/.?9?9N/.N>XO n 0By3B@N^NuNVp?p ?/. ?.BgBgBgBgBgBg/. N>XO??. ?.HnN0 nJg-n0.@p?HnN\O0.@HnHnNPO34\N^NuNVB.?9zp?/.?<Hn?. ?.N/. HnNUBPON^NuNVHn n /NPO?9zp?/<#?<Hn?. ?.NHnNXO n N^NuNVNBg?9?9N6\ON=@34\?.NTOJ@fp =@0.@B.Hn?9?9N6PO yJJfB@`( yJ/(NpXOHnBgp?BgN N^NuNVJy4gp34By3N"By4Jy3gp `B@N^NuNV yV PfX n-h8Jf$-|#/.p?pI?p?N `$ n .XO n0NNB@N^NuNVBy3=y4^=y4$By4^By4$NsP34^34$/<1|NpXOHnHnNq>PO nf nKg< nfpc`>JyRg344/<1|NXON"By4`fJy3gp `B@N^NuNVJng?.?. NYXO`H n fB@`PO ng nfB@`Ns(p6N^NuNVBn09H @bH0@  PNJfB@`/9NpXOHnNXO=@g0.`Jng`/.NJg/9/.NPO`/.N<` /.N XO=@g0.N^NuNV0. @bH0@ PN3HB@`~/<NEJXO=@g0.`dB `BHnHnNq>PO nf ngNs6`/<NEJXO=@g`#HnN`pN^NuNVHnHnNq>PO nfH?.N$TO=@g ng0.`0HnHnNq>PO nf nfNi"`Ns(B@N^NuNVBn-|4Jn g/</.N`,PO=@g4`p-yBBB/./.N`PO=@fL#Bp=@-yV#V?././.N& =@#V/.N_FXO0.N^NuNV n-P n -P/./<BN1PO/.HnN1~POJng#BA-H n=h2 yJgR n-Pg< n ( f0 n h d$ np h n=@ nl np 1@ XX`/.N`XO=@f^/.N#XO=@fB.HnNrXOJ@g>/.NXO=@f$/./.N0PPO/.NrXO=@g0.`#BA-H yJgp n-PgZ n ( fNHn n/N POHn y/N POHnHnHnNtZ Hn n/N@POXX`/.N" XO=@g nfPB@N^NuNV n-hX .T-@ n -hX .T-@ n=P0.SnJ@g*/./.NPO n-H n-H`N^NuNV n-hX .T-@ n -hX .T-@"n n0=@Qgp`@0.SnJ@g2 nBA( nB@( Af n-H n-H`B@N^NuNVHnHnNq>PO ngp6`` n g nfN!=@g0.`< n fp`B@=@0. ]@ @bH0@ r PN`0. @f33`0.J@f34"`0. | 2< `XHXW`33`33`33`33`33`33`x33`n33`d33`Z34`?.NTO`F n-Pg: n-hPg. n1n`"3`0. @Sg @Vf33B@N^NuNVHnHnNq>PO ngp6` n g ng nf nf$HnN(XO=@g$Hn HnNq>PO` n fp`B@=@ N!=@g0.`0. @f0. @Mfv ng 3 ^`dJng" ng n& fRp:$ $`0HnN>XO=@ nn.H`$$ B9$!B9$B@N^NuNVBn0. @bH0@ PN0.`Jp?NmTO`:N `0N@`&N!J@fB94`Nr//<4N.PO`N!J@fB95`Nr//<5`NG|`HnNDXO=@g`hB@`N`N!J@f B96`DNr//<6`~=y=yNiB=@f n fTN!=@fp?09y?09yH?0.y?0.yH?Nn `N!J@f:?<?<?<?<?<?<?9?9?.?.N6`tHnHnNq>PO nf nmgp6`N!=@f@?<?<?<?<?<?<`/<DNdXO/<@NdXO/<8NdXO/<PO nf"0. | 2<`XHXW`THnNDXO=@fD33`8By3`.p33`"p`p`p`/<8NDXO=@fND=@f/<8NDXO=@fND=@f/<8NDXO=@fN!N^NuNV n-P0. @bH0@ PN`/.NXO/.Ne\XO/.`\p?HnHnNE =@g0.`BN!=@f n-P/.NXO/./.N$PON/.NrXON^NuNV n (XT-@"n iX=P0.SnJ@g n (XT-@"n iX=P0.SnJ@gX/./.NPOJ@f6HnHnHn/.N?.?.Hn/.N ` n-H` n-H`fB@N^NuNV# yJfT n -hX .T-@ n=PBn0.nl" y X n-HRn` yBN^NuNV n -hX#B-n yJgf y-P .T-@ n=P nB0.SnJ@g,/./.NPOJ@f n ` n-H`XX`N^NuNVJyg"p?N3TO=@g0.`rBy`p33BgNTO/<NBXO=@gJyfp?N4rTO`Byp+?/<3`/<Nn N=@gNBD ng nfl yJg y hg\ nf> yJhfp` y hfp ` y hfp`p?`~ yJbN\` nfJJ9gB yHh/<NPOJ@g& yJ(1fp?N4rTO=@f0<`p?N4rTO=@fB@N^NuNV?9FNOTO-@NBDJngN5=@g0.`pXO?Hn/<$x/<HnNzp?HnND\O=@ @g ?.N>(`"BgHnNC\\O=@ @g?.N?:TO=@?.NE TOBgN4rTO0.N^NuNVp4?NTO#$*fp` y$*B0 y$*Bh.p4?/9$*?.NGPO @4gp ` y$*=h./</9$*N.PO y$*1yF, y$*Bh. y$*B0 9$*0-@0.SnJ@gZp4?NTO-@gT y$*Rh. n .0-@p4?/.?.NGPO @4fN nB0`B@N^NuNVp4?NTO#$*fp`/</9$*N.PO y$*1yF, y$*Bh. y$*B0 9$*0-@=y4^=y4$By4^By4$NsP34^34$/<1|NpXOHnHnNq>PO ng nf nJfHnNoXO=@g0.`p4?NTO-@g y$*Rh. n .0-@Hn/.N.PO?9FNOTO n!@, nB0`p4?/9$*?.NHPO @4gp`F y$*=h. y$*-h00.SnJ@g p4?/.?.NHPO @4f n`B@N^NuNVJ$*gh y$*?(,NOFTO y$*-h0 y$*=h./9$*NXOB$*0.SnJ@g n-h0/.NXO-n`B@N^NuNVJ$*g y$*-h0 y$*=h.0.SnJ@g^/./.NPOJ@f> y$*3,FBg n/(, y$*?(,NOvPO09$(@3$(B@` n-h0`pN^NuNV/.NAlXOJ@g(09$(@3$(/.NO.XO3Flp`B@N^NuNV09$(@f?9FNOFTON^NuNV y hg/<$}NZXO09$(@g^ y$*3,F"y y (6/0)4H -@Bg/.?9FNOvPO fp `(NsPNBDB@`/<3`NO.XO3FlpN^NuNV09$(@gB@`6/<$NFXO y hg/<$NZXO?.NTON^NuNV y hgp$`JyRg?9FNOTO-@=yBg y/(?9FNOvPO y0( S@3N\NsPN=@g0.`JJyRf@N\Bg/.?9FNOvPO3p3R` y3RN\B@N^NuNV-y y hgD yJd y hfp$` y hf BgN;TO`N\`SnfJn g?9FNOTO-@=yBg y/(?9FNOvPO y0( S@3N\NsPN=@g0.`\JyRfRBg/.?9FNOvPO3-y# ybNsPByRNJ@gp `B@N^NuNVNBn/9NXOJ@gpd=@Jy4`gNDN0.N^NuNVJnfB@`"Ry8NE=@gNTSy80.N^NuNV-|D/<$HnN.PO098.Bnp=@Nr-@NkJ@f@NDJ@g.N!J@g$/.NpXONi=@g0.`,BnNs(`Ni=@fBnJngp/9N>XO=@Bg?.BgHnHn/.N=@f?.Bg/9/.N np@ /9/9 NdPO`d y?( y?( y?(HnHn/.N=@f, y?( y?(/< /.N 0.Rn @ mBnR.p0@`R.NDJ@gN!N^NuNV/<$HnN.PO098.Bn-|Dp3@HnHnHnHnNrBy@ nf ng Jngpe`fHnHn n/N" J@f?././.N* 0.Rn @ mBnR.p0@`R.NDJ@g`N!N^NuNVp3@p34 HnHnHnHnNrBy4 By@ nf0Jnf*HnHn/.N J@f/./.NPONDJ@gNs(B@N^NuNVJn gHnHnNoPOBg/<NC\\O=@ @fp1`.?.?. Hn/.NIF =@?.NE TO0.N^NuNVBn Dfp=@"n Q-hX n=P .T-@-yN0.SnJ@gJng nJ(f n ( gJng/./. NPO=@Jng nfJnf nfJnfA-Hp?/./.Nn n?( N TO n1@ nHh/.NPO nHhN>XO@=@?.Hn?.NHPOngp`4T n-H`Bnp?Hn?.NHPO @fB@N^NuNV n fNX`Jn f /.NXO/.NJXON^NuNVp?/<ND\O=@ @fp`$?./.NK,\O=@?.NE TO0.N^NuNVBBn Dfp=@?<Hn?. NGPOJ@np `JnfB@`A-H n?( N TO n1@ JngHn/.HnN`Hn/. n/N" =@JngB nHh nB@(? n?( nB@( ?/././.N$=@g0.`0 nHhN>XO@HѮBg/.?. NFPO`N^NuNVp@ n-PB=y3By3/.N#XO=@fR/.N" XO=@g33 ng0.`h/.HnNPO yJJg0 yJ/(NpXOHnBgp?p?N =@fJyfN"HnNMXOB@N^NuNVBg/.HnNX Bg?9zHn?9?9N\ NXN^NuNV-| Bn n l< n-PJg$ n h,g/./.NPOJ@fp` XRn`B@N^NuNVBn n-P/.N#XO=@fNT=@/.N" XO=@g ng0.`0.N^NuNVBnBy4Z n-P n 0(=@ n Jl 0.RnJ@g2/.N,XO=@g`0.SnJ@g/.NXOR@=@ n-H yHf$0<Ȑn?/9/.NQ =@fBg/.NQ\ON^NuNV n-P nJ`g n/(`NXO nB`JfB@`6?<NTO n!@`fp`?</9 n/(`NQ N^NuNV=y4By4 n/(`NpXO/. NXO=@340.N^NuNV n-P nJ\fp`"n i\3H"n i\# n (\\-@ nJfB`#/.N>XO n-H yHf .R#p?/.NQ\ON^NuNV/. NpXONi 9J =@nmp3`?./. /.N* B@N^NuNVBy4Z n-PJn g /.N" ` /.N#XO=@ n h\!y/.N XO0.N^NuNV yV//94NRVPO=@/<4N_FXO0.N^NuNVBn"n iX=P"n iX=PJBfXO @mp3`r?< y//<`R y/N>XO @PlpP? y//<`( y/N>XO @l?< y//<BN* B@N^NuNVN!=@f NB@`:HnHnNpPO=@g0.`NHn/<|N.PONxN^NuNV-| Bn n l` n-PJgH/./.NPOJ@fp`< n-hPJg /./.NPOJ@g n-h`XRn`B@N^NuNVHnHnNq>PO nf ngp6`HnNDXO=@g0.`0.]@ @bH0@z PN`0. @%g @Bg`0.3z34d`3N`0. |>2< `XHXW`31l`|34`r34`h34`^3z`T3z`J34T`@3$`60. J@g @g `&34Z`34l`0. @4f34B@N^NuNV/ HnNDXO=@g0.`Jnm n mB@`0.H @4Jf&0.H&@4?<}NTO&fp` nf0.H @4/NdXO`p?/<ND\O=@ @gH?<}0.H @4/?.NGPO @}g?.NE TOp `?.NE TO`:p&_N^NuNVHnNDXO=@g0.`>Jnm6 n l.0.H @4Jg0.H @4/NXOB@N^NuNVJy3fp6`z nfB@`nJng?.NZTO`ZHnNYXO=@fD n f*HnNZXO=@f*NDJ@gN!=@g`HnNZXO=@g0.N^NuNVp3@HnHnHnHnNrBy@ ngp:` Jng nf/./.N.POB@N^NuNV-|DHn/. n/N" =@f0.`^=y8By8Bgp?p?/.Hn/.N=@38JnfBnp?p?Hn/.N N^NuNVHn/.HnN =@g0.`/./.NdPOB@N^NuNVHnHnNoPO=@g0.`N!=@f-|D n P (XT-@"n"Q iX=P-yN0.SnJ@g\ nJ(g@/.HnNPO=@ nfJnf nfJnf/./.NdPO n-HT`B@N^NuNV/ nm n nSn0.H @4Jf&0.H&@4?<NTO&fp`0.H @4/N(XOJ@g.0.H @4/NXO0.H @4B`|0.H @4-P nJg` n ;fP/.N>XOS@=@?. nHh nHhNn np  np @Jnf nB(R`B@&_N^NuNV/<$/.N.PO nHh?. N*\ON^NuNV n-hX n=P .T-@0.SnJ@g n ( fp` n-H`B@N^NuNV/.N]nXO=@g0.` /.N_XON^NuNV nJg n//<NPOJ@g@/<NVXO=@g0.`|/.N_FXO/</.N`,PO=@g,` n-P/.NXO=@f nHhPNkXO n PHhd/<NZPO n PHhdNC XOB@N^NuNV n-P/<NVXO=@g0.`/./<HnNk =@f .P-@ nJg n-P .` n -y nHhNpXOp34 #Ni=@By4 /.NpXOJng nHhPNkXOp-`B@N^NuNV n/NHnHn/. N ~ /./.N?./. HnN= ?93p??.HnHn/.N*|=@f/./.NPO=@fp=@ n (*1fFJy3g>?93Bg?.HnHn/.N*|=@f/./.NPO=@gJnff nJ`gHn/.NPPO=@fdJnf@?93Bg?.HnHn/.N*|=@f/./.NPO=@gDJng /.NZXO/.N XO0.N^NuNV n/N:XON^NuNV/./.N>"PO=@g0.`.p#?/. n/N# =@g/.N?0XO`B@N^NuNV nJg2 n-P nHhNkXO n/N#XO/.N?0XOB@N^NuNV/./.N>"PO=@g0.`0?94T/. n/N$f =@g/.N?0XO`B@N^NuNV n fpU` n-P .T-@ nJg6 n-P n h f"n n /.NXO`-n` y/NpXONi y 9JR@@=@0.@?NTO-@ n fp`Z?. y/ nHhN* "y n1i "y n1i n1n nB n!n B@N^NuNV n-P .T-@ nJg6 n-P n h f"n n /.NXO`-n`B@N^NuNV nJg n-P/.NmXO/.NXOB@N^NuNVJy3fB@`-nJg n-h nJhgX=y3By3 n?( nHh/.Ni =@33Jng ng n+`f n-P` nJg nHhNpXOHnNMXO=@HnHnNhPOJnf /. n/NPO=@g ng0.N^NuNVJy3gt-nJgh"n i-PgP/.N6XO=@g0.`D np1@F n (HnHn/. N ~ /./.NXO?Bg`4-n Hn n?N*\O n?( BgHn` n?( p?/. /.N =@0.N^NuNVHnHn/.N =@g0.` nB@( @b~H0@ PN`nHnHn/. /.N/. ND$XO`FHnHn/. /.N`*HnHnHn/.NHn/. NTPOB@N^NuNV?.HnN\\O?.?.?.HnHn/<8N=@g0.`/. HnNuhPON^NuNV?.HnN\\OHnHnHnN J@f/./.NPOB@N^NuNVBnp=@0.SnJ@g0.Rn?Nw TO`N^NuNV?.HnN\\O/. HnNv PON^NuNVBn n n?. NwTO`?./.NL\O=@0.N^NuNV/<HnN.PO?<zNTO-@fp`HJnfBg/<NC\\O=@ @f/.NXOp`Bg?<z/.NPO n0+ npP1@ np1@ np1@ nBh np61@ np1@ nBh8B@ n1@6 n1@BnBnJygp?N3TO=@Jnf=y3By3BgNTO=y-y-yJ#J/.?.Nzp\O=@##J3NwdJy4`g p?NTO33Jygp?N4rTO=@/.NXO?.NE TOJnfJng nFfBnJnf HnN XO0.`p?/<ND\O=@ @f/.NXOp`f?<z/.?.NGPOJ@n/.NXO?.NE TOp `2/.NdXO n P+gx/.NXO?.NE TOpN^NuNVBn?./. N|.\O=@g0.`?./. N\O094\Y@ @bH0@ PN` nm6 nl . :-@0.U@P n-H nJhzgxRn`pJnghSn`` nmV . :-@-n n@-H .P-@0.U@P n-H-n .P-@ .쐮=@ y 4\f,?././.Nn Bg?<P/.NPO`?././.Nn Bg?<P/.`pF`H/. NdXOBgB?.NFPO fp ` ?<z/. ?.NHPO @zgp`B@N^NuNV/<8NdXOp ?/<$/<$/</<Nz0. J@g @g .:-@0. U@P n-HBgpy?Bg/.BgNv Bgp?p? nHhzp?Nv Bgp?p? nHh|p?Nv Bgp?p? nHh~p?Nv Bgp3?Bg nHhp?Nv Bgp3?Bg nHhp?Nv Bgp3?Bg nHhp?Nv Bgp3?Bg nHhp`TBgp=?Bg nHhBgNv Bgp=?Bg nHhDp?Nv Bgp=?Bg nHhp?Nv Bgp=?Bg nHhp?Nv Bgp?p? nHhp?Nv Bgp?p? nHhp?Nv Bgp?p? nHhp?Nv Bgp?p? nHhp?Nv Bgp?p? nHhp?Nv Bgp?p? nHhp ?Nv Bgp?p? nHhp ?Nv Bgp=?Bg nHhp ?Nv Bgp=?Bg nHh

-H`Bnp=@0.SnJ@g .:-@0.4Ю-@ n *gp=@ nJhzg0.SnJ@g0.4Ю-@B. nJgHn/.N.PO=@g/.` n?(zHnNp\OHnNXO nP-HJngt nJhzgh n?(NrTO`TNRn`B@N^NuNV nJ(@gJy4gJy4 f /.NXO nJ(@gp`p=@Jy4g$094ny4 lNH/.NXONHn nHh@N.PO=@g nHh@NXO0.`HnNXONB@N^NuNV nJ(gJy4g094U@y4 lNHJy4gJy4 f/.NXONHn nHhN.PO=@g nHhNXO0.`JHnNXONp?/.N\O=@f nJh8gJy4gJy4 gNHB@N^NuNV nJ(gJy4g094U@y4 lNHJy4gJy4 f/.NXONHn nHhN.PO=@g nHhNXO0.`(HnNXONBg/.N\O=@fB@N^NuNVJy4g*Jy4 f" nJh6f/.NXO/.NbXO# y # .:-@p=@0.SnJ@g6 nJhzg*B. nJgHn y?( y?( y?( y/Nl=@g y/NXO0.` y hf,HnHnN.PO y?(HnHnNL n h~g n?(~NTO y #` n?(zHnN\O nP-H nJh6fHnNXOJng nJhzg n?(NrTO` nJh6f&N nJhgJy4gJy4 gNB@N^NuNV# yJg\Hn y?( y?( y?( y/Nl/.HnNPOJ@gHn/.N.POp`B@N^NuNVHn?.N\O=@g0.`Hn/.N PO/< HnHnNtZ Hn/.N@POHn0.@ ?N\O=@fHn/.N PO/< HnHnNtZ Hn/.N@POB@N^NuNV?.HnN\\O/. HnHnN N^NuNV# y # .:-@p=@0.SnJ@g4 nJhzg( nJg n h~gHnJn g n?(~` n0(~@ ?N\O=@g0.`Hn/.N PO n?(| n?(zHnHnN HnHnN.PO n?(zHnHnNL /<;l/.N@PO` n?(zHnN\O y #` n?(zHnN\OHnNXO n?(NrTO nP-H`NB@N^NuNV?./. N\O/.N>XO=@0.HЮ-@0.HЮ -@p.?/.N.\O-@gJ .=@ n-H n-H0.n0.n?././.Nn p=@SS0.SnJ@gZ0.SnJ@gN nH?NQTOJ@gSnfp=@ nSp,Sn`p=@ nS"nS`N^NuNV n?N TO n0 n?(N TO n1@ n?(N TO n1@ n?(N TO n1@ n?(N TO n1@ n?(N TO n1@ n?(N TO n1@ n?(N TO n1@ n?(N TO n1@ n?(N TO n1@ n?(6N TO n1@6 n?(8N TO n1@8 .:-@p=@0.SnJ@gV n?(zN TO n1@z n?(|N TO n1@| n?(~N TO n1@~ nP-H`N^NuNVNsPBnJy3g0NHJ@g&Nz=@0. |2<`XHXW PNJy3gJyRfJng"BgN3TON @GgRBgN4rTON=@fB@`8 ng nf0.` 34Z y4Zg y4Zg y4Zg y4Zg yG4Zf 094Z`?</<2j/<1|Nn /<3`/<N.PO3zJ94gF?</<1|/<4Nn N=@?</<1|/<2jNn JngJy3gJ93gN:=@g34ZNN?94ZNrTOp=@p33`pGN^NuNV/JyRgPO ngl ngbp6=@`XHnHnNq>PO nT=P0.SnJ@g. nT=P nT0nf 0.ngJfp3Hp#`"ByHB` yHf`HnHnNq>PO nT=P0.SnJ@g nT0ngT`Ns(`Ns6`p3T`HnNMXO=@HnHnNhPO`~HnNXOH-@`hHnNDXO`HnNXOn=@`@Hn` n fp`B@3 `"Jnf/<4N]B`0. |2<`XHXW`-|@`-|8`-|<`-np?HnHnNE `Bg`N%`@-yV#4VNi"=@#V`vJf Ni"`p34 #Ni=@By4 `>Nj`Nk`Nk`Nl`Nm$`NlN`HnNXO-@?.N$TO=@f -n` nfBn`Jf-yV`/<n/<J/<No `2/<$/<$`/<No`/<n/<h/<`/<n/<`/<n/<`/<n`/<n`B91|0<`$0<`p?NTO yBh y1yR` yJhgp#` yJhgJyRgB@3R` yJhf y3RN\`p ?NTO yp1@ y1yR693H?9FNOTO y!@ y1y `@Bg?.ND.XO`.p?`NCZ`p?NTO yp1@ y1yR yBhByR` y hgp%`ByR yJhg yJhfJy4f4-|1|p&?/.N\O-@g/.Nt4XOJ@gR`HnNXO=@f^Jngb yp1@p`~ y hf`ByR yJhg, yJhf` y hf,`LHnNXO=@g N\`HnHnNq>PO ng N\p6`3R`p+?/</<N*`NiB`.HnNXO=@`xHnNXO`"HnNXO=@`T=n=n`D/.N]n`Jnf/.N^,` nf n PHhdN~F` ng2/.Nr8`N`?.NTO`vN2`lNp`N`X?9?9NzXON`?././.NN `~Hn/.NNPO`l?.?.NV`*?.?./.N)`?.?.N+`N`,p7`?.?.?././. n?(N&N^NuNV n Pp0-@ nT  n .WN^NuNV n-P nT n0N^NuNV 9/0.H # ndNP/<$NZXO y0N^NuNV y 9/0Hї #N^NuNV nf n/ n /NPO`^ n/NXO=@f8-yV#4VByH n//94NPO=@#V/<4N_FXO0.N^NuNV n fpP`/. /.N$PO/.N$XO=@g0.`XBn/.N#XO=@f.N=@/. NrXO=@f/.N" XO=@g ng nIf0.N^NuNVHnHn/<%/. N @fp`\/<%HnNPOJ@gpX`@HnHn/<%/. N @g/<%HnNPOJ@f n-P"n iX=PBn ng( ng HnHnHn/. N&=@` ng/.Ne\XO n (XT-@HnHnHn/. N&=@fxBn0.nlP?.?.Hn/.N J@f HnHnHn/. N&=@f n-HRn`/.NrXO=@g0.`B@N^NuNVHnHn/<%/.N @fp`d nf/.?<HnN /.?<HnN nBPA-H nH=@R .-@ nHngR` nB/./. N.PO/. N>XO n0B@`Hn/<%/.N nf/<%HnNPOJ@g&p`Jnf .Vf" np0 n p/. HnNUBPO`/<%HnNPOJ@f np0 n p`b/<%HnNPOJ@f np0 n B`8N^NuNV n/NXO=@fpJn g n f?. /.NH\O`TByF/<%/<N*PO-@3FJfp`$/./.NPO=@/.NXO0.N^NuNV/<NO.XO=@lp`d?< NTO-@f?.NOFTOp`B n-P?. /.?./.N =@?.NOFTO/.NXO0.N^NuNV"n iX=PBnBn?. NGXO=@g 0.HЮ`BN^NuNV n-P/.NJXOBnBJn f.Bg/<NC\\O=@JngPp?B?.NFPO`?/.N\O/.N#XO=@fR0. @b6H0@ PN`&?.NTO`/.N` /.N0XO/.N" XO=@g n f/<%/<%/.N Jn f?.NE TO` /.NXO ng nIfB@`0.N^NuNVB.Hnp?Bg/<&/.NBn#B yJg RnX`Hn?.Bg/<&/.NHn?. Bg/<&/.NBn#B yJg4Rn y-P/.Bg?./<&/.NX`HnBgBg/<&/.NN^NuNV/<&+/<&"/.N #B yJg0 y-P nB@( @b H0@ PN`Hn/.NPOHnND$XOp"?Hnp"?/<&/` n?( n/(HnN* Hn/<&;/.N `BnHn/.N`POJnf <&C` <&I-@/.?./<&N/.N`@Hn/.NPO?.HnNxb\Op"?Hnp"?/<&W/.NX`N^NuNVp"?/.p"??.?./. /<&c/.NN^NuNVJBfZ#B n (XT-@"n iX=PBn0.nl . y XRn` yBN^NuNV#B yJg` y-PHn/.NPO nB@( @bH0@ PN`HnHnHn/.NJ=@g/.NXO?.NTO?.?./.?.NJ /.NXO`HnND$XOp"?Hnp"?/<&tHnND`Rp"?Hnp"?/<&{`Hn/<&HnND `$p"?.H?p"?/<&HnNDHn?.NAb\OX yJg/<&?.NAb\O`/<&`N^NuNV#B yJg: y-PHn/.NPOHn/<&/.N X`/.p ?N \ON^NuNVN?94nNTO#f/<&NZXONA3FN-|z .@-@ .##JNbNNBNNNNVNNN8Bg?9z/<nBgp?N\ N^NuNVN?9FNOFTON@3z34j4fNCBg?984NJXON/.N*XO/<&N*XON0BgNTON^NuNVp?/<&N\O=@m.Hn?.N$\OHnNXO @f?.NTON^NuNVBnp?/. ?.NPOJ@n n  n B(``Jng0 n  f n B(`F n Bp?p/?.NJPO`* n  f n B` n  fp=@R `xN^NuNVp=?/.N.\O-@g .S-@ n  g n  fS`Bn n  g n  gRn ngS` n  g n  fR?./.HnN* HnNC XO .R-@ n  g n  fR`A-H n  g& n  g nR"n nJgR`HnHnNPO?</.N.\OJfB@`0<N^NuNV-|% nJ g@/./.NPOJ@f/. NXO=@ n h 0` n-H`N^NuNVNXHnHnNq>PO nfp?/<&/<n/<JHnNzHnHnN|PO @fBnBnBg?9zHn?.?.N\ nHnNXOJ@o@0.@ymBnRn0.ymBnp?NTON @f NB@`8NXNN`nNs(HnHnNpPO=@g00.N^NuNV/<NVXO=@g0.`/<N XO=@gJygB@N^NuNV/<NVXO=@g0.`2/<NVXO=@f/</<NPOJ@gp0`B@N^NuNV/<&NZXON^NuNV0.@d @Yb*H0@ PNp`/.N_XO`/.N֜`?./. /.N `?./.N\O`?./.N/`0. @bH0@`?.?./.N0.H//.N`?.Nޖ`/.N_F`N`/.Nr`?.?.?./.N`?.?./.N&`4/.NM`?./.N`Nh`/.NZ`Nz>`?.N `6?.N`(N(``/.N`FN`HNR"`>?./.NO`Z/.NP` y?( y//.Ni`?.NETO=@g0.`Ry8N2=@NTSy8`Jf-|D?.?./.NL`/<&NZXO?.?.N p`v?.N `2?.N `$N`\?.N` ?.N`NB`6?.?.N4`N``?.?./.Ne`p/.Nh`Jf-|D?.?./.N*`>JnfNHT` ng nf?.NW`bJf-|D?./.NH`Jf-|D?./.NJ`?.Nm`/</<4&N.PO34Rp34$B@`,By4$`NF`pG`/.NLP`/.Nk>`N`34`NH`p33`Jng y hfBn`p=@?././. Nl>`/./. NmT`?9?9?9?9NPO`4?.NT`/<dN>XO`/<dNF`/.N`NU`33`N`Jnf?./.NoZ`/.Np`?.N!:`?.N`p?N<`vBg`N`/.Ns,`?.?./.Nw`?./.N&`/.Ntd`ZN= `\Nr`TNE^`LNP`?./.N ``?./.N`N?.N[`?.N,,`pJN^NuNV-|D"n Q-hX n=P .T-@-yN0.SnJ@gN n(Hy8f nB( nHy8f/./.NPO` n-HT`N^NuNV n f/.N XO`l?<NTO-@fp`V?<NTO-@f/.NXO`/././.Nn =@/.NXO/.NXO0.N^NuNV-n .-@ .-@-n .-@ .-@/.HnNPO=@g0.`ND=@f/.HnNPO=@fND=@fHnN(XO=@fNr-@HnNpXO=y4By4Nj=@34/.NpXOJnfpND=@fb/.HnNPO=@fJN!=@fH0@^ PN`.BnJgRnJgRnJngRn` p`p=@/.?.HnHn/</.N,=@fB@`/./.?.0.H @?(?. /.Nb?.NTOp?HnHn?.Hn?./.?./.NƶBnBn?.?.Hn?././.N̠ n fHn0.HЮ/NPO=@34\JngJ.Jg0.H @/( HnJNAPOJ@gfp?HnHn?.Hn?./.?./.NƶBn?.?.Hn?././.N̠`Nz=@34\0. |2< `XHXW PN`?9z?./.N@POJnoSn`/.N#XO=@g ng0.` 09HS@=@Bg?.?9z09y?0.yH??9?9HN 09R@H=@0.R@nnRnBgHnN˄\OHnHn/.N ~ 0. @!n0. @091@0. @091@`Jn gZJn g n g0.R@nlRn`0. @Jg4Rn0.H @1n/.?.HnHn/</.N,=@?.N TO/./.?.0.H @?(?. /.Nb?.NTO09R@H=@0.R@nop?HnN˄\OSn`0. @/(/.NPO=@fBgHnHn?.Hn?./.?./.Nƶ?.?.Hn?././.N̠Bn` n fzJngp=@ n g Jn g^ n gTJnoSn`FJng|Sn0.H @=h/.?.HnHn/</.N,=@?.N TO/./.?.0.H @?(?. /.Nb?.NTO09R@H=@0.R@nop?HnN˄\OSn`0. @/(/.NPO=@fBgHnHn?.Hn?./.?./.Nƶ?.?.Hn?././.N̠ n g0.S@=@`Bn?9z?./.N@PO0.R@nlRn`0.R@ @ fz/.N" XO=@g nf`vHnHn/.N ~ 0.R@ @!n0.R@ @091@0.R@ @091@0.S@=@p??.?9z09y?0.yH??9?9HN p?HnN˄\O`0.S@ @/(/.NPO=@f0.S@ @0(H#0.S@ @0(H# /.N" XO=@fNp?HnHn?.Hn?./.?./.NƶBn`/./.NPO=@fH0.H#0.H# 09H=@Bn0.SnJ@gd/.N#XO=@g ngJ`BgHnN˄\OHnHn/.N ~ -n09=@09=@p=@`Jng\Bg` n gnJn g0. |j2<`XHXW`(/.NXO`/.NXO` yHg?./.Nl\O?.N TO/./.?.0.H @?(?. /.Nb?.NTO`V n g`N^NuNV-nBnJn"g@p=@0.SnJ@g( np n1n0.n n -H`-nHn/.NXPOJnfNXBn n f*/.N#XO=@gP n\g0.`p=@`8 n//.NPO=@f n0(H# n0(H# Hn/./.N ~ 09H=@BnBn0.SnJ@g Jngp-@`HnHn/.N ~ n n1n09 n1@09 n1@ n -HRn?.?9z?.?.?./.?. /.ǸJnfv0.n n f&/.N" XO=@g8 n\fFp=@`& n//.NPO=@f n0(H# n0(H# ` n0B@N^NuNV0.yH0.yN^NuNV0.yH0.yN^NuNV nJg&"n n n p1@ n -H X` n BN^NuNVBn0. @b8H0@ PN`&Jg"?.?./.?./.NʰRnJg"?.?./.?./.NʰRnJng?<?<?<09R@??.Bg?.N`Bgp?/<&Bg?.N\ Rn?<?<?<09R@??.Bg?.NRn?.?./.N$PORn`jBgp?/<'>Bg?.N\ Rn?.?./.N$PON^NuNVJgfBg?. NzXO0.SnJ@gL0.RnH @-Pg&Bg?9z/. nB@(??. N\ n -H`N^NuNVBg?. NzXO0.SnJ@g> n-h Bg?9z/. nB@(??. N\ n -H`N^NuNVJn gp=@Bn0.SnJ@g0. @0.R@ "@ 0. @0.R@ "@1i0. @0.R@ "@1iRn`p=@p=@0.SnJ@gn0. @0.S@ "@ 0. @0.S@ "@1i0. @0.S@ "@1iSn`N^NuNV0. @-P0. @=h0. @0(H#0. @0(H# /./.NPO=@g n\g0.`Zp=@`HnHn/.N ~ Bn?.?9z?.?.?./.?./. Ǹ/.N XON^NuNV nB@(@=@?.?. /.N>PO?.?. /.NPOJng"Bg?9z/<'k?.?.N\ `VJnf/.p?Bg?.N n*f Bg?9z/<'?.?.N\ ?. /.N\ON^NuNV?.?. /.N>PO?. /.N\ON^NuNV=y=yp-@?. N TOBgBgNzXOBgp?NzXOBgp?/<'BgBgN\ p?p?Bgp?p?/<'/<'Nv=@0.S@ @bH0@ PN`/.NPO nf B9B@`Ns(/<NoXO=@g0.N^NuNVJ9g/<( /<N*POH-@fNP/<( NFXO`d/<("NFXO nJg/. nRH?N \O`/.p ?N \O/.p ?N \O/.NXONvN^NuNV y-h6 y ./0(4H -@ nVf .g8 yHhHnN.POp?HnND\O=@ @fp` NmzBg/<NC\\O=@ @f?.NE TO`Jgv o=|`0.=@0.H?.Hn?.NGPO=@o?.Hn?.NHPOng?.NE TO?.NE TOp`` nTg nUfb/<1|N>XO=@0.T@33?./<1|?.NHPOnfp @p @p?Hn?.NHPO @frp?B?.NFPO-@ nTg nVfBg/.?.NFPO?<Hn?.NGPO=@o?.Hn?.NHPOng`?.NE TO?.NE TOHnN XOHn/<NPO/<N XO y!n6 y1y34 yJh:f ySh:NvB@N^NuNV n-P n-hXNXN Df -|(9`: @f -|(@`& 8f -|(I` <f-|(Q/.p ?p?p?N /<(Yp?p?p?N n=PHn?.N*\OHnp?p'?p?N Jng0Jn g?./.Nj\O`p?NTO/.N`XOB@N^NuNVhAl-HhBnB@ nh0=@ .T-@-@ n=P0.ngJBn nh00.ng./.NRXOn0.yl n-HRn`Th` nhp0Al-Hhp??.Hn nh?/.NN=@N0. |2<`XHXW PN`B@`0.nlTh` nhJPgUh`N^NuNVp?NTO=y3 .T-@ n=PBnBn3 4gBy3`NXp330.Rnngp?p?/.BgBgBgBgBgBgBgp ?BgBgHnN0 p?HnN\Op??9zp ?N\OHn?./.HnN nJ( g 09z@p?HnN\ON n-HNJ@g@By3By433NN^NuNV n-P/.NXO=@g0.` n-hX/.Ne\XOp=@Hn/.N hPOJ9gp=@`Bnp?NTONJng2/<N ZXO=@fBgBgN pXO=@fz=y4\` .R/NXO/.NXO=@Jnf/.NXO=@f60.W@ @bDH0@ PN`pNPJnf/<(jNFXOJng/.NrXO=@fp=@Hn/.N hPO`"Jng/.NrXO=@fp=@Hn/.N hPO/.Ne\XO`Jng/.NrXO=@fnHnHn/.N ~ Bn .Sfp?NTO` .S//.NPO=@f U`r/.NXONB@`&Jng/.NrXO=@g`NP`6N^NuNV n-P/.NXO=@fJ g/. /.NPO=@f n-hXJ9gp=@`Bnp?NTONHnHn/.N ~ Jng,/<N ZXO=@f6BgBgN pXO=@g@` /.NXO n*f/<(xN6XO`N/.NXO34\094\Y@ @bH0@D PN`\/.NXO`L/.N`/.N>XO=@g,?.NTO/.NB`/.NBXO=@g?.NTO/.N>`/.NXO=@N`4/.NXONB@`"NP`/.N XO=@gl0.N^NuNV nf N `Jng Nۮ`NX/9VN_FXO/</9VN_PO=@g0.`N/<(NFXOBgNTO"yV Q-hX np0Bg/.N\O=@g NrB@`: yV/N`XO=@gNr`/9VN_FXO/9VN]BXON^NuNV/9VN_FXO-|4/.N]BXO=@g0.`B/</9VN_PO=@f n-P yV-P"yV Q-hX"n Q-hX .T-@ nBPByHBn/.N#XO=@fz n Pdn .T-@HnHnHn ./NHnND$XOHnNC XO?.Hn/.N* HnHnHn ./N.H?NRTO=@?./<(N.\OJg?.NvTO n@ HnHnHn ./NHnHnNTPO n1n 0.n0. @n\HnHnHn/.NHnHnNTPO0. n@ nRP n-H/.N" XO=@g/.N_FXO/.N`XO=@/9VN_FXOJnf/</<N.PO/9VN]BXON^NuNV n-P n-hXJn g?./.N\O`p?NTO/.NXOB@N^NuNV/9VN_FXO/<N XON^NuNVl nf N` nf N` nf/<N¨` nf/<N`NXNmz-|4n/</.nN_PO=@g0.`Z yV P?(6 nn P/(X yV P/(XNn /.n/9VNePOBgNTOBg yV P/(XN\O=@g2/.n/9VNePO/.nN_FXO/<N XOB@`/.n/9VNePO nn/N`XO=@g/.nN_FXO/<N XO` yV-Pv nn-Pr nvHhPNkXO/.r/.vN~PO=@f/.nN_FXO yV/HnN.PO/9VN_FXOHn/<NPO=@f/<N XOHnHnNPOHnN>XO?Hn/<(/<(HnNzHnN XOHnz/<NPOHnzN>XO?Hnz/<(/<(HnzNzp?HnzND\O=@l @g0?.lNE TOHnHnzNPO=@fHnzN XOHn/<N.PO/9VN]BXON^NuNV/. /.N$POBnByH/.NXO?/.HnN* n?( HnNp\O n?( BgHn/.N .-@ nB@( ?N@TO@B. n?( BgHn/.N .:-@ n?( HnNR\O n?( p?Hn/.N .V-@ nB@(?HnNR\O n?( p?Hn/.N n /NrXO=@fpRn`B@N^NuNVBn n-hX .T-@/<)^/.N.PO nB( np 1@ nB(Rn n-H/<)i/.N.PO nB( np1@ nB(Rn n-H/<)t/.N.PO np@ np1@ nB(Rn n-H/<)~/.N.PO np@ np1@ nB(Rn n0/.N`XON^NuNV-y0Jfp+`v yV-P nfp `^/./.NPO/<4/9VN`PO=@f0-y4/././.N =@/<4N_FXO0.N^NuNVBnJnf/. NXO n-HRn yJ/(NpXO/< y?( y?( y?(N =@g0.` y # yJ #J` yB yJB#FJ yJJgB yJ/(NpXOHnHnNq>PO yJ!y yJ #J` n-P=y3By3/.N#XO=@f##FJ yJg yJ-hHn/.N PO y/NpXOHnNMXOHnHnHnNtZ Hn/.N@PO y # yJ #J`t/.N" XO=@gL33 nfzJyfFNX#FJ yJJg*N yJ/(NHXO yJ #J`B@N^NuNVJyf0/<)NFXON?NRTO=@ @Ng@ nYf n-P/.N XO=@g0.` nJPg/.NhXO`B@N^NuNV-|4/</<NPOJ@ff/<)p.?/<N.\O/N.PONhN/<HnN.PO/</<N.POHn/<N.PO/</.N_PO=@fzp?/<ND\O=@ @f/.N_FXO/<N XOp`D/.?.N\O=@/.N_FXO?.NE TOJng/<N XO0.N^NuNV/p ?Hn?.NGPOJ@np `BgB?.NFPO fp ` .g .gB@. @gpV` .f4?< NTO-@fp`/. nHh /.?.N`fA-H n?( N TO6 n?(N TOC?NTO-@g/. n?(N TOHЮ//.?.N=@/.NXO0.&N^NuNV?< /. ?.NGPOJ@np ` n gpV` n BA( n B@(HAH@B@H@-@ n ?(N TO=@ n-P n-hX .T-@ . P-@Bn n  gpp ?/./.N* nB@( ?NvTO n@ nB@( n1@ "n niRn n-H n-H` n0 n/N`XO=@g0.` .SJg?./.?.NGPOJ@o .T-@ . P-@-n nRH=@ n=P0.SnJ@g\ nB@( ?/.HnN* Hn/.NPO nB@( n-H n-H n-H`/.NrXO=@f$ n*f"/.NXO/.NXO`B@N^NuNVp ?/. ?.NGPOJ@np `BgB?.NFPO fp ` n ?(N TO=@ n ?( N TO=@?./. ?.NGPOJ@o n /(NBXO-@ o-| n-P n-hX .T-@ .  -@Bn n  g nl~ n (M gbp ?/./.N* n( H?NvTO n@ nB@( n1@ "n ni n-HRn n -H`p n0 n/N`XO=@g0.`b .SJgR?./.?.NGPOJ@ol .T-@ .  -@-n nRH=@ n=P0.SnJ@g n (M g n (D f@ nB@(?/.HnN* HnHnNxPO?./.NL\O`. nB@(?/.HnN* Hn/.NPO n-H nB@( n-H n -H`R n BB@`@/.N(XO=@f*ND=@f/. N(XO=@f N!=@g0.N^NuNV-|4/</.N_PO=@g0.`" n/N XO=@f/<4N_FXON^NuNVJng?< NTO-@fp`/./.?.?.N$ nB nJg0. @b"H0@t PN`p` p `p `p=@0. nV@?0. nR@??. ?. NPO?<?<?<?<?<?<0. nV@?0. nR@??. ?. N6/.?.?.0. yT@?0. yHR@?/.N/.NXOB@N^NuNV0.H -@-n nB n-Pg| n-hX n=P .T-@0.SnJ@gT nB@( ?N@TO=@?./. N.\OJg/.?. /.N -@ n-H`N^NuNV/./.N.PO/.ND$XO/.N>XO n-H n g nRp, nB@( ?N@TO nR n gh nRp,/. n?( N*\O/.N>XO=@ n-H n g$ nRp, nB@(@0 nR nRp; nB .N^NuNV-n/./.N>XOHЮ/N>PO-@=n?.?././.?.?. N-| .T-@pp?/.N@\O n0S@=@Nz=@34\0. |2<`XHXW PN`Hn n/(N|PO?. n/(/.N* ` nB` n hglp?/.N@\O?.?.?.?. /./.N``2 n hg&p?/.N@\O?.?.?.?. /./.N:`0.H @ hgp?/.N@\O/.0.H @/(NPO-@?.?././.?.?. N`z n hgtp?/.N@\O n-h0.SnJ@g/./.N>PO-@`?.?././.?.?. N .T-@=n` y4\n`nN^NuNVHn n/(N|PO?. ?. n/( n?( n?N~ N^NuNV?9z0.n S@?0.nS@??. ?.Nn -| nBP .T-@Bn0.SnJ@gH n!n  n0 n1n Rn n g/./. NPO-@ PRn` n0 .T-@0.SnJ@gp?/.N@\OP`N^NuNV-| .T-@ nAe Q .`Bgp??9z0.nS@?0.nS@??.?.N  n=P0.nfSn` nRP0.HЮT-@0.SnJ@g"n n!iQ`/. n/(N>PO n!@ .N^NuNV-| n0S@=@0.HЮT-@ nAb P .`p?p??9z0.nS@?0.nS@??.?.N  .T-@0.SnJ@g"n n!i P`/. n/(NPO n!@ .N^NuNV n f . `" n ;f .R` n gR`N^NuNV n f . `&U n ;f .R` n gS`N^NuNV n BP nJg n ;g n RPR`N^NuNV/.NXO=@ @fpE`0.N^NuNVHnNXO=@g0.`rHnHnNq>PO nfJJng nfPO nfB nf:HnNXO=@fp0.-@p0././.NPOB@`pN^NuNV/.NXO=@ @npM`0.N^NuNVHnNXO=@g0.``HnHnNq>PO nf8 nf0HnNXO=@g nnpM=@`0.n=@`Ns( n0B@N^NuNVHnNXO=@g0.`^HnHnNq>PO nf6Jnf0HnNXO=@g nnpM=@`0.n=@`Ns( n0B@N^NuNV yV-Pp3@HnHnNq>POBy@0. @b&H0@` nf/.NXO=@g0.` nJPgB@ n0`JngpO`xHnHnNrPO0. @bH0@`Ns(/.N!XO`8Ns(/.N!`/./.N`PO`Ns(/.N"`p`0. @bHH0@`6-yJ/.NXO=@f NC` nn/.NpXO/.N!XO=@g nf/.NpXO`H n0`j nfHnNH&XO=@fHnND$XOHnN>XO?Hn/<n/<JHn$Nzp?Hn$ND\O=@ @g?.NE TO np`^ nBP`Ns(Jy3gJnf`0. @bH0@B PNNs(p`NC=@fHnN(XO=@fND=@fHnN(XO=@fB.NCJ@g0ND=@fHnN(XO=@fNC=@fz n0` ND=@g`\NCJ@f"Ns(HnNExXO=@f8 n-P np0Jg0. |2<`XHXW PN` nJhFfp`"n n0F`|"n n0D`lHnNExXO=@f n-PHnHn/.N ~ n*` n04ND` NC=@frHnNMXO=@f^ND=@fPHnNMXO=@fHnNDXO=@f*NC=@fJnf"`"/.N%`fNC=@fHnNXO=@fND=@fHnNXO=@fND=@f/.NXO=@fNC=@fJng$ n0`NHJ@gp`B@ n0`B@N^NuNV/< NMXO=@g0.`dHnHnNq>PO nf nf nf Ns(p`2HnNMXO=@f?.Hn/< N$ n0B@N^NuNV/< N)XO=@g0.`2HnHnNq>PO n f nfp3@HnHnNq>POBy@Jnf6HnHnNrPO nf/./< NPO n0B@`Ns(HnN(XO=@fb/< HnNAPOJ@gp`B@` nf. nOf&HnN(XO=@f /< HnN&` nf4HnN(XO=@f?.?.Hn/< N$| `LNs(pN^NuNVNr-@/.N!XO=@g ng0.`/.NpXOHnNXO=@f/< ?.N\OHnHnNq>PO nf nf nf Ns(p`HnNXO=@f nBP0. @b^H0@ PN`N0.ncD`:0.nd8`.0.nf,`"0.ng `0.ne` 0.nb np0B@N^NuNV/. /.NR`PO=@0. @bBH0@ PN`2Jno*p`(Jnl `Jnf`Jng`Jnm`JnoB@N^NuNVJy3f\ ng nfL/.N>XO=@g:/. N>XO=@g(0.no?.`?./. /.N `/. /.NPO=@0. @bBH0@ PN`2Jno*p`(Jnl `Jnf`Jng`Jnm`JnoB@N^NuNVNC=@g0.`HnNXO=@fND=@fHnNXO=@f?.HnHnHnNz?.HnHnHnNz0.nf0.nf np0` nBPNCN^NuNVNC=@g0.`rHnNXO=@fND=@fHnNXO=@fNC=@f2.A0.@Afp`B@ n0B@N^NuNV/. /.N&POJ@fp`B@N^NuNV nH |"2<`XHXW PN` n JgdB@`b n JgRR `R nJgBHn HnN'POJ@f`/. HnN'8POJ@f` n H nHAf`pN^NuNV"n Q -g nR` n-P"n Q ]g nR` n(H n HAnS nH n HAmp`&S n [g n H nHAf`B@N^NuNV n-P n -PHn/.N(DPO-@/.N>XOnlB@`:?././.N( J@fR`0.HЮ n n pN^NuNV n BP nJg n *f .`& n [f n ]gR` n RPR`N^NuNV0.SnJ@g2 nH @?g @[g" n H nHAf"RR `p`/. HnN'8POJ@fB@N^NuNV/.N)XO=@ @fpL`0.N^NuNVByHnN*8XO=@g0.`HnHnNq>PO nfJng nf=y nfHnND$XOHnN>XO=@ByHnN*8XO=@g nfpL=@`z09n @m.0<n?Hn NHhN* 3`DHn NHhN.PO0.y` Ns(Hn/.N.POB@N^NuNVp3@HnHnHnHnNrBy@0. @ bH0@( PNNs(p`B nm=|3?././.N. `JngpO`HnHnNrPOJnf n3 /./.NPO` nfz/.N)XO=@g0.`NC`JnfNHnNyLXO?./.Nxb\O/.N>XO3ND`b0. @9b H0@@`/<3/.N.PO`/.NH&XO=@fn/.NC XO`/.NH&XO=@fJ/.NI`/.NH&XO=@f* nfXOJ@f np  nB(`/.NDdXO`tNC=@fHnNMXO=@fp =@NDJ@fHnNDXO=@f nmBnNDJ@fHnNDXO=@fdJnm3?.?./.HnN `>NC=@f(HnN(XO=@f=yHnN>XO=@ND=@fHnNDXO=@fNDJ@fHnNDXO=@fJnf=nJnl0.F@R@=@0.ʐn=@BnJngSn0.̰nl 0.̰nm nBBn`60.nʰno 0.n=@?. NHh/.N* 3`*NC=@fHnHnNq>PO n gp6`p=@ n+fBn n,fp=@ n-fp=@ n/fp=@ n.fp=@ nfp=@ nfp=@ ng0.J//.N.PO/.N>XO3`^NC=@fH=y4XNC=@g"HnNDXO=@f NC=@f0.̰ym=ySnnBn0.H-@/. n/( NuPO`hHnNH&XO=@fHnNC XOHnNXO-@Jg/./.N.` nB`HnNHXXO=@ffHnHnNTPO0. n nB(p`NC=@f0HnNDXO=@f no=|3?./.N\O0nB`NC=@f nfHnNDXO=@g"`HnN(XO=@f.H=@ND=@fHnNDXO=@f| no=|3?.?./.NPO0n`ZNC=@fHnN(XO=@f*ND=@fHnNDXO=@fJnnHnN>XO=@ no=|HnNDdXOHnN>XO=@ nB0.̰no2?.0.̐n?/.NPOHn0.̐nHЮ/`0.n0@Hh`NC=@fdHnN(XO=@fPND=@fB/.N(XO=@f.ND=@f HnNDXO=@f Jno SnnBn/.N>XO=@g|0.̰nlpHnN>XO=@0.nno 0.n=@?.0.HЮ/HnNn `$/.NIRXO=@fz` nf <` <-@?</./.N* `xNC=@f4HnN(XO=@f Nr-@HnNpXO n f HnNi` HnNkXO?.N@TO n nB(HnHnNq>PO ng npUp3/.NpXO`HnNExXO=@f nB n-Pg /.`HnHnNHPO=@fR nB n-Pg Jnfp=@ n-hPSngJg n-h`Jg /.`tHnNH&XO=@f nfHn/.N|`Hn/.N}`/.NJLXO` dNC=@f/.N(XO=@f nH=@ND=@fvHnN(XO=@fbND=@fTHnNDXO=@f@Jnfp=@A-HSng,?./.N.\O-@fA-H nB`R`-n nJg" nHng nR"nR` nB`VNC=@f/.N(XO=@f nH=@ND=@f/.N(XO=@fp nH=@ND=@fVHnN(XO=@fBND=@f4HnNDXO=@f Jnnp=@ nmp=@A-HBnB@=@=@ nHng nJg RnR` nJf n(HngA-HBn`RRn nHng nJg RnR` nJf n(HngBn`RnHnN>XOnn=@ nB nf Jno0.S@?Hn/.N* nf&Jno 0.S@? NHh/.N* nfx?.0.n0@Hh/.N*`,NC=@fHnNMXO=@fNCJ@gvND=@fHnN(XO=@frND=@fdHnN>XOHЎ9-@/.N(XO=@f6NC=@f(/.Hn` /<)/<)Hn/.N8`NC=@f/<3/.N.PONCJ@gnHnN(XO=@fNC=@fHnN>XO?Hn/<n/</<3Nz`NC=@fn nB0. @g @g`/<4/.N.PONCJ@gHnN(XO=@f$NC=@f0. @g @g`p?Hn/<4N*`pJ=@-| nXVgRn`0. n nB(p`NC=@fHnNXO=@f?.NTO n nB(p` NC=@f\/.N(XO=@fHND=@f:HnNDXO=@f&ND=@fHnNDXO=@f/.N>XO30.̰ynJng-n0n0.(`/<`*/<2j` NC=@fHnN(XO=@fND=@f~HnNDXO=@fjJno noBy n`bHnND$XOHnNDdXO nf?./.HnN<`?./.HnN 3`NC=@fHnN(XO=@fND=@fHnNDXO=@fNC=@fJnoHnN>XO=@0.̰no=n0.ʐn0@Hh`ND=@f\`NC=@fJHnNXO=@f6NC=@f(?.HnHnHnNz0.S@H @8/`hNC=@fp?HnHnNE =@fND=@fHnNDXO=@fND=@fHnNDXO=@fND=@fxHnNDXO=@fdp=@/<)HnN.PONC=@g^ND=@f2HnNDXO=@fNC=@g0ND=@fHnN(XO=@fNC=@f/.Hn?.?.?.?.?.N `:NC=@f/.N(XO=@fND=@fHnNDXO=@fxND=@fjHnNDXO=@fVND=@fHHnN(XO=@f4NC=@f&SnlBn/.N>XOn=@oHnN>XO=@0.HЮ-@JnoD0.R@?0.HЮ//.Nn ?./.HnNn n-HJno20.nn n`0.HЮ/N>XOR@?/.0.HЮ/Nn`NC=@fBHnN(XO=@f.ND=@f HnNDXO=@f NC=@fJnotHnN>XO=@0.̰no=n?.Hn/.`=yN=@3 nB`NC=@fHnNMXO=@fND=@frHnNDXO=@f^NC=@fP/.?.`NC=@f6HnN(XO=@f"ND=@fAE-H/.N(XO=@fNC=@fp@ nHnp?HnNg /.p?/.Ng p@ n8f/.HnHnNtZ`/.HnHnNu /.p?HnNK /.N>XO3B@N^NuNV-n/. N>XO=@ nJg,?./. /.N J@f .R@`R`B@N^NuNV y/NpXO y0( @bH0@\ PN`/./. /. y/N`/.N)XO/.N>XO n0 n BP`h/.NMXO"y n0 n p`6/.NXO n p`"HnNXO/.?.N\O n p0"y n0N^NuNV nJg nH?NRTO nR`N^NuNVBn0.n l" nH?NRTO nRRn`N^NuNV nH?/<)N.\OJgp`B@N^NuNVHnHnNq>PO nf nfB@`Ns6pN^NuNVHnHnNq>PO nf nfB@`Ns(pN^NuNVNC=@g0.`NCN^NuNV/.N>XOHЮ-@ ng n ( fS` nBN^NuNV-n nR  g nHh/.N.PON^NuNVHnHnNq>PO nf n,fB@`Ns(pQN^NuNVHnNMXO=@g0.`Hn/.NTPOB@N^NuNVHnNMXO=@g0.`0Hn/.NTPOHnNsXOJ@l n0D@ n0B@N^NuNVHnNMXO=@fHn/.NhPO0.N^NuNVNC=@g0.`< n VNCJ@fB@`$p?Hn/.NE J@gpP`NCN^NuNVHnHnHnHnNr nf$0.@ @bH0@ PNB@` nfJnf n p0 n  ` nfl nfb ng nfj n Ff` nf nH@A=@ nf n(H@J=@Jnm( n n n 00.H n `LJng/. /./.NG J@f`$ n  n BP` n  n p0` n  n p` n  n p` n  n p` n  n p` n $ n p` n ( n p` n , n p`| n 0 n p `hNs6p6N^NuNVBn n lV0.H -@ n-PJg, nHhd/.NPOJ@f n n0B@` XRn`pN^NuNVNC=@f/.N(XO=@fNC`0.N^NuNVNC=@f/.NMXO=@fNC`0.N^NuNVp?Hn/.NE J@gpP`B@N^NuNVNC=@g0.` n V n BPNCJ@gh/.NHXO=@g/. NDXO=@fNC`> n BPNCJ@g,ND=@f/. NDXO=@fNC=@fxB@N^NuNVNC=@g0.`rHnNXO=@fND=@f/.N(XO=@fND=@fHnN(XO=@fNC=@fJnfHn/.N.POB@N^NuNV nJg nH?NR:TO nR`N^NuNV0. \@H@=@ 0. H@B@H@ @88//.N.PON^NuNVNC=@g0.``p?HnHnNE J@fND=@g `-yVHnNDXO=@fp=@NC=@gJND=@fHnN(XO=@f.H?NRTO?NvTO=@NC=@f\ nB n-Pg n-hX .T-@ n=P0.SnJ@gr ng nBA( 0.AfJSnfD nB@(? n?( nB@( ?N@TO?/./<)/.ND` n-H`/.N>XO3B@N^NuNV nB@@g nB@@ n nRp-Jn f -|Q`$ n f -|` n fp<`p-@p@@/.HnNPO/.HnHnNu -|QHnHn/.NM -|HnHn/.NM p<-@HnHn/.NM HnHnNTPOJng&?.?.?.?./<)/.ND` ?.?.?./<)/.NDN^NuNV/. HnNhPO .谮l nBP`fp@@/.HnNPOHn/. HnNw Hn/. /. N HnHnNTPOHn/.NTPON^NuNV/.NMXO=@ @fpK`0.N^NuNVHnNNXO=@g0.`HnHnNq>PO nfJng nfrHnNNXO=@g nfpK=@`p@JnfHnHnHnNtZ`HnHnHnNu p@HnHnNtPO`h npHn/.NtPONs(B@N^NuNVHnNOXO=@g0.`6HnHnNq>PO nf ng ng ng nf`HnNOXO=@g nfpK=@`p@ nfRHnHnHnNu`p@HnHnNtPO`h npHn/.NtPONs(B@`x nf0HnHnHnNw 09by$l3$b` nfHnHnHnN `lHnHnHnN\ J@gPpaN^NuNV np=ybp3@HnHnHnHnNrBy@0.S@ @ b@H0@ `.0. @b&H0@`/.NOXO` /.NOXO=@g0.` nB@ @ n`/.NMXO=@fNC`/./.NtPO0.ذybo3b`JngpO`HnHnNrPO0. @g @g8`b nB@(ybc nB@(3b/./.N PO`2Ns(/.Nx`0. @bbH0@ PNNs(p`NC=@f?94Z/.NSf\ONCJ@g$/<4ZNDXO=@fNC=@f3b`HnNH&XO=@fHnN>XO=@?./.NSf\O`/.NHXXO=@f^-n nH@ n`BNC=@f4/.NMXO=@f ND=@fHnNDXO=@fNC=@f n0.(-n nH@f/<;|/./.NtZ`/<;|/./.Nu /./.NTPO n0.֑(3b0.ְybop3b`dN|`RN`HN`>N`4Nh`*BnNC=@f NC=@g"HnNDXO=@fNC=@fHn?.N6\O/./.NPO`HnNH&XO=@fHnN>XO?Hn/<n/<HnNz nMf HnN` HnN XO=@`fNC=@fX=y3?./.NSf\ONCJ@g*HnNDXO=@f NC=@f33` NC=@fHnNXO=@fNC=@fJngp`B@=@?./.NSf\O` HnNdPXO=@f`NC=@fHnNXO=@fzND=@flHnNXO=@fXNC=@fJ0.аnc=n=n=n0.\@H@R@=@0.Sn @gSn`0.ΐn=@?.`$NC=@fHnNXO=@fND=@f/.NMXO=@fND=@fHnNMXO=@f~NC=@fpJnf ^Hn/.NtPO` J?9z/.NSf\OND` 0N` &N` N=@f3b?94`DN&` N` NC=@fHnN(XO=@fND=@fHnN(XO=@fp=@NCJ@gXOS@=@Hn NHhNAPO=@g0.nn=@Rn`3b?.`NC=@fHnNDXO=@f| nm nopZ`^0.S@?NHn/.Na6`.Hn/.Nb`Hn/.Ncv`Hn/.NdPO=@Jngpa`/<;/.NtPOp3b`*/<;`NC=@fTHnNDXO=@f@Bn?.`HnNH&XO=@f HnHnNGVPO=@f/.`NC=@fHnNMXO=@fND=@fHnNMXO=@fNC=@fHnHn/.N `NC=@fHnN(XO=@frND=@fdHnNDXO=@fPNC=@fB/.?.HnNg 3b09$аybo 3$bB@N^NuNVNC=@g0.`NCJ@gp=@Bnp=@/.N(XO=@fND=@f/. N(XO=@fND=@fHnNDXO=@fND=@fHnNDXO=@fpNCJ@gND=@fVHnNDXO=@fBND=@f4HnNDXO=@f ND=@fHnNDXO=@fNC=@gHND=@f&Nk=@f yJ( gp8`xX`NC=@f yB n4f$?.?.?.?.?./. /.N`"?.?.?.?.?./. /.Nv34B@N^NuNVNC=@g0.`HnN(XO=@fND=@fHnN(XO=@fND=@fHnN(XO=@fNC=@fA-HA-HHn/./.Nf A-HA-HA-Hp=@ nH nHAf@Hn/./.Ng\ =@Jng 0.SnJ@g nR"nR` nJgJnf nB/.HnHnHnHnHnN>XO?Nf(J@g nJgxHnN>XO n-HA-HA-H nJg nRB`A-H nH nHAg nJg nR"nR`B@N^NuNV/ nBPBn n JPgv n 0.PfT&n/.N>XOnHЮ-@?./.HnN* Hn/.NPOJ@f nRPB@` n 0nT nRP` nBPp&_N^NuNVBn nH n HAg n Jg RnR ` n Jf nT0`JHn/. /.Ng\ =@Jnf nT0Bn`0.n n -H `| nBPN^NuNV nBP nJg$ nH n HAf nRPR R` nJfB@`pN^NuNVH-nBn n -f p=@RBB-@-@-@A-Hp:?/.N,\O-@g"&nX nHhNXO& nB`/.NXO n /<Q/.N PO(/</.N PO&pPOBy4 npU0 nfJnf/.HnNrPON^NuNVNk=@g0.`Hn/.NrPOJngpL`B@N^NuNVp3@HnHnNq>POBy@ nfJnfHn/9NrPOB@`Ns(p9N^NuNVNk=@fXNDJ@g yB0.N^NuNVNk=@g0.`/./9NPON^NuNVNk=@fXHnHnNq>PO nf n gp6`8Ni=@f(X y #NDJ@g yB0.N^NuNVp3@HnHnNq>POBy@ ngp:`4Jng nf-yJ n  fR` yJ!nB@N^NuNVBy3XNl=@f8Ry3X yJ #JNDJ@f y 3Xop:` yJB0.N^NuNV/<)/<No^PO/<N XON^NuNV nl0.J/NnXO`B/<JNnXOp=@ nl$/<J0.J/N.PORn`B@N^NuNV nBHnHnHnHnNr ng ngJy4g Jng(pR`-yJ n  g n  fR`-nBn n  g0 n ,g& nJg n  g n |g RnR` nop=@?././.N* nf np:@ nB(Rn`H no@ nl80.HЮ-@ n (\g n (:g nRp\ nB nJgB@N^NuNV/</.N.PO/. /.NPON^NuNV/<n/</.No N^NuNVHnHnNpPO=@g0.`?.Hn/./. /.NzN^NuNV/. /.NpPO=@f /.NC XO0.N^NuNVHnHnNq>PO-yJ n  g n  fR`-nBn n  g0 n ,g& nJg n  g n |g RnR`/.NpXOJnfp4`, n+mpC` ?././.N* n 0B@N^NuNV y JN^NuNV .##Jp34N^NuNVNB91|Nq(N^NuNV/<1|NpXON^NuNVJy4gd#J/</9Nf"PO# y<fRy<-| nRB@3 @bH0@D PN n0 n 0Dp34` nRB@3#` nB@3D` nRB@3#/</< /9N ` n0 nB@3D n 0By4N^NuNVHn/9JNf"PO-@ n J .J n 0N^NuNVJy4g 9` 9JN^NuNV/. /.Nq>PO n  n0N^NuNV-y n ( fHnNXOJ@g-y n nB@( n 0N^NuNVBy4N^NuNVp34#JN^NuNV-|1|By3-nHn".1|0<A?/.?9FNK -@gRy0.y3JyRgXJy4^gNNNJy4$g6J94&g.094Ryf /<4&/<3`NPOJ@fp33S n ;gJ`/<*/<1|N.PON^NuNVp3@Hn nHhNf"PO-@By@ .gpL`=y4 By4 HnHnHnN J@f34 Hn/.NPOJ@f n .fR/./.N.POHn/.NtPO=@NN0.N^NuNV/. N>XO=@/<1|N>XOn @opXO=@0.R@?0.HЮ//.Nn ?././. Nn B@N^NuNV n/(NuXO n gR n p.R p ?/./. N* N^NuNV y8fpY`j y<fpZ`Z y@fpX`J yDg/.0. H @0(n n?N\O` n m n o pDN^NuNVJnf nBPB@ n 0 n0`=n n:cRn0.=@0.H=@nD0.H@=@-|*@ n0.he TRn` n0.P=@JnfSn0.HH@J@f0.HdH@J@f0.HH@J@f-|*&Jnf=|n`-|* Jnf=|m n p0 n0.hc T n RP`"n0.Q n0 n0N^NuNV0.n cp`0.n dp`B@N^NuNV n BP nH?NQTOJ@g$ nH n 0 A@0 n 0R` .N^NuNVp=@Bnp=@ n R H?NRTO=@gJngJng nf&?.NQTOJ@g nR0.=@Sn0.ng0.@A @bjH0@ PN`|=n`r nRp1Sn` nRp2` nRp3` nRp4` nRp5` nRp6` n,g n.fBn` 0.SnJ@g nRp0` nBN^NuNVp=@ n R H=@gN?.NQTOJ@g(JngBn?.NRTO=@`?.NR:`p=@ nR0.` nBN^NuNVHnHnNpPO=@g0.`/.HnNZPO/.NC XOB@N^NuNV0.S@=@=nJy3f0.HdH@=@0. @ bH0@ PNJnm0.HЮ`Jy3g&?.?.?./<*/.ND=@`?.?.?./<*`Jy3g?.?.?./<*`?.?.?./<*`Jy3g?.?.?./<*`?.?.?./<*`xJy3g?.?.?./<*`Z?.?.?./<*`DJy3g?.?.?./<+ `&?.?.?./<+`Jy3g?.?.?./<+)`?.?.?./<+8`2.H I0.H H@A n2.H I0.H H@A n@2.H I0.H H@A n@ .V`?.?.?./<+G`X?.?.?./<+T`B?.?.?./<+a`,?.?.0.H @8T//<+p/.ND`?.?.0.H @8//<+z`?.0.H @8T/?./<+`?.0.H @8T/?./<+`BN^NuNV n l-|+Jng=n` p `-|+ n g0.@ =@0. @bH0@4 PNJnmv0.HЮ`j2.H HA0.H HA n2.H HA0.H HA n@2.H HA0.H HA n@2.H HA0.H HA n@ .X`?.?.?./<+/.ND=@`4?.?.?./<+`?.?.?.?./<+/.ND`?.?.?.?./<+`?.?./<+/.ND `/.?.?.?./<+/.ND`b/.?.?./<+`~BN^NuNVHnHnHnN, ?.?.?.?. /.N~ N^NuNVHnHnHnN Bg?.?.?.?. /.NrN^NuNVBn nBP nJg` n HnR ./N|VPO-@ n R 0.Rn nR >gpT`" n R "nRRn` n0B@N^NuNV093W@ @b@H0@T PN`RJy3f/<, `6/<,`.Jy3f/<, `/<,)`Jy3f/<,4`/<,=/.N.PON^NuNVp.?/.N.\O-@g$ .=@?././. N* `/./. N.PON^NuNV n (.gp-?/.N.\O-@gZ n (>fN/. .?/.N J@f(/. nHh n P/N" J@fB@`p`094 @bH0@` PN` n V/./. yV/N" J@g/././. N J@gp`" n V/./. yV`f n /./. y`J094 @bRH0@p``-| nH? <,H-@/N.\O-@g0 .HЮ-@ n /. nHh n`-|8 nH? <,T-@/N.\O-@gB .HЮ-@ n /. nHh n/N" J@f`tpN^NuNVJg^ n-hX n=PgJ .T-@0.SnJ@g4p ?/./. N J@f n B@` n-H`pN^NuNV <D-@ n "n Q-hX n=P .T-@-yN0.SnJ@g< nJ(f /./. NPOJ@f n B@` n-HT`pN^NuNV n-P-|D"n Q-hX n0=@=@ .T-@-yN0.SnJ@fp&` nf nH=@` n-HT` n?( n/(HnN* Rn0.ngxU n-H n(Hnf/.HnNPOJ@f n ( g n `T n?( n/(HnN* nH=@`|HnHnHnN J@gp` n B@N^NuNV Df^"n Q-hX n=P .T-@-yN0.SnJ@g, n f098 n@` n-HT`N^NuNVHnHnHn/.NHnHnHn/. N0.ngp`0. @bH0@ PN`.H.HAop`Z.H.HAfB@`FHnHnNPO`4HnHnNR``HnNXO?HnNXO?N|0XON^NuNVHnHnHn/.N nf/. /.NvPO`?.?.Hn/. N N^NuNV"n n0 nB@( n0 @bH0@ PN` n? n/(/. N* ` n?/. n/(NUd`/. n/(NCrXO?N\O`j n?( n/(HnN* HnHnNxPO/. ?.`HnNXO=@g0.`/././. /.NN^NuNV nB@( @g n?( n/(N\O`> nB@(?/<;lHnNX n?( n/(HnNn N^NuNV/.NXO n hp1@HN^NuNV n-h n=h nB@( @bH0@ PN nh n hp1@HB@`$0. @bH0@`?././. Nn 0.no0.n?0.HЮ/N\O`/. NXO?NTO@B.p?Bg`/. NXO=@?.HnNxb\OHnN>XO`p?/. HnNX `0.J@g @gXp5`J0.J@g @g`0.J@g @g`HnNXO=@g0.`?.?./. ` n?( nB@(?/. /.NV J@gp `p?Hn/. NUd ?.p`/. NXO?NTO n`F/. NCrXO=@p?p?Hn`X/. NXO?HnNx\O?./.HnNn `Hn/. Nw^POJ@gpD`p?p?Hn/.N N^NuNV n ( gpK`HnHn/. /.NB@N^NuNVBgp?/. /.N N^NuNV n ( gpM`HnHn/. /.NB@N^NuNVp?p?/. /.N N^NuNV nJ( gpL`HnHn/. /.NB@N^NuNV/. N>XO=@?.Bg/. /.N N^NuNV n ( gpE`HnHn/. /.NB@N^NuNVp?p?Hn /.N N^NuNV/. /.NPO n ( f Hn/. NxPO?./. Nxb\ON^NuNV nB@( @b6H0@ PN`$HnHn/. /.N`HnHnHn/.N nB@(?Hn/. NX ?./. N\O nJ(g nBA( n0( AH@B@H@Ю S-@ nRp. n  fv nRp0`HnHnHn/.N?./. Nx\O`>HnHn/. /.N/. NXO?NTO n  n B(N^NuNV/. N>XO?Bg/. /.N N^NuNV"n n0 nB@( n0 @bXH0@ PN`Hp*? n?/. N PO`0p?/. /<;lNn ` n B`/. BgN\ON^NuNVp3@HnHnHnHnNrBy@ ngp:`XO?Hn^BgBgNHnN XON^NuNV n!nLp0. //.NPOJ@gpH`0p~? nHhN.\O-@g nBR . n B@N^NuNVJnfpN`pYN^NuNV/.HnN.PO?. /.N\OHnN>XO20. A=@l /0.H //.`Hn0.HЮ/N.PON^NuNV?././. NX ?./. N\ON^NuNV?./. N\O0.H=@/.N>XO=@0.H=@0.nl0.n n -H =n`0.n n-H?./. /.Nn N^NuNV?./. N\O/.N>XO20.A=@l ./0.H //. `/.0.HЮ /N.PON^NuNV=y4By4/.NpXO/. N(XO=@340.N^NuNV=y4By4/.NpXO0. @bH0@ PN`/.N(XO=@`|/< NMXO=@?.?././< N `\HnNXO=@?.NTO n nB(` HnNXO=@?./.Nxb\O?./.Np\O340.N^NuNV=y4By4/.NpXONi=@34Jng0.` y0( @bH0@ PN` y?( y?(/. /< N `X/< /. N.PO`D/< NXO?NTO n  n B(`/< NXO?/. Nxb\OB@N^NuNV0. @bH0@0 PNpU`pC`pN` pL`pD`pMN^NuNV0.@C @ bH0@H PNp`B@`p` p`p`pN^NuNV?. /.HnN* HnNC XOJ.f. .Am& .Jn.H@AH n B@`Hn/.HnNG N^NuNV"n iX=P"n iX=P n (XT-@=n0.SnJ@g y yB n (XT-@=n0.SnJ@g././.NPOJ@f y ` n-H` n-HX y #`n yBN^NuNV#B# yJgL yJf y/NXO` y/ y/NPOX y #`B@N^NuNVBn nBBp@/. HnNTPOHnNsXO=@ @fB@. @@p=@HnNsXO=@p=@p-@JngT0.nn0?.HnNX\O=@Hn0.H/N POЮ-@p //.N PO-@Sn`Jng .D-@ n `JnfjN^NuNVSn 0. @T@HЮ-@ nH=@0. @f 0.@=@0.@N^NuNV/ J f/.NsXO`B.J l|B -@ Bn nl60.Rn6@p //. N ,PO@p //. N PO-@ f0. n@ nH@=@BA.0.A nTBn0.nlPJngSn0.0@B@(H@`B.JngSn0.0@(.0nRn`B@&_N^NuNV/.NVXO=@f/. NVXO=@f=|HnHnNPOJ@gp`Bg/. NC\\O=@ @f/.NXOp`p?/.ND\O=@ @f?.NE TO`?./.?.NGPO=@o ?./.?.NHPOngp=@?.NE TO?.NE TO/.NXO0.N^NuNVp@/. /. NTPO/./.NTPO/./. HnNw HnHnNTPOp@Hn/.HnNu Hn/. /.Nu N^NuNVp@ nB/. HnNTPOHnNsXOJ@f/<,/.N.PO`BgHn/.N /./.NPOp@/. HnNyPO/<,Hn/. Nu /. HnNTPOHn?.N*\OJnf/<,`Hn/.NPO/./.NPON^NuNV/<,/. NR`POJ@mPp@/<,/. HnNw 0.R@?Hn/.N /<,/. /. N /. HnNTPOJng6?./.N\OJng 0.S@H @8$//.NPON^NuNV nd mH0. HdS@H @7//.NPO/<,/.NPO0. HdH@=@ n m60. H U@H @8//.NPO0. H H@=@ n m 0. S@H @7//.NPON^NuNV^BndHn^HnfHnp/. /.NJnl09n^H=@b`=nb=n`JngTn`09n`R@=@h=ndf0.fHnhlp`p=@dBnjAp-Hl0.fSnfJ@g6 nl1nb nl0`Rnj nl -Hl0.dn`0.`yo?.?.?.jHnp?.N N^NuNVBn nBP nBP/.N>XO=@ n P(g~ nRP n!n /./. NAPO=@gXSn0.yo=y n0.Po n00.nHЮ -@ n1n n -H`z/. N>XO=@ n1@ n0.Po n00.H @BJg& n -H0.H @B-PA-H n?( n/(/.N* Bn n P(g nRP"n0.HЩ n!@/./.NAPO=@ghSn0.yo=y n0.Po n00.nn=@0.nHЮ-@ n1n n -H`\/.N>XO=@ n1@ n0.Po n0Rn`N^NuNV nfBgpp?/<,Bg?.N\ nf"Bgpp?/<-Bg09S@?N\ -n =np=@Bn0.SnJ@g6 nJhg?9z/. ?.NPOBn n -HRn`BnJngJnfBn0.S@=@0.S@=@no=n0. @ Jhf?./. HnN p=@ nf?9z/. ?.NPONz=@?9z/. ?.NPO0. |x2< `XHXW PN`0.R@`Bn`0.@)`?./. HnN `r0. @ =h?./. HnN 0. @ 0(ng.`?./. HnN8`0. @ =h?./. HnN8 0. @ 0(ng`=n`>Bn`N`?.NRTO=@=n?./. HnN 0.ng0. @ hH?NRTOnf=n`PJng<=yzpp3z nfBg?.` Bg09S@?NzXO3z0.N^NuNV0. Ю -@Bg?. n?( n/( n?( n?NN^NuNV n=P0.nfBn`Rn0. @ Jhg n0N^NuNV n=PJnf=n`Sn0. @ Jhg n0N^NuNVXHnXHnhHnp/. /.N=nbn 0.XT@=@b09Hb=@`09HbH@=@\0.\HR@=@Z=ndJngTndJnnp=@BnjAp-HlJnho`0.dynT=nZf=n`^0.^Sn^J@g2 nl1nf nl0d nl -HlRnjSnhg 0.bnf`0.nd`?.?.?.jHnp?.N N^NuNV n ( f/. /.N8`* n ( f/. /.N@`/. /.NPON^NuNV0. Sn J@g4A-HHn/.N>PO/. . /N$PO`N^NuNV n ( fR n0(@g8/. N4XO/?91l nB@(? nB@?/.Nמ`-|-Tp`p nB@(=@-n nJgVA-H n ( fHn/. n/(N6`Hn/. n/(N HnN>XO=@ nB@(? nB@(??./. nB@(? nB@?NN^NuNVH n -P n-h nB@(S@ @ b&H0@ PN` n //.NnPO` n `-n n / n?N*\O nB@(? n /N` nB@(? n //.N ` nB@(? n //.N` nB@(? n //.N` nB@(? n //.NF` n //.N`( n //.NPO nBC( n /N>XO=@Cd nB@(n? n 0.HА/N` n //.N` n //.N*` nB@( @bH0@`l/< n /N.`n n?( n?( n //< N `F n &P?9 NTO n PB(`$/< NXO=@?. n /Nxb\OLN^NuNV/./. N.PO/. N>XO=@0.n?0.HЮ /N\ON^NuNV nB@( ?N@TO n  n B(N^NuNV nJh f n B`/. n?( N*\O?./. N\ON^NuNV nJ(f n B`/. nB@(?N*\O?./. N\ON^NuNV n/NpXOHnNMXO n?( n?(/. HnN N^NuNV n/NpXO/. N)XON^NuNV n/NpXOHnNXO?.NTO n  n B(N^NuNV n/NpXOHnNXO?./. Nxb\ON^NuNV n-h 0n B0.HЮ -@0.n=@?./.HnN* nB@(S@ @ bH0@ PN`/./. /.N\ =@g0.` nJPfB@`x/. /.N`f0nB`?.Hn/.Nv `DHn/.N`2?.Hn/.NL`Hn/.N`Hn/.N,PON^NuNV/. ND$XO nP nBp34 /. NpXOp3@HnHnNq>POBy4 nf nf/. /.N.POB@` np?NTOpN^NuNV n H?NvTO n@ @bH0@* PNB@`p)?NTOp)N^NuNV/. NXO=@Jno no noV non n ( f no nJ( f* n1n yV/NaHXO=@ nnB@`p?NTOpN^NuNV/. NXO=@Jng" n0( @ndp!?NTOp!`0. n@B@N^NuNV/. NXO n0B@N^NuNVN=@0.N^NuNVNHJ@gNz`B@N^NuNVJy4gZ y3R3H=@ @ f"094S@g y3  f R3Sy4 n fp =@Sy4fN` Nh=@0.N^NuNVNNz=@N0.N^NuNV=yz=yzRy3?.?.NJXON=@ n;m nDnx0.@;H @4Jg`?<Hn/<1|Nn ?</<1|0.@;H @4/Nn N?</<1|HnNn J96gXJ95fP?<Hn/<1|Nn ?</<1|/<6Nn N?</<1|HnNn NJy3g0.`j0. |B2<`XHXW PN`p=@Nq(=y<p3<HnHnNq>PO3< n f nZn 0.T@=@p?/<-^/<-Y/<HnNz?.HnN\O`BJy4Zf/<-cNFXO`(p?/<-q/<-l/<HnNz?94Z`N`NH`NF`J95g?<Hn/<1|Nn ?</<1|/<5Nn N?</<1|HnNn `N^NuNVbHnjNcXOp?/.HnjNH J@fv?<NTO-@fgLHnbN XOJ@f0/.f?. HnjN /.bNXO/.fNXO`/.fNXOp?NTOHnjN `2NP/<-yHnN.PO/.HnN.POHnNFXON^NuNV=n Hn/.?./.N&J@fNBg?9z nHhBgBgN\ BnBnHnHn/<-/.NN=@0. @g @gN`$=n`=nJng``pH?NTON^NuNVHnN XOJ@f|NBgBgBgN6\Op @p @B.?93/<-N\O?93/<-N\O?93/<-N\O?93/<-N\O?93/<-N\OHnNXO?93/<-N\O?93/<-N\O?94`/<-N\O?93/<-N\OHnNXO?94Z/<-N \O?93/<-N \O?94V/<-N \O?94X/<-N \OHnNXO/<-NXO/<3NXO?9N/<-N \O?94T/<.N \OHnNXO?94$/<.N\Op?p/?NXO/<4&NXOp?p/?NXOHn?94RNV\OHnNXO/</</</</</<h/<J/<.NJ HnNXO?94/<.AN \O?94?94?94/<.MN" HnNXO?94/<.gN\Op?p/?NXO/<|NXO/<.nNXO?93/<.rN\Op?p/?NXO/<3NXO/<.xNXO/<.|NXO/<NXOp?p)?NXOHnNXO?9z?9z?9z/<.N" HnNXO-| BnBnHnNXO/<.NXOHnNXO n gp n-Pg\ n/(< n/(8/.0.@J?NźHnNXO0.H @!n0.RnH @1nXRn`Jnf0HnNXO/<.NXOHnNXON`"HnNXO/<.NXOHnNXOBnN @fNBgBgBgN6\OHnNXO/<.NXOHnNXO0.H @-h n-P n/(< n/(8/.0.H @0(@J?NźHnNXO .P-@ nJg< n-P/.NXO nHhNXOHnNXO .`HnNXO/</NXOHnNXO .T-@ nJg n-P n-hBn-| ng XRn` n-Pp?0.@J?NXO nJhg/</3`/</8NXO nHhNXO-n`nHnNXO/</=NXOHnNXORn0.nf`/.NXON^NuNV/.NXOJn g/</L`/</QNXON^NuNV/.NXOHn?. NV\OHnNXO/</WNXON^NuNV/.NXO/. NXOp?p/?NXO/.NXOp?p/?NXO/.NXOp?p/?NXO/.NXOp?p/?NXO/.NXOp?p/?NXO/. NXOp?p/?NXO/.$NXOp?p)?NXON^NuNV/.NXOHn?. N*\OHnNXOp?p/?NXOHn?.N*\OHnNXOp?p/?NXOHn?.N*\OHnNXOp?p)?NXON^NuNVp??.NXOp?p,?NXO/. NXOp?p,?NXOHn/.NPOHnNXOp?p,?NXOHn/.NPOHnNXON^NuNVHnN XOJ@f-|D-|@-|8-|XO6/. N>XOCf^Hn/. N`/. NCrXO6HnNXOC`(Hn/. Nw^POJ@gpD`HnNXOnf nBPB@&N^NuNV?</<1|N\O=@Nq(0.N^NuNV?. /.HnN HnHnNPON^NuNVp?p ?/. BgBgp?p?BgBgp??.p?Bg/.N0 N^NuNV/ *nm0. 0.@0.@ nfJy3gp @0.@094d@0.@0.@0.@0.@0.@ 0.@ +n B0.$@0.&@*_N^NuNV-nBn0.n l n!n n -HRn`N^NuNV-nBn0.n l0. n n -HRn`N^NuNV-nBn0.n l0. n@ n -HRn`N^NuNV-nBn0.n l$ nB@n n n -HRn`N^NuNV-nBn0.n l0. n@ n -HRn`N^NuNV-nBn0.n l0. n@ n -HRn`N^NuNVJngp`p=@Bn/./././. Hn?./.NDN^NuNVB-nBn n=h0. @bH0@| PN` n-P-n n=h nB@(=@-n nB@( =@ @f Jy3gTnp`Lp=@p=@p `< n=hBnp `*p=@p=@p `p=@Jy3gTnp=@p =@Jg/.N>XO=@ n=P?.HnHnHn/.?. n?N=@g\ nfp`B@=@?.?./.?.?.BgBg?.BgBg?.?.?. /.N0 Jg n!n n00.N^NuNVJ g/. N>XO=@`Bn0. no0. `0.=@0.n=@0.yo JnoB@`0. noH0.yo 09n`0. =@0.nH=@ n00.n n`&0.n H=@ n00.n n0p=@0.yo0.y=@Rn` n00.N^NuNV/. N>XO=@Jng/. ?.?.p?N N^NuNV-nBn n0 Ю-@ nJgJg"n0H @-P`B/.?././.?. /.Nn=@g: nRP n0 n -H n -H nRPRn nov0.N^NuNVBn n=P .T-@0.SnJ@g n0( n n-H`0.N^NuNV n BP-np?/.N\OBg/.Nb\ON=@ n g?9z/.N\O`BHnN XO=@g0.`./.NXO=@g ?.NHTO/.NXO0.N^NuNV n BPBn-nA-HA-Hp=@=y3 n-hg n @fR nH |2<`XHXW PN` nH? nB@(?/.N POBn`tBy3Bg/.Nx\O`^p33p?`/./.NPO nJgp=@`././.N.PO` n ( f?93`BnBHn/.N>POBnBn/.N>XO=@ nB@(=@JgZHn/./.N Hn/.N.PO/.N>XO=@=@Hn/.N؈POHn/.NPOJng$=y4pO34NV34p=@p?/.N\O?./.Nb\ON=@Bnp =@p=@0. |2< `XHXW PN`?9z/.N\O330.`Xp =@Bn0.nlP0.nlJgHn/.N؈PO`RnRn`Bn0.nl0.nm"JnoJgHn/.NPO`SnRn`Jnf yI4fpO`pI34NV`Jng*0np ?.?././.N٘ `0.ng~0.nS@?0.HЮ/0.R@HЮ/Nn 0np @?.?././.N٘ Sn`Jng60.nm JnoJgHn/.NPO`8Sn`00.no0.n?0nHh0.HЮ/Nn 0np @?.0.S@?/./.N٘ Sn`R0.n?0.HЮ/N\OJg|Hn/./.N Hn/.N.PO?.?././.N٘ /.N>XO=@=@BnHn/.N؈POHn/.NPO`?.?././.N٘ =n`?.NTOJ@f=np=@` n ( g nB@( @g?.NvTO=@JgHn?./.Nׄ J@f:Jnfb yI4fX0.nl$0.nfSn0.n?0.R@HЮ/0.HЮ/Nn 0n0.`$0.nl0n0.0.nfRn?.?././.N٘ JgHn/.N؈`Rn`v nB@( @g0?.NQTOJ@f ?.NQTOJ@f n:g n_f0 n ( f?.NRTO?/</vN.\OJfNPJnfJy3f"0.nmJngDHn/./.N /. ?.?.Hn/.N\J@gNP`/. ?.?././.N\J@f n (g:Hn/.N>PO n ( fBn?.?././.N٘ ?9z/.N\ONV330.N^NuNV0n H=@0. |2< `XHXW PNB@` n P g n?NTOJ@g nAg nLf n?N&TO n0` n?Nv` n P g n?N,TOJ@`V n P g n?NTOJ@fp n?NQ` n?NvTO n0 n?/</{N.\OJf4pN^NuNV n =PRn0.0@H=@g?./</N.\OJg n 0N^NuNV n =P0.SnJ@g.0nH=@?./</N.\OJg n 0N^NuNV nRH=@g*?./</N.\OJg nR"n R ` nBN^NuNV nB@(? nB@(n ? nB@?N6\ON^NuNV nB@(? nB@(?0.n?0.HЮ / nB@(n? nB@?NN^NuNV nB@(??. nB@(? nB@(? nB@(?N N^NuNV n BPA-H=y3-nA-HHn/.N>PONV n-hg2 n @f/././.Nd ` /./.N.`/./.N POHn/./.N6 HnHnHn/./.N/.N>XO=@Bn0nJg0n .gRn`=np?/.N\OHn0.n?/.NR ?./.Nb\ON=@Bnp =@p=@0. |N2<`XHXW PN`?9z/.N\ONV0.`4Bn0.Ұnl0.nlRnRn`Bn0.Ұnl0.no JnoSnRn` yI4fpO`pI34NV`\0.nl8?. nHh/.Nn np 0.nfRnRn` 0.no0.ng0.nS@?0.HЮ/0.R@HЮ/Nn 0np0@`0.nn60.ng0.S@? nHh/.Nn np ``0.R@ngr0.n?0nHh0.HЮ/Nn 0np0@Sn` nB@(?/.N\OHn/./.N6 HnHnHn/./.N0.=@=@`Jngh nB@(?/.N\OHn/./.N6 HnHnHn/./.N0.=@=@/./.N$POp-?/.N.\O-@f6p+?/.N.\O-@f Jng"Sn0.0@0.` 0. n`Jngh nB@(?/.N\OHn/./.N6 HnHnHn/./.N0.=@=@/./.N$PO0.ng0.R@=@`?.NTOJ@f=np=@`h?.N,TOJ@f NP`NJngh nB@(?/.N\OHn/./.N6 HnHnHn/./.N0.=@=@/./.N$PO0.ng0.nlX yI4fNJnfRn0.n?0nHh0.HЮ/Nn 0.S@0@0.Sn`b yO4f 0.nm<`\0.ngR0.nS@?0.R@HЮ/0.HЮ/Nn 0n0.Rn/./.N$POJnfJy3f80.nm.Jnf(/. ?.?././.N\J@gNPBn`f?9z/.N\ONV0.N^NuNV?.NQTOJ@f n+g n-fp`B@N^NuNV?.NTOJ@f n.fp`B@N^NuNV/.N>XOHЮS-@p.?/.N.\O-@f .R-@Jn gD nAd6 nSH |2<`XHXW PN` neSn ` .R@ n0N^NuNV-n-n -nBnBn nJgt nH |2<`XHXW PN`HJnfBp=@`( n -g n +f&"n nQ`Jnf"n nRRnRR` nB-n Bnp=@ nJgHJngB nH |2<`XHXW PN` np Rn`Bn nRH` n0 n0N^NuNV-n -n-n n @f$R nH |2<`XHXW PN nJg@ nRH=@f p =@S nH |>2< `XHXW PN`?.NvTO n`0.`?.NTOJ@g ?.N&` np `?.NvTO=@?.NTOJ@g` n g?.NTOJ@f?.NQTOJ@gh`?.N,`?.N,TOJ@fn np0`^?.NvTO=@?./</N.\OJ` nH nngSRR` nB` nH?/.N>XO?HnN POA-H`Hn/.Nw^PO=y3By3 n Efp33?./.Nxb\O33`"Hn/.NPOA-H nJfN^NuNV-n -n-nBnB-n nR  gSp =@ n -g n +f nH=@R-nBnB@=@=@ nJg4 n .f .R-@-@ nRJgRn`RRn`SBnpS?/.N.\OJgp=@ .-@-@ n @fA-H/././.Nd RBy3Jy3f nRH |z2<`XHXW PN` n-f nRp(-|/` nRp p =@p33` n-f-|/` n-g|-|/`p=@`/.N>XO?Hn/.NUd HnNsXOJ@f/.N>XO?/.N\O`H .R-@`n-n nJg n .g RRn`-nS0.HЮ-@ .S-@Jng(JngH nH |2<`XHXW PN`"n nSSn`0. n` nH |2<`XHXW` n gJnf0. np=@` np `"n n n gnJnfh` no^ n(H=@ n$g n*g n#g n9f0 n gJng n#g n9g0.`:"n nSnSS` nJgJngB nH |2<`XHXW PN`X0. n`L"n nRSn`8 nH | 2<`XHXW` np ` np0`"n nRR`l nBJng/.NDdXO`Jg/./.NPON^NuNV0. @brH0@ " PN`bJy3g </`N </`FJy3g </`6 </`.Jy3g </` </`Jy3g </` </-@/./.N.PON^NuNV/. /.N.PO-nBn nJg. n .gJng np9` np#`p=@R`N^NuNV/./.NPO nJf/. /.N PON^NuNV-n n B nJg nR  f/./. N.PON^NuNVBgp??9z?986?984BgBgN p?NTON^NuNVp?p??9z?986?984BgBgN BgNTON^NuNV?9zNTON^NuNV?9z09y?09Hy??9?9HNn BgBgBgN6\ON^NuNVBnJy4^gp=@?9z?986?984Bg?.Nn BgBgBgN6\ON^NuNVHnHn Hn HnNHnHn Hn HnN|?9z0.y?0. yH?0. y?0.yH?Nn BgBgBgN6\ON^NuNV?9z?90. y?0.yH?NPON^NuNV?9z?9?. ?.NPON^NuNV?. HnN\OBg?9zHn?. ?.N\ N^NuNV=y3p33Bg?9z/.BgBgN\ 33N^NuNV?9z/. ?. ?.N N^NuNV/. N>XO=@gV?./. HnN* 0.no0.n? NHhN\O?.Hn?. ?.N N^NuNVByzByz384z386zHn HnNPO?./. N>XO?/. ?. ?.N~ N^NuNVBg?9z/. ?. ?.N\ N^NuNV/. N>XO=@g"?.?.?./. ?. ?.NN^NuNV nf\Jy4^gXO=@0.HЮ-@ ṉg n \fR`S`/.HnN.POHnNXO/.N XON^NuNVJygn/</HnN.POHn/<3`NZPOp?HnBgNPO/<0HnN.POHn?9N*\Op ?Hnp?NPON^NuNVJy4^g/.NFXO`$?9zp.?/.BgBgNf p3N^NuNV/. ?.?.p?N N^NuNV/. /. N>XO??.p?N N^NuNV/.p?p5?p?N N^NuNV/.pP?Bgp?N N^NuNV yO4f094h`094j34fN^NuNV/<0p?pI?p?N N^NuNV/<0NXON^NuNV/<0N6XON^NuNVJy4^g/<0p2?Bgp?N ByN^NuNV/<0?<BgBgN N^NuNVJy4^g BgJ91|g/<1|`/<0NL\ON^NuNV/.0<n ?0. X@?BgN N^NuNV/<0 NFXON^NuNVJy4^g*Hn/.NPOHnp?pI?p?N N^NuNV/.?. ?. ?.Nd N^NuNVHn?. NV\OBg?9zHn?. ?.N\ N^NuNVHn?.NV\O?. HnN\OBg?9zHn?. ?.N\ N^NuNVHn/.NPO?. HnN\OBg?9zHn?. ?.N\ N^NuNV0.@B.Hnp?p3?p?N N^NuNV/<0%p?p2?p?N /<0'p?pE?p?N /<0+p?p4?p?N N^NuNV ndf nd f Bn=y B0. yH?0.yH?N|POB@N^NuNV/ =n0.n nA-HBn0.y86l&?.?.NJXO&nRNRn`Bn0.y86lS n  gR`Rn`J g$ nRp  nB/. HnNPO`& nBHnN>XO?HnNz\ONRn`6&_N^NuNVJy4gXO?HnNz\ON34N^NuNV09zyH309zy3N^NuNV/<HnN.PO/<0RHnNPO/<0[HnN*PO-@fp?NTO` /.?984BgN|PO/.NXON^NuNVJy4^gJnf6Jy4^fJng(34^JngNND` NNVB@N^NuNVNNVNNNNNBn-| yVg XRn`0.@J?NTON^NuNVBy3HnNH&XO=@g0.`^HnHnHnN =@fJy4g,A-H0.SnJ@g nRH?NNTO`Jy3gp `B@N^NuNVHnHn Hn HnNHnHn Hn HnN|0.n R@=@o?.?.HnN PO0. nR@=@o&0.SnJ@gHn?. ?.N6PORn`N^NuNVHnp ?Nt\O=@g0.`4?.?.?.?.?.?.?.?.?.?.N6B@N^NuNVHnp?Nt\O=@g0.`(?.?.?.?.?.?.?.NB@N^NuNVHnp?Nt\O=@g0.` ?.?.?.?.?.N. B@N^NuNVBg/.NC\\O=@ @g` n ( n/(8 n/(PN.PO=@fr n/(8 n hP/(N=PO`B@N^NuNV/.N6XON^NuNVp*?/.N\ON^NuNVp ?/.N\ON^NuNV nJhFf nJhDgB@` nJXO=@g0.`< n (*1fJy3f nJ`gHn/.NPPO=@fJngB@N^NuNV nJ n?(:N TO n1@ n?(4N TO n1@: n1@<=@ n?(6N TO n1@ n?(N TO n1@ n?(8N TO?NvTO n1@ n?(0N TO n1@6 n?(2N TO n1@8 n?(.N TO n1@4 nHh< nHhN.PO .@-@0.SnJ@m . /N>XO=@g`\B@N^NuNV nJh.fB@`RB?<Hn n?(,N =@g0.`( nBh.A-H n?(>N TO n1@, n?(N TO n1@: n?(:N TO n1@4 n?(4N TO n1@. n?(N TO n1@6 n?(N TO n1@ n?(N@TO?N TO n1@8 n?(6N TO n1@0 n?(8N TO n1@2 nHh nHhXO np1@6 nBh8 np1@4 nBh: nBh< .@-@/.N>XO=@g0.` n-h np1@ n0(>T@ n1@ n?(N TO n0"n n04 np1@ n (T-@//.NPO np1@./.N&:XO=@f/./.N5PON^NuNV0.X@ n1@> n1n n1n n1n n1n/. nHhN.PO/.N'XON^NuNVpA|-Hx nxHh/.N8PO nBhBnpJy3f nJhfp=@p?.p nxHh/.N/ =@vg0.v`Jy3gT"n n0(FHЩB-@r n?( n?( n0(>Y@? nxHh nrHhN7 J@fB@`2-nxr/. NBXO nr /.x nHh@/.N1D N^NuNV/ nBh n p n0.hfJngp?/./.N/ `/. /.N.:PO=@Jnf"n n0(FHЩB-@ n/NBXO n Jng4Jnf./.NXO6 n0(>Y@? nHhNZ\OCfX n?( n?( n0(>Y@?/. nHhN7 J@fB@` n gJy3f np1@p&N^NuNVrA|-Hx nBh/.x/.N8POBgp? n?(/.xHnr/.N*|=@vf*Jnvf$ .r fB@`$Hnr/.N.:PO=@v` np1@0.vN^NuNV nBh"n n1i:< n0(< Ю@-@ n=h4?././.N5n =@g0.` n-h .T-@ n/NBXO=@ nJh?././.N5n =@g0.` n-h n0(n n1@ n0(HЮ-@ n/NBXO=@ nJhY@?/.n nHhN7 J@g././.N:PO=@g0.`/. /.N)~PO`B@N^NuNV nJhgB@` np1@ nHh@/.N:PON^NuNV n0(: Ю@-@"n n1i:< n=h4?././.N5n =@g0.`n?./. /./.N0=@f nJhY@?/. nHhN7 J@lL n0(> n h`p`8 n?( n?( n0(>Y@?/. nHhN7 J@oB@N^NuNV n -h-n n=h> n 0(HЮ-@"n n 0(i?0.HЮ//.Nn ?. n 0(HЮ//.Nn n 0.h n ?(N TO n0 n p1@ n 0(n @nB@`/. /.N2PON^NuNVA|-HA-HHn/.N7PO=@g0.`" n=h> n -h-n n 0(U@H=@0.H=@0.T@=@?.N TO n0 n 0.ho n =h n =P` n 0(nT@=@=n?./.0.HЮ/0.H /Nn -n n 0H/NBXO n n ? n /(/.N66 =@f n 0(n=@?. nHh0.HЮ/Nn 0.T@=@?.N TO n0?./.0.HЮ/0.H /Nn n 0-n n 0H/NBXO n n p1@ ?./. /.N5n =@f2 n 1n"n n0(XO=@f nHh4/.N7PO=@f"n n 04 n -h-n?. nHh/.Nn 0.T@ n 1@?. n 0(HЮ//.Nn "n 0.i n 1@ n ?(N TO n0 n p1@ B@`P nRh< n -H ?."n n 0(HЩ//.Nn /./. /.N1D N^NuNV n 0.PgD/. /.N5PO=@g0.`T?. n /(/.N6 =@f n 0 n -h n p1@ n?N TO n 1@B@N^NuNV n Jh g0 n ? n /(/.N66 =@g0.` n Bh B@N^NuNV n=h,0.H-@-|Hn/.N PO-@Bg/.?.NFPO fp ` ?</. ?.NHPO @gp`B@N^NuNV n=h,0.H-@-|Hn/.N PO-@Bg/.?.NFPO fp `?</. ?.NGPOJ@np `B@N^NuNVJnfJng>?./. /.`< nf"Jng/. /.NR`PO`&/./. `Jnf?././. N N^NuNV"n n 08gL n ?Hn/.N6 =@f^A-H n?(N TO n1@8 np1@.B@`4 n0(6Rh6 n 0 n ?Hn/.N66 =@g0.N^NuNVA-H np0 n?(8N TO n1@ n1n 8?. Hn/.N66 =@g0.` np1@.B@N^NuNV-yV=y4 -yp34 n (##V n?( nHh/. N= 34 ##V nJhf n0(>Y@?/. Np\ON^NuNV n0(> n h"n n 0(imn n0(: @A@ fp`z/. n Hh /.N9 =@g0.`T n0(=@?./. /.N5n =@f"n n 0(HЩ-@ n/NBXO n B@N^NuNV n hn n0(: @A@ fp`/. n Hh /.N9 =@g0.`~ n0(=@?./. /.N5n =@f"n n 0(i> n 1@` n0(> n h"n n 0(HЩ-@ n/NBXO n B@N^NuNV n=h> n 0(n @fH n ?/.N8\O=@g0.` n p0 n Bh n Hh /.N:PO` n 0.h n -h n ?(N TO n0"n n 0(HЩ-@"n n 0(i?/.0.HЮ/Nn n p1@ n 0.h"n n 0(nif/. /.N;POB@N^NuNVt n=h> n0(: Ю@-@t0.Y@?Hnx"n n 0(X@HЩ/Nn "n n 0(nifN n tgD n -H 0.Y@?"n n 0(X@HЩ/HnxNn n p1@ `B@N^NuNV-nJg(/. /.N)~PO=@g0.` n-h`B@N^NuNVJy3g(-nJg/. /.N+PO n-h`B@N^NuNV-nJg(/. /.N.PO=@g0.` n-h`B@N^NuNV-nJg$/.N/XO=@g0.` n-h`B@N^NuNVNr-@/. NpXO0. @bnH0@ Z PN`^/.N)XO`P/.NM`HnNXO?./.Nx\O`&HnNXO?.NTO n nB(/.NpXON^NuNV?<>NTO-@ n fp`0Bg?<>/.NPO np1@, n!n n B@N^NuNV nJg n/(NXO nB n0 nBh B@N^NuNV nJf?<NTO n!@fp` n0 nBh B@N^NuNV .@-@p =@0.SnJ@g . /N>vXO`N^NuNV n-P/.N>XO/.NXO nBN^NuNVn nJhf/. /.N.:PO` .@-@r"nr nr0(HЩ-@nAz-Hv n0(>Y@?/.v nnHhNn /. /.N.:PO=@g0.`N"nr nr0(HЩ-@n n?( n?( n0(>Y@?/.v nnHhN7 J@gB@N^NuNV nJhf/. /.N.PO`B/. /.N@PO=@g0.`&/. /.N@POJ@f/. /.N?^POB@N^NuNVn .@-@r"nr nr0(HЩ-@nAz-Hv n0(>Y@?/.v nnHhNn /. /.N.PO=@g0.`N"nr nr0(HЩ-@n n?( n?( n0(>Y@?/.v nnHhN7 J@gB@N^NuNV/. N>XO?/. ?.NHPON^NuNV?9:?9:/<NAPOJ@gNN^NuNV?.?. /.NAPO nJhg nJPfp`B@N^NuNV# yBP yBh yB yB yB Jn gJnfp`0. "n n /.NXO n-P` .-@ n-h`B@N^NuNV?.NQHTOJ@f?.NQfTOJ@gp`B@N^NuNV nAm nZnp`B@N^NuNV nam nznp`B@N^NuNV n0m n9np`B@N^NuNV?.NQTOJ@f?.NQTOJ@gp`B@N^NuNV n g n g n fp`B@N^NuNV n m nfp`B@N^NuNV?.NQfTOJ@g 0.@ `0.N^NuNV?.NQHTOJ@g 0.@ `0.N^NuNVp@/. /.HnNu .H@gp` HnNsXON^NuNVH *n>. JGf/ NsXO`|JGl <B@G>x Dl"0RD0@0H H@@0H >fDH@=@H0.ATvnl:JDgSD00@(HH`zJDgSD00@(0CHRC`B@L N^NuNVH *n>. JGf/ NsXO`z El*0RE0@0 H@@0 >fEH@6TxCl:JEgSE00@(HH`|JEgSE00@(0DHRD`B@L N^NuNVH0*n(n / NsXO>JGnBU`lH@<TzxFlB6HAA0 A8Clp`Bnp=@0SGJ@gH<gz F0mV F9nPF00.RnnmB`JngRnJng0.Rn0@ 0EBn`0H:p=@`9<H0AfJnf p=@`vSJng0.Rn0@ Jng0.U@n n 0.n n @/. Ny,XO L N^NuNVH0*n(n 0.nmp` BnB@=@=@=@=@=@=@=nH@gp=@Jngp=@H@H=@/ NsXO=@ob0.n=@0.nn=n0.nno BnBn`0.n0.nno 0.n=@0.n`bp=@0.nn=@nn0.nno 0.n=@0.n0.D@=@0.no=n0.n0.n=@T0.SnJ@gp `Jngp-0.SnJ@g6JngH@@0Bn`H@@@0p=@Sn`Jngp0Jng 9<H0.SnJ@gp0`0.SnJ@gBJno6JngH@@0Bn`H@@@0p=@Sn`p0`B@L0N^NuNVH0*n n H@gp- n H@H=@/. NsXO=@B.BnJnn:p09<Hp@0.D@=@0.RnJ@lp0`p=@-M . T(@Bn0.nl`0.SnJ@fp@9<H0.@gH`H@@@@0J.gJ.g-MRn`-MRn`0.SnJ@o p0-M`J.f9<H-M ng(0.n=@l0.RnJ@l p0`-M9<H n(HAfS nB .L0N^NuNV/. /. /.Nu N^NuNV n H@gp`f/. NsXOJ@g/. NsXO=@p@@@@/. HnNtPOp@/<;pHnNR`POJ@fHnNsXO`/<;HnHnNu /<;HnHnNtZ HnHnHnNw HnHnNZvPO/<;|HnNtPOBn nlT0. :/HnHnNu HnHnHnNtZ HnHnHnNu Rn`Sn0.?HnNR\OHnHn/.NtZ B@N^NuNVBn/.HnNTPOJ@gp`p@@@@@/<;pHnNtPO/. HnNtPOJngL0.@gHnHnHnNu n0.@=@gHnHnHnNu =@`/.HnNyPO.HnNsXOJ@g&/. HnNZPOJ@f4HnHnHnNu HnHnNTPOHnHnNyPOHnHnNtPO/<;pHnNtPOBn nlT0. ;0/HnHnNu HnHnHnNtZ HnHnHnNu Rn`HnHnHnNu nHnHnHnNu nHnNsXOn nn.0.@ nH@gHn/<;pHnNw nHn/.NtPO0.N^NuNV n H@g/.NsXOp` p@@/. NsXO=@0.H=@2.I0.ސA n @/<;|/. HnNu Bn nlr0.@gA-HA` A-HA-H/./. /.Nw /././.NtZ /<;|/./.Nu Rn`0. n @/.NsXOn n@/./.NtPOB@N^NuNVp@/<;/. HnNw HnHnNTPO/<;HnHnNu Hn/. HnNu .H@g/<;Hn/.NtZ `Hn/.NtPOB@N^NuNV/<;/. /.Nu N^NuNV/<;/. /.Nu N^NuNVp@/. HnNa6POJ@g/<;p/.NtPO`ZHn/<;NZvPO/<;p/<;/<;NtZ /<;/<;N^NPO/<;Hn/.Nw n9;H@ nB@N^NuNV/. /<;/.Nu /./.N`ZPON^NuNV/. /<;N_~PONa/<;/<;/.Nw J@gp`/.NsXO @nB@N^NuNV/<;NsXO/<;p/<;NtPOBn nn0. ://<;/<;Nu 9;H@g,0. ://<;/<;NtZ Rn`/<;/<;NtPO/<;/<<NtPO0.9;0.9</<</<;/<;NtZ /<;/<;/<;Nu ` N^NuNVp@@/. HnNtPO.H@@./<;pHnNR`PO=@Jnop`Jnf/<;/.Nt`\HnHnNZvPOHn/<;pHnNu HnHnN^NPOHnHnHnNw Hn/.NdPO n.B@N^NuNVp@@/. HnNtPO.H@@.HnNsXO=@f/<;/.NtPO`/<;pHnNR`PO=@Jnop`Jnf/.NsXO`^HnHnNZvPOHn/<;pHnNu HnHnN^NPOHnHnHnNw Hn/.NdPOJ.g/./<;/.Nu B@N^NuNV/. /<;NtPO9;H@@9;Nd/<;/.NtPO n.B@N^NuNV/<;p/<;NtPO/<;NsXO-|;-|;Bn nn0.9;/<;/./.Nu 0.9; nH@fb n0.(/./<;/<;NtZ 0. ://<;/<;NtZ -n-n-n`\Rn`TN^NuNV/. /.NZPOJ@gp`/<;/./.Nw N^NuNV/. /<;/.N\ N^NuNV n  g n  fR` n 0e n 9b/. /.Nk"PO` n ae n zc n Ae n Zb/. /.Ni` nB@ | v2<`XHXW PN`p=@p`p=@p`tp=@Bn`jp=@p`Zp=@p`Np=@p`Bp`p=@ n (=fp=@R`"p=@ n (>fp` n (=fp`p=@p`p]=@/. /.?.Nht ` nB@`=|`Lp =@ n (?fp:`xp*`p =@p#`p `p `p` n (0e n (9ch/. /.Nk`d/. /.Nh`R n (&f"=|Bn`p=@p`=|`p=@ nB@=@/. nHh?.?.Ni N^NuNVBn .T-@ . R-@ nJg@ nHnf nB/. nHhBg?.`. nR"nRRn`/./. ?< nH?Ni N^NuNV .R-@ . X-@-@ nJgP n }f2 nB n Hh/.Nw^POJ@f(/. nHhp ?Bg`* nR"nR`/. /.?< nH?Ni N^NuNV0. n0. n@ . N^NuNVH0 . T*@(nBnBn am znH@ RRRn` Am Zo 0m 9n` _fp=@` -f ,>fp=@Tn` .f ng :gBJng/. / p??.`x=y<Jy@gp3<HnHn n HhNl =@3<JnfJy@g ng ng/ NjXOJ@g/. / ?.?.Ni L0N^NuNV n  g n  fR` n (fp`B@N^NuNV-n . T-@/./.NUBPO-@f/. /.?< nH?`DBn .S-@ n .g nfBn` SRn`/. /.p??.Ni N^NuNV .R-@ . T-@Bn n am* n zn n nR"nRRn` n Am n Zo n .fX nB=y<p3<HnHn n HhNl =@3<Jnf/. nHh?.?.`/. /.?< nH?Ni N^NuNV09<S@ @bfH0@!* PN"n n 0"n n0B@`>?9?./<<`?9D/<?0` ?9KJ/<D/.Nm -@fpN^NuNVH8Bn*n 0.S@HЮ (@/.N>XO=@bh HHЍ&@?.//.NP =@lI`JnoK`/N>XO=@0.no nmp=@JnfB`,0.ng cQ?.//.NP J@gP L8N^NuNVA-H-n0. Sn J@g`"n n"n ni0.HH@=@0.Hn4.@=@=n"n n"n niT`N^NuNVA-H-n0. Sn J@gp"n n"n ni=n0.4.@=@0.@=@2.II0.HA=@=n"n n"n niT`N^NuNV0.F@=@Rn/. ?. ?.No6PON^NuNV0.@@0. @@0.@@0. @@0. n@ n .H@@.H.HAf.H.HAgp`B@N^NuNVH0*n(n >.B.0SGJ@gZBB.B@$0@VHB@%0@VHAB@ .ccp@.d`B.B@.0@Wf`B@.L0N^NuNVH0*n(n >.B.0SGJ@g^BB.B@%0@VHB@$0@VH@dAB@ .cc B..d`p@B@.0@Wf`B@.L0N^NuNVH0*n(n >.<.Fl GSG0 @g`SF0 @gB`SF0 @fL0N^NuNVH *n>. 0SGJ@gB`L N^NuNVH *n>. 0SGJ@gJgp`B@L N^NuNVH *n>. x0SGJ@gJ%BBBA0<AH@B@H@ @VHBB@ @ccxd`xB@0@Wf`B@L N^NuNVH *n>.  Gg-B@B@SGfL N^NuNVH *n>. % Gg-B@B@SGfL N^NuNVH0*n>. <.0@@FJ.g ?/ Nq\OJFg8Fo((MƞFSG0 @g B@`SF0 @gB`?/ Nq \OL0N^NuNVH0*n>. <.0@@FJ.g ?/ Nr\OJFg:Fo*(MƞFSG0 @g $B@`SF0 @gB%`?/ Nq \OL0N^NuNVH0*n>. (n<.H>GT??/ / Np L0N^NuNVH *nH>GRG?/ Nq \OL N^NuNVH *nH<Fgp`H<FT?/ NqD\OL N^NuNVH *n-HL N^NuNVH0(n*n |H>GGH>GF??/ / Np L0N^NuNVH0*n UmB.IRz?/ ?/ NsN *nUmB.IR?/ ?/ NsN RE.H<.H@g(JFmI`nI0D@<??/ NrPOKI.H>.H<0G0@f?/ / No `&?/ / NpB J@g?/ Nqn\O .I ,}l(T,/ Ny,XO-L(n/./ NtPOB@`pL0N^NuNVH0*nH< FFFH>GI-LTSF0 @g`/./. /.NtZ L0N^NuNVH0*nH>G-H>GIz?/ ?/ NsN *n H>G-H>GB.IRz?/ ?/ NsN REI?/ Nq \O.H8DDKIz.H=@ng?/ / No nfSDg&Iz?/ Nq\OIE?/ Nr\O`I.H>.H80GGG.H>Hn.H??No6PO@.H>J.fLHnp??No6PO@.H>J.f(G-L/ Ny,XO(n/./ NtPOB@`pL0N^NuNVH8*nH>G-H>GGz?/ ?/ NsN ?/ NqD\OJ@g@*n H>G-H>GG?/ ?/ NsN (nH8DDTKGzBn?/ / NpB J@fRn n g`?/ / No >Gf0.H=@0.`0.G?/ Nr\OSDf&n.H>.H80GG.H>Hn?.H?No PO@.H>J.f6Hnp??No6PO@.H>J.fG/ Ny,XOB@`/.NsXOpL8N^NuNVH0*n(MH>G|TSG0 @gJfRF`/ NsXO`JF$H>GfRFJFg6(MHl,H??No POJ@fH>GT??/ Nr`POL0N^NuNVH8*n(n -L nH:E n(H:G~?/ ?/.NsN n(H<TJFo??/ Nr`POB.G/ / NtPOL8N^NuNV-yBBB/<4/9VN`PO=@f-y4#BBnp=@ L-@##B yJgzJngt y-P n!n"n n0 nB@( n1@ @f np 0 nJhf nRP n0nSn n -HX`~ nBP=y3=y3By3By3?./. yV/N{ =@3333/<4N_FXO0.N^NuNV.=|40.R@@=@ n~op`0.X@=@.Hn4Hn6NPO=@:f. n0.4.H@B@H@XO=@ @f(9|H@0=@0. @bH0@!F PN/<z/<|N*PO#nf6BgBgBgN6\O/<|/<zN*POp`p3n3nB@N^NuNVJynf"Jng/9nNXOBnB9|B@N^NuNV=n0.@=@Jyng?.?9nNXOB@`XO=@0.HЮ-@-@-n0.SnJ@g6 n .f-n n :g n \f .R-@`S` .=@ @ op =@?././. N* N^NuNVN^=@ @fp` nfNhB@N^NuNVNC=@g0.`HnNDXO=@f ngt`BB ngr`BA ngp`B@ABgpZ`ND=@fHnNDXO=@f no=|ND=@fxHnNkjXO=@fdNC=@fV?.Hn?.NPO?.BgHn/.N N^NuNVNC=@g0.`HnNDXO=@f ngt`BB ngr`BA ngp`B@ABgpZ`ND=@fHnNDXO=@fND=@fHnN(XO=@ftNC=@ffHnHnHnN =@fH0.no=n?.Hn?.N4POB@N^NuNV2 n  f nJgR`A-H n  g nJg nR"nR` nB n  f nJgR`A-H nJg nR"nR` nBp @4HnHn5N.PONHn2?<N\OBHn4HnBgpK?NAHn2?<N\OB@N^NuNVp&N^NuNVp?p?p?NM\Opw?p?p?NM\ON^NuNVp?p?p?NM\Opv?p?p?NM\ON^NuNV0.@ @0. @ @3z3 zp?p?p?NM\OpY?p?p?NM\O.H?p?p?NM\O.H?p?p?NM\ON^NuNV0. @bZH0@!Z PN`jp?p?p?NM\Opb?p?p?NM\Op`8p?p?p?NM\Opb?p?p?NM\O?.`p?p?p?NM\Opp?p?p?NM\ON^NuNV ng p?p?p?NM\Opq?p?p?NM\ON^NuNV?. ?.NJXO?.?./. NPON^NuNV?.NTO0. Sn J@g nRH?N`?.NNTON^NuNV n fj09zy84mDBg?9HNJXOp?p?p?NM\OpM?p?p?NM\OBg?984NJXO`?.p?p?NM\ORyz`j n fByz?.p?p?NM\O`J n fp =@09zy86op ?NTOp ?NTO?.p?p?NM\ORyzN^NuNVp?p?p?NM\Opf?p?p?NM\ON^NuNVp?p?p?NM\Ope?p?p?NM\ON^NuNVBg?.NJXO0.SnJ@g,p?p?p?NM\OJngpM?p?p?NM\O`pL`N^NuNVp??. ?.N6\Op?p?p?NM\OpJ?p?p?NM\ON^NuNVp?p?p?NM\OpE?p?p?NM\OByzByzN^NuNVp??. ?.N6\O0986yzR@=@0.SnJ@gp ?p?p?NM\O`N^NuNVHnHn Hn HnNHnHnHnHn?.?. ?. ?.N. ng4 ng,0. ng"0.n g?.?. ?. ?.N*PON^NuNV0.n f 0. ng?.?. ?. ?.N*PON^NuNV nJg nRHn fS .`BN^NuNV n f=| ?. ?.p?NM\OB@N^NuNV?.p?NMXON^NuNVp?p?p?NM\ON^NuNVNp?p?NMXO-@/</.N PO-@0.=@0.=@f 0.@`6 n8f nHf=|I n2f nPf=|QN0.N^NuNVp?p?NMXON^NuNV0.SnJ@g?.p?NMXO n R ` n BN^NuNV0.SnJ@g n H??.p?NM\OR `N^NuNVp?NNTO-@?<}/./.Nn N^NuNVp?NNTO-@?<}/./.Nn N^NuNV0. @H @z=P?./.N\ON^NuNVBg/.N\ON^NuNV?.NTON^NuNV?./. ?.NPON^NuNV?./. ?.N6PON^NuNV?./. ?.NPO-@ g .`p?B?.NPO-@ . oL . n0<` . =@?.Hn?.N6POngp` p0.Ѯ`?./. ?.NPON^NuNV/./. BgpV?NA N^NuNV/.pA?NA\ON^NuNV/.N>XOHЮ-@ nSg nHn f .`BN^NuNVH0*n(n >.g,JGg(d?Bg?Bg0SGJ@g%`0SGJ@g`L0N^NuNV0. |!z2<`XHXW PN`p`p`p`p`p` p`p`B@N^NuNV n m no?.NTO`pN^NuNV nAm nZn 0.@ `. nf0<` nf0<` nf0<`0.N^NuNV nam nzn 0.@ `. nf0<` nf0<` nf0<`0.N^NuNV-|z nB@@?NTO=@g n B@@?NTO=@g0.nlp` Sn0.nHЮ-@ nBA n B@@Ab nRBA n B@@Ae nBA n B@(Ac` n B@@?NTO=@gfSn0.nHЮ-@ nBA nB@@AeJ nRBA nB@@Ab8 nBA nB@(Ab"` n BAA nB@@AepN^NuNVH0*n(n >.0SGJ@gJg`B L0N^NuNVH *n>. 0HЍ-@g n ( fS` .L N^NuNV/.N>XO?/.NZ\ON^NuNVH0*n(n >.0SGJ@gHHAf JfB@`R` GgHHAlp`pL0N^NuNVH0*n(n BAB@Af JfB@`R`/ / NPOL0N^NuNVH0*n(n >.0SGJ@gHHAf JfB@`R` Gg/ / NPOL0N^NuNVH0*n(n >.0SGJ@gJgHHAfRR` GgJgJfB@` / / NPOL0N^NuNV nAm nZo nam nznp` ?.NTON^NuNV?./<z/. ND /. N>XON^NuNV?./<z/. ND /. N>XON^NuNV/./<z/. ND /. N>XON^NuNVH *n  g  fR`Bn -fp=@` +gSR~ 0m* 9n$HC0p //N PO/0Hї .`Jng D. L N^NuNVH *n>. JgB@GfS `BL N^NuNVH0*n(n B@ngJg`BB@nfR L0N^NuNVH *n>. 0SGJ@gp `L N^NuNVH *n>. 0SGJ@gp `BL N^NuNVH *n>. <.0SGJ@g`L N^NuNVH *n>. <.0SGJ@g`BL N^NuNV/.N>XO=@n l0. n?0.HЮ/N\ON^NuNV/.N>XO=@n l(0. n?0.HЮ/N\O0n BN^NuNVA-H"n n"n ni0.N^NuNVA-H"n n "n n iN^NuNV=nA-H nP"n n nn0.N^NuNV-nA-HA-H"n n"n ni"n ni"n nQ .N^NuNVNC=@gD?<NTO-@fp`0Hn/.HnN =@Jnfp?HnN\OHn?<N\OHnBgN\OHnHnHnHnHnHnBgBgHnBgBgBgBgBgBgBgBgBgBgBgBgBgp?N@< @fpp?NTTO0.H @34094Hd34094HdH@34Bg?.HnNPOBgHnN\OBgNTTOHn?<N\O/.NXO0.N^NuNV/.NtXO=@g0.``p=@0.Ю-@ np1@ n1@ n0 np1@ nBh nBh n!| nBh nBh n1| np1@p?Bg/.NDPOJ@fpH`Rn n-H np1@ n1@ n0 np1@ nBh nBh nB np1@ nBh n1| n1y`?.p?/.NDPOJ@gpRnp=@=@?.Bg/<z?.p?/.NJ@f:Rn=nHnN(XO=@fND=@fxHnNl"XO=@fdA-H-n BnBnHnN>XO=@ n lHn/.NAPO=@fp=@/.N>XO=@`SnJng?././.N* ?.?./.?.p?/.NJ@fRRn0.H @0.T@1@Rn0.R@ n-H0.nHЮ-@0.n0.nJng( .0-@0. n1@0.Ю-@ np1@ n1@ n0 np1@ nBh nBh nB nBh n1y` n1| n1|0?.Bg/.NDPOJ@gP=nRnp=@?.Bg?.?./.N J@f=nRnBnp=@=@?.Bg?./<z?.?./.NDJ@fRnRn?.Bg?./<{ ?.?./.NDJ@fRnRn?.Bg?./<{?.?./.NDJ@frRnRn?.Bg?./<{2?.?./.NDJ@f>RnRn?.Bg?./<{E?.?./.NDJ@f RnRn?.Bg?./<{X?.?./.NDJ@fRnRn?.Bg?./<{k?.?./.NDJ@fRnRn?.Bg?./<{~?.?./.NDJ@fnRnRn0.Ю-@0. n1@0. n1@Bn0.Ұno0.H @=hND=@fHnNl"XO=@fX?.Bg?.?./.N J@f=nRnBnA-HBnBnBn ndm p=@`Hn/.NAPO=@fp=@/.N>XO=@`SnJng?././.N* ?.Bg?./.?.?./.NDJ@f0.H @0.R@dnR@0RnRnRn0.R@ n-H0.nHЮ-@0.ڰno=nJngBn0.Ю-@0. n1@0. n1@ n0(Ю-@0. n1@ n0ng n0`JnfRn` NCN^NuNV-n np1@ n1@ n0 np1@ nBh nBh nB nBh nBh n1| n1|B@N^NuNV0.Ю-@ np1@ n1@ n0 np 1@ nBh nBh n!n 0. n1@ nBh0. n1@ n1y`?.?. /.NDPOJ@fpH`B@N^NuNV0.Ю-@ np1@ n1@ n0 np1@ nBh nBh n!| 0. n1@0. n1@pPnU@ n1@ n1|0?.?. /.NDPOJ@fpH`B@N^NuNV0.Ю-@ np1@ n1@ n0 np1@ nBh nBh n!n 0. n1@0. n1@0. n1@ n1y?.?. /.NDPOJ@fpH`B@N^NuNVN/<`/</</<NR3HBn n l0.H @ p0Rn`p3 /<H/<H/< N 3H3JHn?<N\ON^NuNVHn?<N\O?9HNpTON*N^NuNVNC=@g0.` HnNkjXO=@fHnHnHn/.NND=@fHnNkjXO=@fHnHnHn/.NNC=@fHn?<N\OHnND$XOHnNC XOHnND$XOHnNC XOHnHnHnN Hn?<N\OJnfB.Hn/.NPO=@fHn/.NPON^NuNVNC=@fHnNDXO=@fND=@fHnNDXO=@fND=@fHnNDXO=@f|ND=@fnHnNDXO=@fZND=@fLHnNDXO=@f8ND=@f*HnN(XO=@fND=@f?<NTO-@fp`?<NTO-@f/.NXO`?<NTO-@f/.NXO/.`BnBnBn-nHnN>XO=@HnNl"XO=@fA-HBnJnfHn/.NAPO=@fp=@/.N>XO=@`SnJng?././.N* 0.R@ n-H0.nHЮ-@0.R@n nnop=@`0.ذno=nRn`XJnfND=@g$NC=@JnfvJngpHnHn/.?./.?.?.?.?.N/.?.?.?.?.?.?./.N=@f/.NXOSy4/.NXO/.NXO/.NXO0.N^NuNVp=@Jnop=@=n0.SnJ@gj0.SnJ@g^ n0 n1n/.N>XO=@ n1@ n!n n -H0.R@ n-H0. n=@`0.n`l0.R@ n00. T@ n0N^NuNVBnBn/.NtXO=@g0.`Rn?.?.?.?./.N J@gpH`=nRn0. Sn J@gF?. n?( n? n/(?.?./.NDJ@fRn n -H`0.Ю-@0. n1@0. n1@B@N^NuNVBnBn09P=@09=@?.?.?.?.p?Bg/.NHn?<N\OHnBgN\OBnHnHnHnHnHnHnBgBgHnBgBgBgBgBgBgBgBgBgBgp?p?p?p?N@p=@0986U@?/./. N -@ nHh/. NPO-@ . =@?././. Nn n-H n -H 0.nJng nRRn n e n0.&N^NuNVH0*n(n Bn nP nB?</ N.\O-@g6 .=@?./ / Nn ?.Bg .R(@0.n`d$ .=@?./ / Nn 0.n n0.L0N^NuNVn n g n fp`B@N^NuNV nH=@n0. @ g @ g`, n(H@ @ fp` n(H@ @ fB@N^NuNVH0*n>. <.JFo"0S@0HЍ(@|Gn LS"MSRF`L0N^NuNV n-PBn nH@ @ fRRn n  fRRnJ g n 0.P n Jnop`B@N^NuNVBn n dH nH@ @ g6 nH @ gRn`0.HR@H=@0.nnR` .N^NuNVH0*n(n Bg/ / N L0N^NuNVH0*n(n >.d8H@@ @b H0@! PN`0HR@H>`RGR`0L0N^NuNVR n P n Bp ?/.N,\O-@p ?/.N,\O-@ n S Jf-n nc-nJgR n c-n Jg .` . N^NuNVH0*n(n c H |!2<`XHXW PNR` L0N^NuNVR n P n Bp ?/.N.\O-@Jg4 nB?</.N.\O-@ np Jg .`R .`L?</.N.\O-@ nc Jg-nJf-n n S Jf . N^NuNV/ *n mHh/-NtPO=@0986S@nl / NXO`?./ Nb\O*_N^NuNV/ *n0986U@? mHh/-N -@ nHh/-NPO-@ me/./ NPO/ N|XO`/./ NPO0-R@?/-/ N *_N^NuNV/ *n m(H@ @fb m Hh/-NPO-@?. /./-N =@Jng*0986S@nm mHh/ NԢPO/ N|XO*_N^NuNV/ *n - =@ mHh/. NPO-@ nH@ @f8S0984W@mo&0986S@?0984W@?Bg0-R@?NPO+n /. /-NtPO=@?.0-T@?NXOBg?</ NҖPO m+H*_N^NuNV/ *n - =@ mHh/. NPO-@ nH@=@0. @ g @gZ`\0984W@mo(0986S@?0984W@?Bg0-R@?N0PO`&-m/ N˨XO/ NXO+n`Sn m+H?./-/. Nn /. /-NtPO=@?.0-T@?NXO n  . R+@*_N^NuNVH *nBn-m +m" m Hh/. NPO-@0984W@nm nHh/. Bg?.N\ 6986SC/./. NtPOCoPp=@0986U@?/./. N -@ nHh/. NPO-@ nH@=@ nfDp? .?/.NlPO/./. NtPO=@ n .R-@ ` .=@S?./- mHhNn n|/./. NtPO=@ n f40984W@no&0986S@?0984W@?Bg0.R@?N0PO-n 0984W@nm?.0.T@?NXORn`TJng / N,XO`+n L N^NuNVHnN XO=@f/.NXO=@/.NXO0.N^NuNV/BnBn=|HnHnNPOJ@gp`Pp?/.ND\O=@m>p0.//.?.NJ =@fN?.NE TO/.NXOp `p=@Bg/.NC\\O=@l/.NXOp`Bn?.NE TO0.@ne/.NXO`N/.Hn?./.NdJ@f`/.NXOBg/.NC\\O=@o8v6.p0.//.?.NK gp=@?.NE TO`p=@`Jng /.NXO/.NXO0.&N^NuNVBnA-H n??. /./.NJ NBpp?0986R@?/<{BgBgNf pp?0986R@?/<{Bgp?Nf pp?/<{Bgp?N pp?/.p?p?N pp?/<{p?p?N /.NXOBn=| nf/.NXO n?( n?(NИXON=@0. |!2<`XHXW PN`/.NXO`/.N˨`/.N`/.N`/.N`/.Nd`/.N͜`/.N@`/.Nվ`/.N`p=@/.NdXO/.N|`rp=@/.N`p=@/.N``L"n n (=@ n"h!I?. n/( n/(Nn n/(" n/( n/(ND n0NBn`tJng NJ@fbNp=@`RJngB@`p=@?.NTOJ@f n g n f p=@?.?./.NҖPO`0.N^NuNV/ *n?.Bg _ (fSn . +@+@+@*+@0.H@B@H@Ю +@"+@ 0.nH@B@H@Ю +@?./-/. Nn ?./-/. N =@0.nH@B@H@Ю +@?./-/. Nn / NXOBmBm/ N,XO*_N^NuNV/ *nBm-U-m0984U@mg*HnHn/./.NJ@f Rm-n`-m-m"0984U@mg*HnHn/./.NJ@f Rm-n`+n *_N^NuNV/ *n/-/-NtPO;@*_N^NuNV/ *n?-/-/-N +@*_N^NuNV/ *nHnHn/- /-NJ@gp`0?./-/-Nn +m m+H+nB@*_N^NuNV/ *n mfp`jHnHn/-/-NJ@f( m+H?./-/-Nn +mHnHn//-NlJ@f+nB@*_N^NuNVBn-n n n0 n fp`: n dHnHnNPOJ@f RRn` n n0B@N^NuNV n fp`VBn .S-@/.NXOJ@gSRn n c/.NXOJ@gR n n0B@N^NuNV/ *n/ N|XOJ@gHnHn/-/NlJ@gp`*/ N|XO0984U@mn&HnHn/-/- NlJ@f+n `Rm0986S@?0984W@?BgBgN0PO/-/-BgBgN\ `Sm/ NXOB@*_N^NuNV/ *nBn/ NXOJ@gHnHn/-"/-NJ@gT mg m(H?NTOJ@fp`+m0984W@moRm/ NXO`p=@`+n / NXOHnHn/-/NJ@f*0986S@?0984W@?BgBgNPOJngSm/-/-Bg0984W@?N\ `Rm/ NXOB@*_N^NuNV/ *n -S+@ mH@ @ g @ g R`S*_N^NuNV/ *n+m*_N^NuNV/ *n mH@ @ f/ N˨XOJ@f/ NXO` mgR*_N^NuNV/ *n mf/ NXOJ@f/ NXO`S*_N^NuNV/ *n Ug=m=m/ NXO0984U@=@*0.SnJ@g/ N|XOJ@g*/ N,XOBm0-ng/ NXOJ@fRm`;n/ NXO/ NXO*_N^NuNV/ *n m "gp=m=m/ NXO+m" / NXO*/ N,XOBm0-ng/ NXOJ@fRm`;n/ NXO/ NXO*_N^NuNV/ *n/ N|XOJ@fSm`*_N^NuNV/ *n/ NXOJ@fRm`*_N^NuNV/ *nN/-/NFPO/- /-NFPO*_N^NuNV n g nRH?NpTO`N^NuNV=nn n f^ n f(0986S@??9NИXOp?pp?Hn?.NGPO @gp ` /.NBXO n!@r n1npB@N^NuNVHn/.NڮPOBgHnNC\\O=@lp` n1np/.NِXON^NuNVBg?<HnNPOp/NBXO-@BgB n?(pNFPO fp `.?<Hn n?(pNHPO @gp` np!@rB@N^NuNV n-h HnHnHn/.NJ=@fp=n0.@ne/.NXOp`P/.Hn?./.NdJ@f"?.?.?././.N=@/.NXO0.N^NuNVHn/.NPOHnN>XO?Hn/<|;/<|:/. NzN^NuNVHnHnHn/. NJJ@gB@`././.NAPOJ@gp`B@=@/.NXO0.N^NuNV n0/./. NPOJ@gp`4/. n? n //.Nۦ=@g /. NXO0.N^NuNVHnHnHn/.NHnN4XO-@f n B nBP` n-h n=hp . -@-@ .-@Bg/.?.NFPO fp ` .ncp`/</.?.NJ -@lp `l nBp?/.N.\O-@g, .ꐮR@ @f nB`$R n fS` n-H`j .ꐮ n0B@N^NuNVBgB n?(pNFPO n/(rNBXO n!@rp? nHhr n?(pNHPO @gp` n?(pNE TOB@N^NuNV/0.R@nep`d?.Bg _ p~p?0.H@B@H@Ю /?.NHPO @gp`*Rnv6.p0.//. ?.NK fB@&N^NuNV/HnHnHn/.NHnN4XO-@f JnfB@`F n-h n=hp0.T@nep` ?.Bg"_ 0.R@H@B@H@ @ pTn0.HHH@B@H@-@0.@gRTn0.HHH@B@H@-@0.@gR .nJf n-hr n .Ѩr .-@Bg/.?.NFPO fp `bv6.p0.//. ?.NK gp`:Hn/.NPOp ?HnN\Op ?p?Hn/.N &N^NuNV/.NِXO=@fp//.NPO=@fj n-hX n=P .T-@0.SnJ@g0 n ( f/./.NvPO=@f, n-H`/.NBXO=@g nfBn0.N^NuNVN^NuNVN^NuNVN^NuNVN^NuNVN^NuNVN^NuNVN^NuNVN^NuNVN^NuNVN^NuNVN^NuNV3:0.@ H|@-@p=@ nl$ nRH2.H A:0Rn`/9N XO09N^NuNV#:"#B&#`*#.#2#6#"p ?NVTO3pN^NuNVp?NVTOpN^NuNV3`3 b3 d3f3h3j3l3n3p3r3t3v3 x3"z#$3(|3*~p?NVTO n,0 n00 n40 n80 n<0 n@009N^NuNV## pZ?NVTO n009N^NuNVpM?NVTO n0 n 0 n0 n009N^NuNVpO?NVTO n0 n 0 n0 n0N^NuNV3`# pN?NVTON^NuNV#3 `p?NVTON^NuNV#3 `3bp!?NVTON^NuNV#3 `3bp(?NVTON^NuNV#3 `3b3d3f3h3j3l3np/?NVTON^NuNV#3 `3b3d3f3h3jp*?NVTON^NuNV#3 `3b3d3fp+?NVTON^NuNV3`pk?NVTON^NuNVpe3ByBy3NN^NuNV## .Z#pd3Byp 3 n 3N n 0# #H#V#RN^Nu#"< <sNBNuNVH *nBEB@H.H< @ g F fR` F-fz` F+fRH< @0m$ F9n6Hp //N PO0.`JEf D. L N^NuNVH8&y# g.*[ g((nHHAfJgR`Jf -=f `BL8N^NuNVH8..P b d.</NXO*@ Mg`J}f&M #}#}`& y}f QP&m`(y}Q L&h)M Q@* Ѝ#}(@Q LB)KL8N^NuNVH0~ .\S@,dB`ƙ*y} gr .gH g @є .*L(Mc2  d @*`* Ѝ#} y} X`dJg @Ѝ*@`*m}f g#}Ry}09} @e Sy}`X/NXO/.NXO*@Sy} L0N^NuNVp0./NXON^NuNVH .Y*@Jf4~0G}Jg 0RG0@}H?p?p?NM\O`NlL N^Nu"o o JfSfNu"o ofJfHHNu"o o fNu o"Jf S@Nu"o oB2/ gSAfJgQHHNuNVHn/<}NPON^NuNVHn /.NPON^NuNVHn/.N>XO?/.Nz Hn HnNPON^NuNVH Bn n X -P nRH> |"2<`XHXW PN`Z/./.NXO<?Nb\O Ff`4/. n hNXO<Gg/.?Nb\O` nRH> @*fp`B@=@Jng nRH>Bn G0m( G9n"0. G@0=@ nRH>` Glfp`B@=@ Ghfp`B@=@JnfJng nRH>0 |"Z2<`XHXW`/<~/<}NPON `6Rnp `Rnp`RnBn` Rnp=@Hn?.?./.N -@JngJnfbJng n X P `Jn n X P0.0Rn`0RnHn?./.N -@-AJngJnfJng n X P .". !A` n X P .". `A-H nRH> @^fp`B@=@Jng nRH>JGg G]g nR` nBA-H/. n hNXO<`DJnfp=@/. n hNXO<-|}`/.NXO<-|}p=@Jnf n X *PBn FgH?/.N.\OJfp`B@nf*RnJnfSnf|`/. n hNXO<` Fg/.?Nb\OJngJnf GcgPB`JJnf n(H@gp`0.L N^NuNVH>. <.BJFo F o| nBP/.NXO: E-fp`B@=@f E+f/. n hNXO: nRP n0FnPJGfL E0g~ `B/. n hNXO: nRP0Fn$ Exg~`~/. n hNXO: nRP n0Flf0@W8 @ l0@78 @ l0@08m D nGm Gf0Jf*0@x8f 6HHn0H/N PO-@`z/.?Nb\OJng .` .DLN^NuNVH |KJn o n op =@ nBP n0n l/. n hNXO> |"2<`XHXW PN`|JFfx nSP nRP`JFg Ff`RF` Fn(|`JFg Fg Ff|` Fm6 Fn0|` F` Fg Fg Ff|` Fg Ff|`/.?Nb\OBHnNXOL N^NuNV//. n hNXO> @ g G g G g0.N^NuNVHn/<}NPON^NuNVHn?</.Nz Hn HnNPOHnBg nN\ON^NuNVHn /.NPON^NuNVH0-n n(PXH> @%gJGgP/.? n hN\O`p =@p=@p=@H> G-fp=@H>`Bn G0f p0=@H> G*f& nT=Plp=@0.D@=@H>`*Bn G0m G9n0. G@0=@H>` G.fJH> G*f nT=PH>`*Bn G0m G9n0. G@0=@H>` Glf&H> Gdg Gog Gug Gxf0@> `-@*@p=@0 |#\2<`XHXW PN`4 nT=PJnl0.D@=@p-p ??./ NPO*@`p ? nT?`p`p` n-PXJl .D-@p-p ?/./ N `p ? n// N *@X`p`p`/ ?./.?N4 *@P`fBn n-Pf-|}X .-@*@JgJnm noS`(Bn nT0` n//.NPO`n ./0.Hї =@lBnJnfLJng0 n0f( n -f/. nRH? n hN\O0.SnJ@g /.?.` nd /. nRH? n hN\O`Jng0.SnJ@g/.?. n hN\O`L0N^NuNVH >. *NB%0<g"0H@H@B@H@ @#>`?Bg _#Jg nR` .L N^NuNVH0*n>.IB$p0//. N PO-@g$p0//. N XPO @#-n ` n #Jg` L0N^NuNVH >. *nSGo"/. n hNXO< @g 0 @ fB Ff fB` .L N^NuNV/ *n/ mNXO*_N^NuNV/ *n "f&+|+|Bm -;n0.`> f +|` tf +|T` f +|`p*_N^NuNV/ *n+|"+|FBm -0-*_N^NuNV/ *n+|+| ;@ o -;@ -0-*_N^NuNV/ *n+|t+|Bm -0-*_N^NuNV/ *n+|/N>XOD@;@ 0-*_N^NuNVH >.*n / mNXO/ ? mN\OL N^NuNVH0*n(n Jg/ H? lN\OR`L0N^NuNV/ *n / ?. mN\O*_N^NuNV/ *|~2~d2Jg U(H@fp?//. /.N*`X`B*_N^NuNV/ *n/ NXO @fp`D?./. -H?NPO-@ gJg0.@H@B@H@Э*+@B@*_N^NuNVH *n>.|BnBnp=@ n R pr@H @rf|pw@ n g,H @bfBnR n gH @bfBnJGlJnf?/.N\O>JGl@JnfJng4?</.N\O>m Fg?NTO?/.N\O>JGmJngp?B?NPO fp?NTO*@ f ?NTO`|p@Jng- p+@*+@Bm +|"+|FG `DH @wfRn`H @af&Rn`H @+g.HHAf|`BL N^NuNV/ *n .*+@+|B-0. D@;@ m l;| +|`+| *_N^NuNV/ *n Sm lBm p` UR0.*_N^NuNV/ *n UR0.*_N^NuNV/ *nRm oBm p` URB@*_N^NuNV/ *nJf0-H@f?<NTO+@f+|t+|`n-H@f2-H?NTOJ@g}f+|+|0 -`&+|+|-H?NTOHЭ*+@Bm *_N^NuNV/p?B?.NPO. fB@`0H@.N^NuNV/ *n/ N4XO/ mNXO*_N^NuNVH >.*n / N4XO/ ? mN\OL N^NuNV/ *|~Y M~2eJg/NXO`*_N^NuNVH *n-H@fp`@/ NXO>-H?NTOJg-H@f /-NXOB-0L N^NuNVH *nBm -H@ff >o?/--H?N6POGf$JGm mAf -*+@`+UB@` 09#H fBy#`-pL N^NuNVH *nRm o/ NXOJ@f 0~f/<}NXO -?/--H?NPOD@;@ @f^09#H fBy#`-Bm `F0- Rm m+H URB@>-H@ g G gL Gg 0`Jm f-pL N^NuNV/ *n 0~f/<}NXOBm p?Hn-H?NPO @g4J@gP .f -H@ f< . f -H@ fB@.`(09#H fBy#`-`-p*_N^NuNVH >.*n G f$-H@ g/ p ?N\O @fp`0Sm l"/ NXOJ@f -S@;@ UR0L N^NuNVH >.*n G G f -H@ g/ p ?N\O @g^Bm -H@fN/ NXOJ@f@p?Hn-H?N6PO @f0` 09#H fBy#`-pL N^NuNVH >.*n G f$-H@ g/ p ?N0\O @fp`?NAXO/NXO`B@N^NuNV/Bg/.pl0H/NXO`"?.NTO=@m?.?NXO0.N^NuNV/?.?. rF?NA\O>J@f(?.NTO=@m?.?. NXO0. `0H/NXO.N^NuNV?.NTO @Cfp`B@N^NuNV?.?./. pB?NA /NXON^NuNV/?. /.p=?NAPO.m:0H.mpF?0?NXO` m n0?N(TOH./NXO.N^NuNVH A#~/9~N bXOJ@gB~p 3#p`?.NTO @Cf|9H>9HH*@SnmSGl^pQB9/<p ?NA\O>mp ?p?p?NM\Op9H>9HH*@0Gp H: Ef~` n R RF E ft B~0`0/. 0.H/?.p??NA >B~0H/NXOL N^NuNVH..Jl <`0Jf 9`$R @./pH?NA\O,g Ї# LN^NuNV0.H/NXON^NuNV/A#~/9~N bXOJ@gB~p 3#p`,/. 0.H/?.p@?NA .B~/NXO.N^NuNVH >.0V@ @bH0@# PN`*pP`&pA`"pC`JGm*y~SGmJfp`JgHL N^NuNVH >.JGm*y~SGmJfp` Jg0. L N^NuNVH >.0V@ @bHH0@# PN*y~HGg Jfp`&R` ~?N.TO`~C`~A`~P`pL N^NuNVJl .D3#p` .N^NuNVH *nA-H-nHnN XOBnBnp@=@ +g -fnRH> @.g G0m G9n G.f0.@fn`B@.@gRn`jHnNXOHnHnN POHnNXOHnNXOHnHnN DPOHnN XO0@0@HnHnN DPO0.@gDSn`< Geg GEfZ +g -fnRBnH> @0m G9n0. G@0=@`0.@g 0.D@=@0.nBn nl NJ(fRn` nf HnBgBg`JnoHnHnN POHnNXOJ@f:HnNXOJ@f*HnHnN DPOJ@fHnHnN PORn`VHnHnN POBgHnN\OBgHnN\OHnHnN DPO>gRn?HnN\OVnSnfJ`JnlB@.@fHnNXOSn`BgHnN\OHnHnN POBn n lJ0.@gBgHnN\OBgHnN\OBgHnN\OHnHnN DPORn`WnRnfdSnHnNXOJ@gHnN XOp@HnHnN DPOJ@gRnBgHnN\OHn0.@?0.@?/.NF n "(L N^NuNV/~ G lBg/.N\ORG`0.@@ n0.H@ n(Jn g n/./.N PO.N^NuNVH| Fl4>. nB@@=@ nJGg nRF`0. LN^NuNVH|zJEm.>| nB@@g| n nŏSE`0LN^NuNVH|~JGm. n BA nB@A@ n0@@<SG`0LN^NuNV/~ Gl n"n RG`.N^NuNV/~ Gl nBRG`.N^Nu"o`C"/jD$jDA`|J/j JgRJk`JjDNu"o`C"/$A`JNu"o`C$jD"/A`, g J/j Nu"o`C$"/A` NupJfpN∲cd⒒d҂dFN o"`"/ jD$/jDD$@A`" jDNu o"`"/ _$0"@0HAHBЁH@B@ЉNNVH ..|Jg 0F "@~SF`|0FJg 0RF0@H?p?p?NM\O`p?NlTOLN^Nu O$X"XHB@Nu o0/L.Nu"/0<NBNu X ^ @=TUVW  G H P w N*J?Xb"""B"B"""B"B"B"B"B"B"B"B"B"###$#$###$#$#$#$#$#$#$#$#$#b$$$$$$$$$$$$$$$$%@%%%%n%%%%%%%%%%%)*,*J0*V2*z4*b6*nT*Y+[*\*k*~**)+*0++*+*+*.r/,s/ t/4u/v/ w/0-,T,d,n,x,,,,,,,--.(.d../8///NNNNTTTUUHUr W<WFWZWd*W+WPVWn]WxjW2 WWWWVWWWWWuuuvTvv|z{zxzxzx{zxzxzxzzxzxzx{zx{zx{  D"#8"bbDl>&6XzhrtRfB.N*"Fp8L\\b ,Vh|l&4(6BD~n :JVp2@ (4BLZt &4T.8N\&x.8>LZd*n4@Jp ~v.@>fĊ nv.HLPns"tɈx".HDDXDצ4ؤغڜڜڜڜڜڜڜڜBBڜچڜnڜ 00 00000HVP  HP@  rdH PFxttt6 ` d h l `8 vHP,N8 ttt<|!|pVV  F FF "! 0 l z !! "t^tt @\######$F$P$X$`$h$p%%%$%,%4%<&*&?&[''+++,B,0/00/1818332133*|*|55f58X5V9:0:l:;j;j99-./N+6X3+;V;`<< 44*|*|*|<="18>\?@R00@v@@**|*|**|*|*|**|*|*|+h+(BzBBBCCCCBXGbGtGGGGGGGGGGFGGG,G>GPPlP|QQP\+\,\p\_ _$8^O^P^^__>_ _8_O_P_^_Q`B`T```*`v````````QWt\,QVWWXX^^YNYYYXXXXXZZJZJZJZJZJZJZJZJZJZJZJZJZJZJZJZJZJZJ[ [ [[[\,\,bb\V<]R]^@^^^^^___a__^a&______RRNS@SJSTS^SS^^S6S,TT*VXTTU^dVVa.a\^aVlVbaPQPRQQQPQQQVQQVQQjqqqqqqqqqqqqqqqxxxxx}<}F}X}d}<}F}X}<}<}X}X}p}|}|}<}F}X}}X}d}<}F}<}X}<}X~&V$(Jt 4pR^p68Xr8<d`xJRj|`dhl\p D"GHKM,PF]w  "Jl~6Thr.>R rrb6666:6RAHB>CDh]4@DzDb*HHHH˨!RARDzEАRО!*rKlM0RҮast!# 9A׺L׺N(U׺X״YT!״ۨۨۨ+ݾ-ݾ.ނ6KMRabsۨtۨ #$*.9#j$d*d,B.49j#| $*0 !ADER!D!#9&ALNUXYB!h(xBCR.XZ(#$*9S##$*,89S##9S#.#9&S#.:BJRZbjr====G"G Gg g gh6!g"g#g$g&h'g(f)f*f+f,h@-f.g/g<g2=g>g?g@g[gd\gX^h,{h|gh6h@lll6Z|***    D2XGHŘKMPŦRsŲtžw  p p Jz%HDFEFNVONX`[2cdJefnZoRsxd(z " " "%pH X X X+j-j.z0123456789Ee DlOUXc&defgodr8suTxhD0123456789ABCDEF~zDO 0##########BOFEOF*RANGE is to RANGE is to ::.fmtdBMAN STACK ERR DBMEM.MEMDBMEM.MEMDBMEM.MEMDBMEM.MEMdBMAN STACK ERR .prodBMAN STACK ERR Updating current command filedBMAN STACK ERR D_ARG000D_ARG000Y.V_A@RPRTI.DBMdBMAN STACK OVERFLOW PICTBFSZ4nBUFFERS:FILES:VIDEORAMROWMX84COLMX86GBLCNT$GBLSIZE$DBASE33%s %*d %*1s %d %*sTABLE%s %*d %*1s %d %*sDATA%d %*1s %s%sEODTRUEFALSErw+a-1,0 %s EODTABLEVECTORSTUPLESLABELDATA-1,0 %s BOT1,0 %c%s%c 0,%s V FALSETRUE0,%d %s 1,0 %c%s%c %s %d,%d %c%s%c %c%s%c%c%s%c%s%c%c%c, %sNot enough memory CLOSED ALL dBMAN FILES. CONFIG.DBM*Not Enough MemoryExit dBMAN. Esc=exit ^S=save F6=menu Pg[^D,^U] Rec[UpAw,DnAw] Fld[^L=Lt,^R=Rt] Pan[^<-,^->]Esc=exit ^D=nxt ^U=prv ^->=Pan Rt ^<-=Pan Lt*** THE RECORD IS LOCKED **** Item Move: UpAw DnAw Select: Ret Exit: Esc , Top,Bottom,Record Number Enter record number : Cannot find the record !! aCan not open 'LOGFILE'Appending to 'LOGFILE'GLOBALX.GLOBALY.LOCALZ.LOCALVariable count :Record copied** DELETEDEnter structureCDLN.dbt.dbtRecord size :Bytes remaining :No. of fields : fieldname type width decimalRecord size :Number of records : File name : fieldname type width decimalFIELD_NAMEFIELD_TYPEFIELD_LENFIELD_DEC0Are you sure? (Y/N).DBBrbabAND /100 DOLLARSCDLNTtYy%s,%c,%d,%d%02d:%02d:%02d:%02d%02d:%02d:%02d0dbtemp1BUFF*OVFLO;Zx0Nm<[y1OnnH%d%*1s%d%*1s%d%1s%1s%1s%04u%02u%02u%4d%2d%2d%02u/%02u/%04u%02u/%02u/%02u%02u/%02u/%04u%02u/%02u/%02u%04u/%02u/%02u%02u/%02u/%02u%02u.%02u.%04u%02u.%02u.%02u%02u-%02u-%04u%02u-%02u-%02u%02u.%02u.%04u%02u.%02u.%02u%02d%02d%02d%02d%02d%02d%02d-%02d-%02d%s %d, %d%s %d, %d%02d %s %02d%02d %s %dAMPM%02d%02d%02d%02d:%02d:%02d%02d%02d%02d%02d%02d:%02d:%02d.%02d%02d:%02d%02d:%02d:%02d %s%02d:%02d %s - - - - . . . . / / / / JKLMNOPQRSTYZX.DATERRCan't open ERR.DATErr72 - System Message File Error%xZERO NOHUNDRED Move: UpAw DnAw LtAw RtAw or first char. Select: Ret Help: F10 Exit: Esc Move: UpAw DnAw LtAw RtAw or first char. Select: Ret Help: F10 Exit: Esc Memo.DATHELPNo error.DATERRHELPCan't open %d %dAPPROX=CONFIRM=CONSOLE=DELETED=ESCAPE=EXACT=SAFETY=TALK=UNIQUE=ERRCODE=DATE FORMAT=USERSTAT=GETNO=VER=INTXX=OPEN MODE=BREAK= DEFAULT(DBF/NDX/TXT/MEM/PRG/Sys/DXX) (LINE COUNT=MARGIN(Top/Bottom/Left) (PRINT() TRAP() LOGFILE(VIDEO(Say/Get/Erase) (DBF FILE ,,,NO FILE IN USE ^D to continueDBF FILE ,,,RELATIONS ,FIND/GOTO,FINDGOTO^D to continueON OFF Esc=quit Any=next memory TFYNTYFNXALU!#9NYXALU!#9NYXALU!#9NYTYFN) CR DB##/##/######/##/######/##/####/##/####.##.######.##.####-##-######-##-##File : Line : MSG:CMD: DoneFRecF7=Mem F8=Sta F9=Err F10=Cmd*bad col*scrn.txtaa^S=save ^Q=quit ^E=era ^I=ins DnAw=nxt UpAw=prvEsc=exit ^D=PgDn ^U=PgUp ^->=Pan Rt ^<-=Pan LtEsc=exit ^D=PgDn ^U=PgUp^S=save ^Q=quit ^N=nxt ^P=prv ^C=carryover^S=save ^Q=quit ^N=nxt ^P=prv ^D=del ^U=undelEsc=exit ^D=PgDn^S=save ^Q=quitEsc=exit ^S=Pause ^Q=Resume24.00L OP<#d  88888888888899 9999%9/999B9K9V9`9j9r9z999999999O9999999:: ::::::#:':+:/:3:7:?:H:N:T:X:]:b:i:s:{:OY.T_1Y.T_2Y.T_3Y.T_4Y.T_5ONE TWO THREE FOUR FIVE SIX SEVEN EIGHT NINE TEN ELEVEN TWELVE THIRTEEN FOURTEEN FIFTEEN SIXTEEN SEVENTEEN EIGHTEEN NINETEEN TWENTY THIRTY FORTY FIFTY SIXTY SEVENTY EIGHTY NINETY THOUSAND MILLION BILLION TRILLION SundayMondayTuesdayWednesdayThursdayFridaySaturdayJANFEBMARAPRMAYJUNJULAUGSEPOCTNOVDECJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember9999999999999999PxS4fU"0gqb7700q(5R@u"7dv7q@Q)'vf'0B%CWH@r6fB%Ty` PPP1AY&SX'((EEpyc&yHbSCBH%W)WyPE31b'.$KL 'KS +K] Kd ?Kk ;Kp XKw 3K~ K &K K K K >K K UK 4K K DK K FK EK [K ZK \K K K K ,L L ]L SL "L! L' L- %L3 =L8 6L= KLC 9LL LO LT LW IL^ CLb -Lh (Ln @Lt BLz L 8L L L RL L LL 1L L !L L YL <L +L +L WLJL VL JL M $M M 7M .M M& M. MM5 0M= HMC MJ QMN /MS 6MX M_ 2Mc TMh Mm Mr Mx M| PM NM GM OM M 5M M M )M AbMFM`MMuMMrM M M.MMM%NvN cNN NkN&XN- &N3dN9:NA4NI6NQ 4NWZN_<Ni Nn[Nr\Nv +Nz]N&N NNMN N NBN$NhNmN N)NRN SNKN %NO@O,O 0OPO>O$SO- O3(O= ODOINOP 6OUOXO[O^#OdYOnOq Ot!OwDO~OIOqOOOOsOOO^O8O"O#OtOOWOPOO O OO9OGOiObP -P (P;PxP BP#wP+lP/ 4P4=P9OP>+PC'PK*PR /PV /P]jPgzPm )Pu ,PyP~LPnPPP PVPPPPcPPPpPYP .PP +P +PJPUP VQQQ yQQ3Q! MQ(Q-2Q4 /Q9Q=aQHAQO?QSQ]HQc_QjgQoQyoQ Q)QfQQ QEQ -QCQTQ Q-QQ1Q~QeQ4QQQQ QGQQQR R ERDRFRR!R$KR(R+ R2 R9R< R@IRD"RGcRNRQ-RV 2R[ RbRe Rl RpRs 0Rz R~BR RR R R +R R R RR RLR3RR RJR%R R R RR R R (RS0SS 'S$S 5S";S& S. $S7S9 SC SMSR +S[]SdSgSjSm#Ss SyS| 1S S!SdS SSSS=SRSS "S !SPS5S %S S SXSS ,SSVSSTTT +T 4TT9T T" T):T- T3 T: TC &TI TN TSSTX T^*Tb /Tf /Tm )Tu T|)T`T_T T TT<T ,T/TT T T 7TTT^T@TYT .T T2T8T&T'TUU +UZU,U!U',U/ 6U9NUD6UM *US UYHU_Uc Uj Up Uz UMUUU UaU[U!UAU :U U U>UU U(U U U U 3U U ;V V V CV V 8V7V% 9V-bV51V< VD VK VP VY V^\Vb -Vf Vk Vr Vx VOVVV #VV4VV?VQV.VWVV ACCEPTALTERNATEAPPENDASSIGNBEEPBROWSECANCELCASECLEARCLOSECOMPARECONTINUECONVERTCOPYCOPYRECCOUNTCREATEDECDELETEDENYRWDENYWDESELECTDIRDISABLEDISPLAYDOEDITEJECTELSEENABLEENCRYPTENDCASEENDDOENDIFERASEEXITFINDFLUSHFORMFEEDGOGOTOIFIGNOREINCINDEXINPUTINT21INTXXJOINLISTLOCATELOOPMERGEMODIFYMODINDEXNOTEONOTHERWISEPACKPARAMETERSPAUSEPRINTPRINTERPRIVATEPROCEDUREPUBLICPURGEDIRQUITREADRECALLREINDEXRELEASERENAMEREPLACEREPORTRESTORERETRYRETURNRUNSAVESEEKSELECTSETSHOPSKIPSORTSTORESUMTEXTTOTALUNDENYUNINDEXUNLOCKUNPENDUPDATEUSEWAITZAPADDITIVEALIASALLAMERICANANDANSIASCEASCENDINGBELLBLANKBOTTOMBREAKBRITISHBUTTONCARRYCASECENTURYCHANGECLEARCOLORCOMMANDCONFIRMCONSOLECOUNTCURRENTDATABASESDATEDB2DB3DBFDECIMALSDEFAULTDELETEDDELIMITEDDELIMITERSDESCDESCENDINGDEVICEDIFDOHISTORYDOUBLEDXXECHOEMPTYENCRYPTENDTEXTERASEERRCODEESAYESCAPEEXACTEXCEPTEXCLUSIVEEXTENDEDFIELDFIELDNAMEFIELDSFILEFILTERFINDFJFKFLFLAGSFLDUPDATEFMFNFOFOOTERFORFORMFORMATFPFQFRFRENCHFROMFSFUNCTIONFXFYFZGERMANGETGETFILEGETNOGETSGOGOTOGROUPHEADINGHEADING2HELPHISTORYINDEXINPUTINTENSITYINTOINTXXITALIANKEYLEFTLIFOLIKELINELOGFILEMARGINMEMMEMORYMEMOWIDTHMENUSMESSAGENDXNEXTNOCLEARNOEJECTNOTOFFONOPENMODEORORDERPAGENOPATHPICTUREPIXELPLAINPMENUPRGPRIMARYPRINTPRINTERPROCEDUREPROTECTPUBLICRANDOMRANGERECORDRELATIONREPORTRESTSAFETYSAVESAYSCOREBOARDSCREENSDFSECONDARYSPOOLSTATUSSTEPSTRUCTURESUMMARYSYSTEMTALKTITLETOTOPTOPFORMTXTTYPEAHEADUNIQUEUPPERUSERUSINGVIDEOVIDEORAMVIEWVMENUWHILEWINDOWWITHABSAHALANDAPPROXARCCOSARCSINARCTANATAXBARBHBITCLRBITSETBLBOFBOXBPBUTTONBXBYTECDOWCENTERCHCHKKEYCHRCLCMONTHCOLCOSCTODCXDATEDAYDBFDELETEDDELRECDFLTDRVDHDIDISKSPACEDISPTYPEDLDOWDRAWLINEDSDTOCDTOKDUPCHARDXDXXEOFERRCMDERRCODEERRLINEERRORERRPRGESESCEXPEXTRACTEXTRACT2FFIELDSPECFIELDTYPEFILEFILENAMEFILESIZEFJFKFLFLAGSFLOCKFMFMENUFNFOFONTFOUNDFPFQFRFRACFRAMEFSGETENVGETNAMEGETNOHMENUIIFCIIFDIIFLIIFNININDEXNAMEINKEYINSETINTKEYSTROKESLASTKEYLASTRECLEFTLENLNLOCKLOCKRWLOGLOGINLOGOUTLONGYEARLOWERLPADLTOCLTONLTRIMMAXMEMMEMORYMESSAGEMIDSTRMINMMENUMODMODCHARMONTHNNATENDXNLISTNOTNRANGENTOLNTOTIMEORPAGENOPCOLPIPMENUPRGPRNFLGPRNTSTATPROWPTR1PTR2RANKREADKEYRECCOUNTRECEIVERECLENRECNORECSIZEREPLICATERESTSCREENRETRYCNTRIGHTRLOCKROUNDROWRTJUSTRTRIMSAMEMONTHSAMEWEEKSAVESCREENSCROLLSELECTEDSELFILESENDSISINSMENUSOUNDEXSPACESQRTSRCHSTATIONSTKSTRSTRPT1STRPT2STUFFSUBSTRSYSCALLSYSTEMTTANTIMETIMEADDTIMECNTTIMESUBTIMETONTOKENSTOMONEYTONAMETRAPTRAPFILETRIMTTSTXTTYPEUNLOCKUPPERUSERNAMEUSERSTATVALVERASEVERSIONVGETVMENUVSAYWAITCNTWINDOWWORDWOYYYEAR  *+,-./ !"#$%&':;<=>?()*+,-./01JKLMNO23456789:;Z[\]^_<=>?@ABCDEjklmnoFGHIJKLMNOz{|}~PQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy (&\ 6K98J* x|^DdFn ,  > p ` nd < t 0 h   &>  x.6B<LT\dnrvz~V".^vB &KL3 &K K  K  ,0l(LF:4F :4Fk  BKF X\LFk   L+r L*:rG Y   -`>$N:p FO ,:FO:FO:d   MNX$2<L BLFm;$ Fm# F dL$ Fm    L (U:AL Fo Fo Fo ML#FF%oF]o   -0 (^JV< +$q* p qF kFk \ P ,>TL9FkrF tL    L$':d:d(:d{ GMJ n FG $? 6<FFZSb .N,+M:*:$':G:iF:tG:t$':t jZSb M:tiF:F:FG F +M:*:!':G:iF] "L;] i GZP~M-:@ hxL$'&:@\:@Ffe h$?+LG  hG:F L!gF L"gF  L!g L 2:4* FfFG:NF Hj : B8"#: /L+ M :H:*:  +LG:s  L  +LG t  /L @.L  +:LG u \hx:h+H rM-:H*:Hv :  ZMFB VF:F:F: L + L*LFx]y &:L+ 4L*:Fx F ZL| F rK | FM-:~+~  Q:$'&:~:~*:~F:~}   "M:   :*:$':~  F hM : 0+ 0  Z `: <*: 0: ,z C  MB  $'  L;$'   M: +   : $'&: *: = <02  6 < F%  0 .LF? <@  N PL7  ZL% 7 G v vMJ4 G MJE1.6/ )F  @   %  &  "{ .| .} 4 U9  @   9UR: S:  ( 9F kF k 9 9 FG L jP d / j rLGF: F F A $'yF F  A  C /  FF k F F  LA   .L  L  * .LF  @ TLA  ^ bL  ^L F  | LA  L  L TF   5 MR ,  9Q: : FdGd  H MI , LJ F FG  6L  FL '  ~ ~R n= v LF: JG: J(: J  GF  M  8 " # :  : O P LF: F: F FL .8D"D#DAZ|L' |LPL .LF prLF!:^ OPLF:F FL 8"#ALL' FL F LF $ 4 B X nL 60)& +2,34%6B09GD'EZH^J|TYVNd[\^_axbxcx.x;x>xMCd]*hxfxgxixzxejkq~L  -NdL +-(%BSVL L RL:Fk )4L L  L9F:F:F:F  LkF:I LjL  L %F ,LID "L +N,^-f/n.v~L LF LF:RF:RF:RF:RF:RF:RFFL  LF D *LDWD  4LD 1L  G 0LGbM x(L   6P XbbLF:\F G tL M*F:F:F :x M L LJF L Fr  $*L!FFFF @L  +RAVLF F #nL zL LZX HLF L+ L*::      $' $L;$'  9   F F F F:b L+ L L ' FL* FL   IL#,G $p49<nFoN F[  +L[:[:[:[: F  pL,  p FL$:t:tF:t ,  F L! L;!L+ L*:Fw Fx FHMl+6 X:>*:6  nLFi G: G: F,  @L :@ Fkdbtmp1dbtmp2dbtmp3dbtmp4qsort failure !4.DBF.NDX.CMD.TXT.MEM.DIF.FRM ___________________________________________________________ | | | | | dBMAN - Version 4.00L Serial No. XXXXXX | | (C) Copyright 1986,1987 VersaSoft Corporation. | | | | for | | Atari ST | | | | VersaSoft Corporation | | 4340 Almaden Expwy Ste 250 | | San Jose, California, USA. | | | | | | Please read UPDATE.DOC | |___________________________________________________________|aCannot open %s0pAeOeUeaeoessue%d%u%ld Desk -------------------- Desk Accessory 1 Desk Accessory 2 Desk Accessory 3 Desk Accessory 4 Desk Accessory 5 Desk Accessory 6 ^Q=Quit ^S=Save ^E=EraLine ^->=LineEnd ^<-=LineBeg ^U=PgUp ^D=PgDn Edit: Abort Editing ? (Y/N)^Q=Quit ^S=Save ^E=EraLine ^->=LineEnd ^<-=LineBeg ^U=PgUp ^D=PgDn.dbt Bad pointer in free. Bad format in scanf {NULL}"F!"F!"F#}}~ You must compile with the -f option to include printf() floating point! ~CCAP????????????????????????0123456789ABCDEFUser abort at 00000000 L"20            ,H   &, < .  8   (   (      4  $$4       &"        0(  "      " D    $ $(  $.6 (&.dx8 * $&   (F  "          "  "   "       *  $   (P * h&8 .:4" "     "(  &  f64  6$                 $       $&.$"$$ $(.    0                      ,( &(  $      $                         ,    .,     &.DF6  ."L&     64,2  "   * 2 $   0( 4*,   *   "  *(4"(&   4 $ ,"  (  &&0H  "< d   B    " $ (4  $ ":"R    . &NX >2< "& ", f v0 .6 "&4:JB$  *6 \<0 ":     \. $,&,2  l    *    L 2 2  H    &    "     R&00 L " 0 $        F  $$  n     0N:R8&  ,      P>.P    : (     2          $   *4*" , 2    D&.&( ,R   < .$ $ ,xB L4&0 .   6           * :             JDl0   $                 &     &0 ` $6  $ 8 $J :,*& ,0&    ((F2 ,&"2"~ ,&"2"$8(,  "$ 4 $  6 ,z0 @"(,  ^(("  .& x0.            "  .@  &&   "   dF H$<  $  "        $     *@ $*4* 0                0nR,">~,4 4|* Z  H& "( 4 & :,&"    * 66 (          :BDB     $ (  X$"$(: 2 2 4 4 $N  B         ( *V  2(               &"      "D( "LL\0`: "x^0< "  0.FL0"R<4J $(>@T, 42 p*  &0 & *$&&& "&& Z<2&fH&@&"@ "  " **&,, @    &  $   ,R$ < "   $   ( $   "lF*F.R"L" " (    "   &         *    .4& :  2d  2^8.,   & ,& ,   0    * 8< , &$ * (4*"\ (&*$$$4   $@        ,&$668 "  0 $    ,.    &t    ,.0 >&   $ 0  2  ("$ 6&""" &.    $       ,$ (Hb $0b  "V     "  $            .  (j*     (  "  $,r.(    P "  (B >hZ,>4 "(        ,                :4,L 0 &    . ,0F "&    *  2 , (,t&.L2"&>\F  6v  >.2(6.  FTp&,0 NB@* $0  "<2   $ J",  X(&   *  "  $         & $         8D    L*  62                  .(&   $ ><:NH"2R8:"n ("p  :.6 ",   FR$.  ("( &.$<D2TXF (> ^$fFF00N& 4$D$, .&8lzF  H >.tHBL X:         (&        &   $. .  & " B     "   ("   .  & 6B   (               * &&0<0(  $&   n    & F $ &      $ & &"@ "T$* . `6 2>$.D4*> *.> *(4B"L $$ ($>80"$ ""::,$ 2&$,0$0((:@:d$& & :("$V0((6"& :$:r4.Jj2.20*,6&F40N(&($  0>0  FD80DR $(JF046",j2D$hNj(26.T8N&:Lf"6(dh :."$P<0&L&$26L @ J&. >4&*   b.,X.V>2*F>XX4*2:*  "@8^ (PR*VR * &6 @   2P 4 N(($"<jBJ B,jJB,JTN2 .`N B08..@t0 $$:xb&4"Ƭ"`P^j><*&     ( $& 0 &.J         (   .  "   $8 H<΀^NJ  `j 8& :0$HN4H8(<:><02(bB88 B$$F40"2D$ B.N$ jH^>` 2>    *  B>.<.*^DD8V.:L.0Lx*",  "   ",X( DD.&d"  *& dTPB*>4 T* (D*DTNX<   `<(( F   |"*&"zd&02""""""",0"L&$&0l$j     $,$d:* \.P4 (P$($ ,  .N ("(*0R,$ <@JzD .^  : 0" <.  ,H 6B  , $ 4      B" $00 &&8(.P&ZP"2  $  46 0 $" *.    44>(< &Z$ @6   & $,  $ **     4,>2 ",  $@("  "$$$T>&n$L,,*J .                h0j  @J$  $2$ .>` .NtjJ&vFP( LD   &>& (&"",p$  .6*" .J0.$nBF\ @$@(  .8*046  & 6& ,$ &(2> 00v   0$"$0DX:4>t   0 RD[d1+SsHELPC Commands - At the CMD: type a command and press F10. ? COMPARE DO FORMFEED MODIFY RECALL SET USE ?? CONTINUE EDIT GO MODINDEX REINDEX SHOP WAIT @ CONVERT EJECT IF NOTE RELEASE SKIP ZAP ACCEPT COPY ELSE IGNORE OTHERWISE RENAME SORT APPEND COPYREC ENDCASE INC PACK REPLACE STORE ASSIGN COUNT ENDDO INDEX PARAMETER REPORT SUM BEEP CREATE ENDIF INPUT PAUSE RESTORE TEXT BROWSE DEC ERASE JOIN PRINT RETRY TOTAL CANCEL DELETE EXIT LIST PRIVATE RETURN *UNDENY CASE *DENYRW FIND LOCATE PUBLIC RUN @UNINDEX CLEAR DIR *FLUSH LOOP QUIT SAVE @UNPEND CLOSE DISPLAY MERGE READ SELECT UPDATE For dBMAN Atari ST | * = Multi-User Only @ = Single-User Only ^D > General Info | ^U > Functions | Esc > CMD: ~100 104~ CREATE Create a new database file. The default file extension is ".DBF". FIELDNAME: 1..10 characters ( A..Z 0..9 _ : ) TYPE: 1 character ( C = Character, N = Numeric, D = Date, L = Logic ) WIDTH: 1..3 chars ( C = 1..254 N = 1..17 D = 8 L = 1 ) DECIMAL: 1..2 chars ( 0..15, Digits to right of the decimal ) ... move to next entry in the current FIELD DEFINITION ^N ... move to Next FIELD ^I ... Insert blank FIELD ^P ... move to Prior FIELD ^E ... Erase current FIELD ^S ... Save FILE and exit CREATE ^Q ... Quit CREATE without saving FILE See also MODIFY. ^D > MORE CREATE | ^U > CREATE REPORT | Esc > CMD: ~93 79~ DISPLAY [] [] [] [FOR ] [OFF] Display all records that satisfy the "" & "FOR" conditions in the file area (current or "Fi" ). "OFF" shuts off display of record numbers. If an "expList" is provided, only that information is displayed, otherwise all of the fields are displayed. dBMAN will display one window full of records and wait for one of these keys: ^... pan data display window right ^... pan data display window left ^U .. show prior data page (unless FOR phrase is used) ^D .. show next data page Esc ... exit DISPLAY command ^D > LIST | ^U > DISPLAY MEMORY/STRUCTURE/FILE | Esc > CMD: ~58 94~ APPEND (direct entry from keyboard) APPEND adds new records to a data base. ^N ... save & append Next blank ^P ... save & move to Prior record ^C ... Save & Carryover data to next ^S ... Save all records and exit APPEND ^Q ... Quit without saving current (appended) record Note: If you ^P to the prior record then ^N for next, dBMAN will append a new record - NOT return you to the record where you pressed the ^P. APPEND FROM [FOR ] Append all records (or selected by "FOR") in the "FROM" file to current file. FROM file can not be in use. See MORE APPEND for appending to open files. ^D > MORE APPEND | ^U > UNPEND | Esc > CMD: ~95 53~ SELECT [ | PRIMARY | SECONDARY | | ] Make one of the ten file IDs ("Fi" = FJ..FS) the current file ID. Its associated file becomes the current file. The initial "Fi" is FP. PRIMARY and SECONDARY are equivalent to "FP" and "FS" respectively. is the Alias name given to the file when the file was USEd. is the area letter A...J. SELECT (without an argument) resets the selected file ID to "FP". Most dBMAN file-reference commands allow the use of an optional "Fi" file ID so that operations which move the record pointer may be used without doing an explicit area SELECT command first. The commands which may require a prior SELECT are: APPEND, COPY, CREATE, EDIT, JOIN, MODIFY, PACK, SORT, UPDATE ^D > USE | Esc > CMD: ~6 0~ USE [] [ [INDEX ] [ALIAS ]] Close any open files in the current (or "Fi") file ID area & open the new DBF (and index files). If a file extension is not specified, ".DBF" and ".NDX" are assumed for the database (and index files). If the "INDEX" phrase is used, access to the DBF file is in the order determined by the first NDX file in the list. See also SET INDEX. Examples: USE Maillist | MAILLIST.DBF opened in current file ID area USE FQ Costs.BAK | COSTS.BAK opened in ID area "FQ" USE Inv INDEX Inv, Qty | open INV.DBF in current area with INV.NDX & | QTY.NDX indexes. INV is the "master NDX" If the ALIAS is given the file can be referenced by the rather than by SELECTing the work area. If no ALIAS is given the filename becomes the . ^D > CLOSE | ^U > REINDEX | Esc > CMD: ~7 57~ CLOSE [] [INDEX []] ] Close the DBF file (or NDX files) used in the current or "Fi" (FJ..FS) area. When the INDEX phrase is used, the index files listed are closed rather than the DBF file. Index files which are not listed will remain open. If the "master index" is on the list of indexes to close, the lowest numbered index remaining open becomes the new "master". Using "INDEX" without arguments will close all NDX files in the current (or "Fi") area. Examples: CLOSE FJ INDEX | Close all NDX files in file ID area FJ CLOSE INDEX Qty | Close only the QTY.NDX file in the current ID area CLOSE {ALL | ALTERNATE | DATABASES | FORMAT | PROCEDURE} CLOSE ALL & DATABASES | Closes all DBF & NDX files in all file IDs (FJ..FS) CLOSE ALTERNATE,FORMAT,PROCEDURE | Closes file opened with SET. See SET. ^D > SET | ^U > USE | Esc > CMD: ~52 6~ UPDATE FROM ON [RANDOM] Note: WITHList = WITH [, WITH ] ... etc. Update fields in the current DBF file using the "" expressions. Fields of the "FROM " file may be used in expressions by use of a "T." file ID prefix to the fieldname. The "FROM" file must be pre-sorted on the "ON ". The current DBF file must be sorted or indexed on the same . RANDOM searches the primary database using the of the FROM file. The primary file must be indexed on the . The FROM file can be in any order. Example: USE InvTotal | use the InvTotal file to be updated in the current area UPDATE FROM InvUpdt ON Part:No On:Hand WITH On:Hand + T.On:Hand,; Cost WITH T.Cost * 1.1 ^D > SORT | ^U > JOIN | Esc > CMD: ~14 20~ MODIFY STRUCTURE dBMAN saves the current file to a temporary file ($TEMP1) while the new structure is being defined from the keyboard. After the structure has been modified, the records from $TEMP1 are appended to the new file and $TEMP1 is deleted from the TOS file directory. Field data types may be changed. MODIFY FIELDNAME ... very fast, but only the fieldnames can be changed. ... move to next entry in the current FIELD DEFINITION ^N ... move to Next FIELD ^I ... Insert blank FIELD (Modify Structure only) ^P ... move to Prior FIELD ^E ... Erase current FIELD (Modify Structure only) ^S ... Save FILE and exit MODIFY ^Q ... Quit MODIFY without saving changes ^D > MODIFY REPORT | ^U > CREATE | Esc > CMD: ~79 2~ COPY [DELIMITED | DIF | SDF] TO [] [] [FOR ] [ADDITIVE] All undeleted records within the specified "" and "FOR" conditions are copied to "" in any of four formats: DBF (the default), DELIMITED, DIF (Data Interchange Format "Spread Sheets") or SDF (System Data Format "fixed length"). All fields (the default) or only fields specified by the "" are copied. The file extension default for DELIMITED and SDF files is ".TXT". ADDITIVE is for non .DBF files only. See also APPEND. COPY FILE TO Copy the contents of to . Any file type can be copied. There are no default file extensions or path names. ^D > COPY STRUCTURE | ^U > MODIFY | Esc > CMD: ~96 9~ QUIT Close all open files, terminate dBMAN, and return to TOS. All data will be saved. ^D > CANCEL | ^U > PAUSE | Esc > CMD: ~53 62~ EDIT [] Change data in the current record (or record "") of the currently selected DBF file from the keyboard. ........ clear current FIELD from cursor. ........ move down one FIELD ........ move down one FIELD ........ move up one FIELD ^N ... save & move to Next RECORD ^D ... Delete RECORD ^P ... save & move to Prior RECORD ^U ... Undelete RECORD ^S ... Save changes to RECORD and exit the EDIT command ^Q ... Quit EDIT without saving changes to current RECORD NOTE: Multi-User should have SET FLDUPDATE ON first. ^D > REPLACE | ^U > APPEND | Esc > CMD: ~13 4~ REPLACE [] [] WITHList [FOR ] Note: WITHList = WITH [, WITH ] ... etc. Replace information in the current record (or all records within the specified "" and "FOR" condition) for fields listed in the "WITHList" clause. The optional file ID ("Fi" = FJ..FS) and field ID prefixes ("J." .. "S.") allow replacements in unselected databases. ^D > UPDATE | ^U > EDIT | Esc > CMD: ~8 12~ SORT ON TO [{ASCE | ASCENDING} | {DESC | DESCENDING}] Sort on specified fields of the current file and put the sorted records into the new "TO" file. If a file name extension is not specified, dBMAN uses a ".DBF" extension. Sorting can be done in ASCENDING order (low value to high value) or in DESCENDING order. Fields are sorted in the standard ASCII character sequence and ASCENDING order is the default. The can be up to 7 fields and contain up to 128 characters. The can also be a field expression. Examples: SORT ON zip_code TO mailzip SORT ON last_name,acct_numb TO acct SORT ON $(last_name,1,5)+STR(acct_numb,5) TO acctnum ^D > JOIN | ^U > INDEX | Esc > CMD: ~20 47~ STORE TO Create one or more variables (contained in varList) and assign the value of the "" to them. If any of the variables already exist, they are assigned the new value. The type (N,C,L,D) is changed as required. STORE may also be used to assign values to fields in any open database. If the data type of the field is different than the "", a Syntax Error occurs. Use file ID prefixes ("J.".."S.") when the field is not in the currently selected area. You may also assign a value to a variable with the "=". For example: Today = DATE() Other dBMAN commands which create memory variables are: ACCEPT, COUNT, INPUT, SUM, RESTORE and WAIT. ^D > SAVE | ^U > RELEASE | Esc > CMD: ~49 48~ DELETE FILE Delete the named file from TOS directory. When no filename extension is specified, dBMAN assumes that ".DBF" is the file extension. Files that are in use can not be deleted. DELETE [] [] [FOR ] Mark the current record (or all records that satisfy the optional "" and "FOR" conditions) for deletion. Deleted records are not physically removed from the DBF file until a PACK command is executed. Deleted records are displayed with a "*" character following the record number; can be made "invisible" by SET DELETED ON; can be tested for by the DELREC() function; and can be undeleted with the RECALL command. see also: SET DELETED, EDIT ^D > RECALL | ^U > PACK - Remove Deleted records | Esc > CMD: ~18 67~ GO [] { | TOP | BOTTOM } GOTO [] { | TOP | BOTTOM } Move the record pointer in the current file (or in the file selected with the file ID "Fi" = FJ..FS). The record pointer can be moved to the record number given by "", or the record pointer can be moved to the first (TOP) or last (BOTTOM) record in the file. Note that TOP and BOTTOM are often NOT the first or last "physical" record if the file is indexed. see also: SET RELATION TO, FIND, LOCATE ^D > FIND | ^U > LOCATE | Esc > CMD: ~56 32~ RECALL [] [] [FOR ] Clear the "deleted mark" in the current record (or all records selected by the optional "" and "FOR" conditions) in the currently selected file area or in the area specified by the optional file ID ("Fi" = FJ..FS). Records that have been removed by the PACK command can not be recalled. ^D > PACK | ^U > DELETE | Esc > CMD: ~19 16~ PACK Physically remove all records in the current file ID which are marked as "deleted" records. They can not be RECALLed. Automatically REINDEX all open indexes Will PACK "in place" - deleted records will be over written. ^D > ZAP | ^U > RECALL | Esc > CMD: ~67 18~ JOIN TO FOR [] Create a new database "" from two currently open DBF files (one in area FJ..FR and the other in area FS). The new file structure is defined by the optional "" or combines all fields in both files. Each record in the currently selected DBF file (FJ..FR) is compared with EVERY record in the FS file according to the "FOR" expression. If the "" is true, a new record is appended to "" using "" fields from both source files. At least one field must be in common to both source DBF files. Example: SELECT | force current area to FP USE InvA | USE 1st file in FP USE FS InvB | USE 2nd file in FS 2nd file MUST be in FS JOIN TO NewInv FOR Price = S.Price,Item,Supplier,Cost See also: SET RELATION TO ^D > UPDATE | ^U > SORT | Esc > CMD: ~8 14~ SUM [] [] [TO ] [FOR ] SUM [] [TO ] [FOR ] Add the numeric values in the "" and store the total in the variables specified in the "". The expressions must yield a numeric result. The variables in the "" can also be a field name (in some other use area). The number of expressions in the "" must match the number of variables in the "". The default "" is ALL, but records can be selectively totaled by use of "" and "FOR" clauses. If the "Fi" file ID is specified, records in unselected DBF files can be summed. If the " TO " clause is omitted, the first five numeric fields are totaled and displayed to the "CMD:" mode user. ^D > COUNT | ^U > TOTAL | Esc > CMD: ~54 80~ IF | executed only if is TRUE [ELSE ] | executed only if is FALSE ENDIF The "" logic expression is evaluated for a TRUE or FALSE result. If it is TRUE, all commands between the "IF" and "ENDIF" (or optional "ELSE" command) are executed. If it is FALSE, all commands between the optional "ELSE" command and "ENDIF" command are executed. If there is no "ELSE" command, execution continues with the first line following the "ENDIF". ^D > ELSE | ^U > ENDIF | Esc > CMD: ~23 24~ [ ELSE ] [] Used in conjunction with the prior IF command. All commands between ELSE and ENDIF are executed when the "IF " is FALSE. ELSE is optional. Comments may be used following ELSE without the "|" comment character. (see also: NOTE for rules on use of comments) ^D > ENDIF | ^U > IF | Esc > CMD: ~24 22~ ENDIF [] Terminate the prior IF command. Every IF command MUST have a corresponding ENDIF command or misleading error messages may result. e.g. "ENDDO without matching DO WHILE" can result from a missing ENDIF command. Comments may be used following ENDIF without the "|" comment character. (see also: "NOTE" for rules on use of comments) ^D > IF | ^U > ELSE | Esc > CMD: ~22 23~ DO Execute the "" command file. The default file extension is ".PRG". see also: RETURN DO WHILE Execute all commands between DO WHILE and matching ENDDO while "" is TRUE. When "" is FALSE, execution continues after the ENDDO command. DO CASE Like IF...ELSE...ENDIF conditional command except DO CASE allows testing of many different conditions with selective execution of commands only for the first CASE which is TRUE. ^D > ENDDO | ^U > CASE | Esc > CMD: ~27 34~ RETURN [TO ] Return control to the previous command file at the line following the calling DO command. When the "TO " phrase is used, dBMAN returns to the specified file (if it was in the calling "DO " program chain. If the "" is not in the calling sequence, control returns to the first command file which was executed from the CMD: prompt. If the end of file in encountered dBMAN will assume a RETURN. RETURN MUST be the last command of any procedure - including the last procedure in the procedure file. See SET PROCEDURE. see also: DO, CANCEL, QUIT~~ ^D > CANCEL | ^U > DO | Esc > CMD: ~53 25~ ENDDO [] Syntax: DO WHILE [LOOP] | force evaluation of the [EXIT] | force exit from the DO WHILE ENDDO Termination of a DO WHILE loop. The "" is evaluated the first time the DO WHILE command is executed. If it is FALSE, execution continues at the next line following ENDDO. If it is TRUE, all commands following the DO WHILE are executed until a LOOP or ENDDO command is reached. Either of these cause the "" to be evaluated again. An EXIT command can be used to force the immediate unconditional termination of the DO WHILE from within the loop. ^D > LOOP | ^U > EXIT | Esc > CMD: ~29 63~ SKIP [] [] Move the record pointer forward or backward in the current file or the area specified by the optional file ID ("Fi" = FJ..FS). The record pointer moves forward if the "" is positive; backwards when negative. If no "" is specified, the record pointer advances one record. A SKIP beyond the TOP of file will set BOF() to TRUE; beyond the BOTTOM will set EOF() to TRUE. Other record pointer commands: GO / GOTO, LOCATE, FIND, SET RELATION ^D > GO | ^U > FIND | Esc > CMD: ~17 56~ LOOP [] Used inside a command file DO WHILE ... ENDDO loop to force the immediate re-evaluation of the prior DO WHILE "" (as specified by the ""). When the is not specified, dBMAN loops back to the prior DO WHILE. DO WHILE DO WHILE LOOP | re-evaluate LOOP 2 | exit inner loop & re-evaluate ENDDO ENDDO ^D > EXIT | ^U > ENDDO | Esc > CMD: ~63 27~ RENAME TO Change the old file name to a new file name in the TOS directory. The default file name extensions are ".DBF" if no extensions are specified. ^D > COPY | ^U > DELETE FILE | Esc > CMD: ~10 16~ COMPARE TO [] Perform a comparison of all records in the currently selected DBF file with another specified database file. If a "" is specified, fields which are not in the list are ignored. COMPARE is for use at the CMD: prompt or for programmed applications which can not continue normal processing if the files do not compare correctly. Esc > CMD: ~0 0~ LOCATE [] [] [FOR ] Examine all records according to the optional "" and "FOR" conditions until a record matching the "FOR " is found. That record becomes the current record. If the "" is large enough (ALL, NEXT 65000, REST, etc) and a matching record is not found, the EOF() flag is set to TRUE. To locate the next record that satisfies the "FOR" expression, use CONTINUE. LOCATE saves the "FOR" expression and "" independently for each open file. i.e. CONTINUE can move each file record pointer independently. LOCATE with no "" and "FOR" arguments moves the record pointer to record 1. ^D > CONTINUE | ^U > FIND | Esc > CMD: ~33 56~ CONTINUE [] Used in conjunction with the LOCATE command. CONTINUE moves the record pointer of the specified file to the next record satisfying the LOCATE expression associated with that file. A LOCATE command must be executed before using CONTINUE or an error message will result. ^D > FIND | ^U > LOCATE | Esc > CMD: ~56 32~ CASE Select one of several possible choices, based on the result of the "" expression associated with each CASE. Only those commands between the first CASE that is TRUE and the following CASE, OTHERWISE or ENDCASE are executed. DO CASE CASE | Execute if is TRUE CASE | Execute if is TRUE [OTHERWISE Execute if every CASE is FALSE ] ENDCASE ^D > OTHERWISE | ^U > ENDCASE | Esc > CMD: ~35 36~ [OTHERWISE []] An optional command used with the DO CASE..ENDCASE commands. The commands between OTHERWISE and ENDCASE are executed when all the prior CASEs are FALSE. Use of the OTHERWISE command without a DO CASE command is invalid. DO CASE CASE CASE [OTHERWISE Execute only if every CASE is FALSE ] ENDCASE ^D > ENDCASE | ^U > CASE | Esc > CMD: ~36 34~ ENDCASE [] Every DO CASE command must be terminated by a corresponding ENDCASE. Comments may be used following ENDCASE without the "|" comment character. see also: NOTE for rules on use of comments DO CASE CASE CASE [OTHERWISE ] ENDCASE ^D > CASE | ^U > OTHERWISE | Esc > CMD: ~34 35~ @ [{SAY | ESAY} [PICTURE ]] [GET [PICTURE ] [RANGE ,] [GETFILE [CHANGE] [MESSAGE ]] = where "x" = line number 0..24, "y" = column number 0..79 SAY displays the result of the expression using the optional "PICTURE" format at "". ESAY erases the line from "" to the end of line before the "" data is displayed. Both use the VSAY() video attributes. GET will display the variable or field specified. When a READ command is issued, the cursor will go to the GET and allow data entry. GET can not be used to create a new variable or change its data type. PICTURE Formats: Char Data { U L X A 9 # ! } Num Data { S # 9 $ * , . } RANGE will not let the user proceed if the value entered is not in RANGE. ^D > MORE @ | ^U > CLEAR GETS | Esc > CMD: ~97 40~ READ [NO CLEAR | SAVE] [GETNO ] Used in a command file to read user input from the screen. You create input prompts and screen displays by using @ SAY and GET. The READ command can be used to get user data for up to 64 GETs. READ automatically CLEARs all GETs. Using the NO CLEAR or SAVE GETs are not cleared. Using the GETNO, the READ will place the cursor in the field. Example: STORE SPACE(20) TO Var1,Var2 | initialize variables @ 3,0 SAY "First Name: " GET Var1 | write prompts & @ 4,0 SAY "Last Name: " GET Var2 | variables to screen READ | get user input See also @. ^D > CLEAR | ^U > @ | Esc > CMD: ~40 37~ ERASE [] The ERASE command clears the display in the data window. The coordinates associated with the "@" command ( ROW() and COL() ) are reset to 0, 0. ERASE will delete the file from the TOS directory. See also DELETE FILE ^D > CLEAR | ^U > DELETE FILE | Esc > CMD: ~40 16~ CLEAR [ALL | GET | GETS | MEMORY] ALL - clears the screen, closes all open data bases, selects file ID "P", releases ALL memory variables, resets screen coordinates to (0,0), and clears any pending GETs. Use to reset dBMAN to know starting point. GET | GETS - Clear all of the previously issued GET commands. Each time a READ command is executed, data may be entered into all open GETs. When the READ is exited, the GETs are automatically CLEARed unless the optional NO CLEAR or SAVE commands are used. A READ followed by a CLEAR GETS is simply redundant. MEMORY - release all memory variables. ^D > CLOSE | ^U > SAVE | Esc > CMD: ~7 49~ ACCEPT { [""] [TO [PICTURE ]] } Read a character string from the keyboard into the named variable or field- name. If "" is not a field (and no variable with that name exists) a new variable is created automatically. The "TO " is always a character data type. The optional "PICTURE" clause allows programmed control of data entry in the same way that "@ GET" does. The optional "" is displayed as a user prompt at the start of the next line. The "TO " is entered at the current cursor location and may be used with the @ SAY command. You can also test the key pressed with the LASTKEY() function. ^D > INPUT | ^U > WAIT | Esc > CMD: ~42 43~ INPUT { [""] [TO ] } Read any type of data from the keyboard and store it in the "TO ". Date, Logic and Numeric data may be entered directly. Character type data must be surrounded by quotation marks or square brackets ([ ]). Date type data may be entered using curly braces (e.g. {1/14/85} ). Logic type data is entered with the characters T, F, Y or N. The "string" is displayed as a user prompt. The "TO " can be a fieldname or variable. The variable will be created if it does not already exist. An existing variable data type can be changed simply by entering a new type from the keyboard in response to the INPUT command. You can also test the key pressed with the LASTKEY() function. ^D > WAIT | ^U > ACCEPT | Esc > CMD: ~43 41~ WAIT [""] [TO ] Command file execution to wait until any key is pressed. The key can be stored in the "TO " variable as a character data type. If the "TO " does not exist, the WAIT command will create it. If the optional "" is specified, it will be displayed as a prompt on the next line (if called within a program) or on the "MSG:" line (if called from dBMAN "CMD:" mode.) You can also test the key pressed with the LASTKEY() function. ^D > ACCEPT | ^U > INPUT | Esc > CMD: ~41 42~ ? [ [PICTURE ]] [,ESC()] The "" is evaluated and displayed on the next line. (A CR/LF is issued before displaying the result.) The display location is the line following the current cursor position. The "" and "ESC()" phrases may be repeated but must be separated by commas. The PICTURE phrase may be used to format the output using the same "" characters as the @ SAY and ACCEPT commands. The "ESC" phrase is used to send a string of control codes to the printer. ESC() does not display these codes on the screen. Non-printable codes must be enclosed in angle brackets "<", ">". e.g. ESC("<27>D<0>") will send the byte sequence 27, 68, 00 to the printer. ESC does not increment the ROW() or COL() - as opposed to CHR() which does. Use SET PRINT ON command to output to the printer. SET CONSOLE OFF to suppress output to the data window. ^D > ?? | ^U > SET | Esc > CMD: ~60 52~ PRINT [,] Print an image of the data window to the printer. This is used for printing data displayed on the screen with the @ SAY and ? commands. Print is from to (when these are specified) or from line 1 to the last line previously written to by @ SAY or ?/?? commands. must be 0..18 with SET TALK ON; 0..24 with SET TALK OFF. see also: SET FOOTER, SET HEADING, SET LINE COUNT, SET PRINT ^D > EJECT | ^U > FORMFEED | Esc > CMD: ~46 59~ EJECT Send a page eject (Form Feed code) to the printer. Set the values of the dBMAN internal line and column counters to zero. see also: SET FOOTER, SET HEADING, SET LINE COUNT, SET PRINT ^D > FORMFEED | ^U > PRINT | Esc > CMD: ~59 45~ INDEX [] ON TO [{ASCE | ASCENDING} | {DESC | DESCENDING}] [EMPTY] [LIFO] Create an index "" for the current database file or the DBF file specified by the optional "Fi" file ID phrase. The components of the index key "" must be of the same data type. The key can contain up to 8 fields and up to 128 characters. EMPTY - creates an empty index file for use with the MODINDEX command. LIFO - If several records have the same key the last record entered will be the first record returned. This is not necessarily in record number order for if you change a key that record will become the last key entered. FIFO is the default. see also: CLEAR, SET INDEX TO, SET SAFETY, MODINDEX ^D > REINDEX | ^U > CLOSE | Esc > CMD: ~57 7~ RELEASE [] Memory variables are deleted explicitly (by the "") or in groups. If RELEASE is used without a "Fm" memory area phrase (FX, FY or FZ) then the GLOBAL memory variables are deleted. FY memory variables are released when execution returns to the calling (or any higher) program. RELEASE FZ ALL will release all of the calling programs FY variables. RELEASE [] ALL [LIKE | EXCEPT ] All memory variables are deleted or only those that are LIKE or no like (EXCEPT) the . Wild cards are * and ?. Example: RELEASE FX ALL LIKE ABC* see also: CLEAR, STORE, SAVE, RESTORE ^D > CLEAR | ^U > STORE | Esc > CMD: ~40 15~ SAVE [] TO [ALL {LIKE | EXCEPT} ] Store all global, or those LIKE or not like (EXCEPT) the , memory variables to the specified "" file. When is specifies all variables from FX global or FY local of FZ local are stored. dBMAN assigns a filename extension of ".MEM" when one is not specified by the user or program. Note: A special file ($MEM.MEM) is used by dBMAN to retain local "Y." variables for programs which call subprograms two or more levels deep. ^D > RESTORE | ^U > STORE | Esc > CMD: ~50 15~ RESTORE [] FROM [ADDITIVE] Read the "" of memory variables previously saved with the SAVE command and place them all into the memory area specified. The default area is GLOBAL memory. If you specify "Fm" (FX, FY or FZ), the memory variables are restored to that area rather than to the GLOBAL area. Note: Before memory variables are restored, ALL existing variables are released in the memory area selected by the RESTORE unless you use the ADDITIVE phrase. ^D > SAVE | ^U > STORE | Esc > CMD: ~49 15~ NOTE [] * [] | [] The NOTE and "*" commands allow comment lines in a program ".PRG" file. The comment "" can consist of any ASCII printing characters. The entire line following the "NOTE", "*" or "|" is dedicated to comments. The "|" character may be used anywhere in a command line to indicate that the remainder of the line is comments only. When the "|" character occurs within a quoted character string, the character is treated as normal text. Note: DO NOT use "|" following the ";" line continuation character. In fact nothing may follow the ";". Esc > CMD: ~0 0~ SET Switches: SET ALTERNATE [on | OFF | TO []] SET BOTTOM MARGIN TO SET BREAK {on | OFF | TO [,]} SET CENTURY {on | OFF} SET CONFIRM {on | OFF} SET CONSOLE {ON | off} SET DATE {AMERICAN | ANSI | BRITISH | ITALIAN | FRENCH | GERMAN | TO } SET DB3 {on | OFF} SET DECIMALS TO SET DEFAULT [DBF | NDX | TXT | MEM | CMD | SYSTEM | DXX] TO [] SET DELETED {on | OFF} SET DELIMITERS {on | OFF | TO [] [DEFAULT]} SET DEVICE TO {print | SCREEN} SET ERRCODE TO ^D > SET page 2 | Esc > CMD: ~98 0~ CANCEL Terminate the execution of a "DO" program file. Return dBMAN to the interactive keyboard "CMD:" mode. Note: CANCEL in the run time is the same as QUIT. ^D > PAUSE | ^U > QUIT | Esc > CMD: ~62 11~ COUNT [] [] [FOR ] [TO ] Count the number of records (qualified by the optional "" and "FOR" conditions) in the current file (or the DBF file specified by the "Fi" file ID). The result is stored in the variable specified by the optional "TO" phrase. If no is give the result is displayed on the screen. ^D > SUM | Esc > CMD: ~21 0~ UNPEND [] Physically remove the last record of the current file, or from the file specified by the optional file ID ("Fi" = FJ..FS). This allows fast removal of unwanted blank records from the end of the file and is much faster than DELETE and PACK for such removal. Note: Not supported in the Multi-User version. ^D > APPEND | Esc > CMD: ~4 0~ FIND/SEEK [] FIND and SEEK work the same. Search for the first index key matching the "" in the current DBF file using the "master" INDEX file. If no matching records are found, then EOF() is set to TRUE and the record pointer is set to one greater than the number of records in the file. Use of the optional "Fi" phrase permits FINDs in all unselected DBF areas. Note: The first index file in the USE command or the latest index file in a SET INDEX TO command is the "master index". See also: SET INDEX, ASSIGN APPROX() ^D > LOCATE | ^U > USE | Esc > CMD: ~32 6~ REINDEX [] Rebuild all index files used with the current DBF file. The optional "Fi" file ID (FJ..FS) permits reindexing files in unselected DBF areas. see also: SET INDEX TO ^D > USE | ^U > INDEX | Esc > CMD: ~6 47~ LIST [] [] [] [FOR ] [OFF] [TO PRINT] List all records that satisfy the "" and "FOR" condition in the specified file. The OFF option shuts off display of record numbers. LIST [] MEMORY [TO PRINT] List the GLOBAL (or selected "Fm" = FX, FY or FZ) memory variables and contents. The ^A7 key in debug or command mode will also display memory. LIST [] STRUCTURE [TO PRINT] List the record structure (fieldname,type,width,decimal) of the DBF file. LIST FILE [] List files in TOS directory according to . "*.DBF" is default. ^D > DISPLAY MEMORY/STRUCTURE/FILE | ^U > DISPLAY Records | Esc > CMD: ~94 3~ FORMFEED Issue carriage returns until the line count equals the sum of the current TOP MARGIN, BOTTOM MARGIN and LINE COUNT settings. And reset the internal counters to 0. see also: SET LINE COUNT, SET PRINT TO, SET TOPFORM ^D > PRINT | ^U > EJECT | Esc > CMD: ~45 46~ ?? [ [PICTURE ]] [,ESC()] Identical to the "?" print command except no CR/LF sequence is output before the print expressions and/or ESC() codes are sent to the screen and/or the selected printer device. ^D > @ SAY | ^U > "?" | Esc > CMD: ~37 44~ BEEP Output a brief "beep" sound. Esc > CMD: ~0 0~ PAUSE Suspend execution of the command file on the next command. PAUSE is used for program debugging. When command file execution is paused, you can display variables with the ^A7 keys, display environment switches and files with the ^A8 keys, edit and save program line changes with the ^AA keys, delete the program lines with the ^AC keys, insert additional command lines with the ^AD keys, execute any dBMAN command or execute another PRG file. ^K ... KILL program execution ^L ... reLoad the line (unparsed) from the PRG file ^U ... Resume normal execution ^T ... execute the current program line (single sTep) See also: SET BREAK ^D > QUIT | ^U > CANCEL | Esc > CMD: ~11 53~ EXIT [] Used inside a DO WHILE...ENDDO loop (or "nested" loops) in a command file. EXIT unconditionally terminates the DO WHILE loop and execution resumes on the command following the ENDDO statement. When is specified, dBMAN unconditionally exits out of the Nth level of DO WHILE nesting. Note: EXIT will not exit a DO WHILE in a calling program. Note: When EXIT is executed within a trapfile, the effect is the same as if it was executed in place of the command which invoked the error trap. ^D > ENDDO | ^U > LOOP | Esc > CMD: ~27 29~ CONVERT TO Convert a dBASE II or III DBF file to dBMAN DBF file. "" is the dBASE database file name and "" is the dBMAN file name. When a file is specified without an extension, dBMAN will assume the extension is ".DBF". If both file names are the same, dBMAN will rename the dBASE file using a ".DBB" file name extension. Note: If you have a dBASE III file you do not need to CONVERT it. Just USE the file and dBMAN will read and write to it. ^D > CREATE | ^U > COPY | Esc > CMD: ~2 10~ ASSIGN Execute any dBMAN function where output to the screen, printer, a variable or a DBF field is not required. Example: ASSIGN SELFILE(Y.PATH,Y.FILE_NAME) ASSIGN TRAP(T), TRAPFILE("MYTRAP") ASSIGN APPROX(T) ASSIGN DX(55),AX(5) ^D > Functions | Esc > CMD: ~104 0~ INT21 Not Available for dBMAN - Atari ST. ^D > ASSIGN | ^U > Functions | Esc > CMD: ~65 104~ ZAP [] Equivalent to DELETE ALL and PACK. Eliminates all records from the current DBF file or the file in the specified file ID (FJ..FS). NOTE: All unused file space is NOT returned to the TOS directory. ^D > DELETE | ^U > PACK | Esc > CMD: ~16 19~ INTXX Not available for dBMAN - Atari ST ^D > ASSIGN | ^U > Functions | Esc > CMD: ~65 104~ INC Increment all numeric variables in the "" by one. ^D > DEC | Esc > CMD: ~70 0~ DEC Decrement all numeric variables in the " by one. ^D > INC | Esc > CMD: ~69 0~ DENYW NOT SUPPORTED AT THIS TIME ^D > DENYRW | ^U > UNDENY | Esc > CMD: ~72 73~ DENYRW (Multi-User Only) Note: FiRecList = and/or / list ( = record number) Places an exclusive lock on the files and/or records. Other users are denied both read and write privileges. If a DENYRW is placed on the current record, the current record buffer is updated from the disk. ERRCODE() will be set to 92 if the lock request fails. dBMAN will make RETRYCNT() lock attempts with WAITCNT() duration between attempts before the "file locked" status is returned. The default is 5 for both RETRYCNT() and WAITCNT(). Set the CNT() values to minimize the occurrence of error 92 for your paticuler network, network traffic, and application priorities. Note: Novell version; TIMECNT() is used instead of WAITCNT() to allow the file server to control the time between lock attempts. The default is 5. ^D > UNDENY | ^U > RLOCK() | Esc > CMD: See also RLOCK() Function. ~73 113~ UNDENY (Multi-User Only) Note: FiRecList = and/or / list ( = record number) Unlocks all records and/or files included in the . The current record buffer is written to disk. All records and files which are locked must be unlocked. All locks are released when you QUIT. Note: If you are using a expression to point to the locked record make sure that you are pointing to the same record to unlock it. Otherwise the operating systems lock table could be filled causing an error. ^D > SET FLDUPDATE | ^U > DENYRW | Esc > CMD: ~99 72~ RETRY This command must be executed within a trapfile; otherwise an error 96 is posted. RETRY forces the command which caused a trappable error to be re-executed. Note: There are only three approved ways to exit a trap file: RETRY, IGNORE, and RETURN TO . Any other command such as RETURN or EXIT may cause an error 63 INSTACK POPPING. ^D > IGNORE | Esc > CMD: ~75 0~ IGNORE This command must be executed within a trapfile; otherwise an error 96 is posted. IGNORE forces the command which caused a trappable error to be ignored and the following instruction to be executed. Note: There are only three approved ways to exit a trap file: RETRY, IGNORE, and RETURN TO . Any other command such as RETURN or EXIT may cause an error 63 INSTACK POPPING. ^D > RETRY | Esc > CMD: ~74 0~ PURGEDIR (Novell only) Not available for dBMAN - Atari ST. ^D > DISPLAY FILE | ^U > DELETE FILE | Esc > CMD: ~94 ~16 FLUSH (Multi-User Only) Note: FiList = [,] ... etc. Forces the current record buffer of any file included in the to be written to disk. No records or files are unlocked by FLUSH. Note: Modified (dirty) record buffers are also written to disk by: 1. Moving the current record pointer 2. Use of UNDENY on the current record 3. The CLEAR command 4. The CLOSE command 5. The QUIT command Esc > CMD: ~0 0~ MODINDEX [] [] TO [FOR ] ADDITIVE Used to selectively update a partial index for the current (or ) database. All records which satisfy the optional "" and "FOR" clauses are added to the index. The index to be updated must not be in use. Example: USE MyFile INDEX ON state TO TempIndx EMPTY | Create Empty index MODINDEX ALL TO TempIndx FOR Paid ADDITIVE SET INDEX TO TempIndx LIST ALL | dBMAN lists only paid records ^D > SET FILTER | ^U > INDEX | Esc > CMD: ~52 47~ REPORT [] FORM [] [FOR ] [HEADING ] [SUMMARY] [TO PRINT] Print the report form for all records that satisfy the "" & "FOR" conditions in the file area (current or "Fi" ). You may change the HEADING by including a new . SUMMARY will print a summary report if a GROUP ON has been defined. TO PRINT will print the report on the printer otherwise REPORT will go to the screen. Note: HEADING over rides any heading defined in the report and any heading in the SET HEADING TO. SET HEADING TO also over rides any heading defined in the report. ^D > MODIFY REPORT | ^U > CREATE REPORT | Esc > CMD: ~9 2~ TOTAL [] ON TO [] [FOR ] [FIELDS ] [ADDITIVE] Creates a new file with records (limited by the SCOPE and FOR) which contain the sums of all numeric fields (or numeric fields in ) which have the same value as . Numeric field widths are automatically increased to ten unless the ADDITIVE phrase is used. The group specified by ON is an expression and can contain several fields. Note: The new file will have the same number of fields as the source file. Note: The file to be totaled should be indexed or sorted on the . ^D > SUM | ^U > UPDATE | Esc > CMD: ~21 8~ UNINDEX [] (Single User Only) Remove the record from the index and moves the record pointer to EOF(). ^D > MODINDEX | ^U > INDEX | Esc > CMD: ~78 47~ TEXT ENDTEXT This command outputs all the text lines between the TEXT keyword and the ENDTEXT keyword to the screen or the printer. ^D > ?/?? | ^U > @ SAY | Esc > CMD: ~44 37~ RUN RUN executes any TOS commands or any exicutable files and returns to dBMAN after the program execution is complete. Note: You must have enough remaining memory to run the new command because dBMAN remains resident in memory. Example: RUN edit myfile.c Esc > CMD: ~0 0~ MERGE [] FROM TO [] [FOR ] [DELIMITED ,] This command copies the text of the skeleton or FROM which contains dBMAN expressions enclosed in the delimiters start "<" and end ">" to the TO , replacing the delimiters and expressions with the result of the expression. Text is append for each record specified with the scope and FOR phrases. The default scope is the current record only. If your skeleton file uses on of the delimiters you may specify another with the DELIMITED phrase. Esc > CMD: ~0 0~ ENCRYPT [] To encrypt an already existing data file and any open indexes. To ENCRYPT an already existing data file you must first LOGIN() to the password table, SET ENCRYPT ON, USE the file and any indexes. Then you may ENCRYPT. To encrypt a new file simply LOGIN() and SET ENCRYPT ON then you may CREATE and the file will be encrypted. See the Security section of the manual. Esc > CMD: ~0 0~ SHOP [] [] [FOR ] ,,, Displays the records of the specified data base file and allows the user to select a record. The SHOP command is very useful to find cryptic data like a part number from a more descriptive field. , are headings placed above the data with a line between. is the field, field list or field expression, to be displayed. is the picture used to display the . Note: ,,, are all required even if you do not need one. you may use "" (null string) for no headings or picture. ^D > DISPLAY | ^U >LIST | Esc > CMD: ~3 58~ COPYREC [] TO Copies the contents of the source to the current record of the target . COPYREC only copies the matching fields. Example: USE FP inv USE FJ order GO FP 3 GO FJ 4 COPYREC FP TO FJ | all matching fields are copied from FP record 3 to * FJ record 4 ^D > APPEND RECORD | ^U > COPY | Esc > CMD: ~95 10~ PUBLIC To share values of memory variables used in different programs. If a variable is declared PUBLIC the variable is available in all programs and can be changed in any program. If the variable is changed the new value will be seen in all the other programs. ^D > PRIVATE | ^U > STORE | Esc > CMD:89~ 15~ PRIVATE ALL [{LIKE | EXCEPT} ] PRIVATE PRIVATE declares memory variables either ALL, LIKE or EXCEPT, on in the list as a local variable and cannot be accessed from another program. The variable is automatically released then the program ends. ^D > PUBLIC | ^U > STORE | Esc > CMD:88~ 15~ BROWSE [] [] [FOR ] [FIELDS ] Allows full page editing of the specified file limited by the scope and FOR phrase. Displays all the fields or those specified by the . Keys: ^R & Move field right ^U Move up one page ^L Move field left ^D Move down one page Move up one record ^ Pan the screen right Move down one record ^ Pan the screen left ^S Save - Saves all changes, terminates BROWSE. ^Q Quit - Terminates BROWSE. Does not save changes to the current record. - Display menu to move cursor to the TOP, BOTTOM, or specific RECORD. ^D > DISPLAY | ^U > SHOP | Esc > CMD: ~3 86~ PARAMETERS To declare variable names for the parameters which are passed from the calling program. PARAMETERS is used in conjunction with the DO WITH . The parameters in the calling program get assigned the variable names from the . Example: DO saymsg WITH "Error bad entry." *saymsg.prg PARAMETERS Msg @ 24,00 SAY CENTER(MSG,80) RETURN ^D > STORE | ^U > DO | Esc > CMD: ~15 25~ DIR Displays a listing of the data files in the current TOS directory. If the is used any file may be seen. The uses the standard TOS file and wild card system. ^D > DISPLAY FILE | ^U > DELETE FILE | Esc > CMD: ~94 16~ CREATE FROM Creates a new data file from an extended structure data file. CREATE STRUCTURE TO MIKE DBF? Creates a empty extended structure data file. See also COPY STRUCTURE EXTENDED. ^D > MODIFY | ^U > CREATE | Esc > CMD: ~9 2~ DISPLAY [] MEMORY Display variable names and contents for Global (the default area) or "Fm" (FX, FY, FZ) memory area. DISPLAY [] STRUCTURE Display the structure of the file used in area "Fi" (FJ..FS) or in the current area. Information displayed includes: FieldName, Type, Width, Decimal, Record Size, and Number of Fields. DISPLAY FILE [] Display the file names in the TOS directory which match the optional "". The may contain: path, wild-card characters ("*" and "?") and file extension. "*.DBF" is the default "". ^D > LIST | ^U > DISPLAY | Esc > CMD: ~58 3~ APPEND { DELIMITED | DIF | SDF } FROM Append all records in DELIMITED (comma delimited, quoted fields) or DIF (Data Interchange Format) or SDF (System Data Format "fixed length") files. APPEND [Fi] BLANK Append a empty record to end of the current or "Fi" (FJ..FS) area file. APPEND [] RECORD TO Append the current record in the selected or file to . APPEND [] [scope] TO [FOR ] Append records (just like APPEND FROM) except both files are open. ^D > EDIT | ^U > APPEND | Esc > CMD: ~12 4~ COPY STRUCTURE TO [] The structure of all (or "") fields is copied to "". COPY [] STRUCTURE EXTENDED TO Creates a extended structure data file. Where each field is an record in the new data file. The extended structure looks like: fieldname type width decimal FIELD_NAME C 10 FIELD_TYPE C 1 FIELD_LEN N 3 FIELD_DEC N 3 See also CREATE STRUCTURE, CREATE FROM. ^D > CREATE STRUCTURE | ^U > COPY | Esc > CMD: ~93 10~ @ [{SAY | ESAY} [PICTURE ]] [GET [PICTURE ] [RANGE ,] [GETFILE [CHANGE] [MESSAGE ]] GETFILE - program is run when the user exits the GET field during a READ. If the CHANGE is used and user has changed the data the program is run. See also USERSTAT(). MESSAGE is displayed a the coordinate specified by the SET MESSAGE FIELD. @ ERASE Erases the display to the right of and below the "" position. @ [CLEAR] TO [DOUBLE] Draws a box or vertical or horizontal line. CLEAR erases box and contents. DOUBLE in ignored. ^D > READ | ^U > @ SAY | Esc > CMD: ~38 37~ SET Switches Page 2: SET ESCAPE {ON | off} SET EXACT {on | OFF} SET [] FILTER TO [] *SET FLDUPDATE {on | OFF} SET FOOTER TO [] SET FORMAT TO [] SET {HEADING | HEADING2} TO [] SET [] INDEX TO [ | ] SET [LEFT] MARGIN TO SET LINE COUNT TO SET LOGFILE TO [] SET MESSAGE {TO [] | FIELD TO ,,} SET OPENMODE TO ^D > SET Switches Page 3 | ^U > SET Switches Page 1 | Esc > CMD: ~99 52~ SET Switches Page 3: SET PAGENO TO SET PATH TO [] SET PRINT {on | OFF} SET {PRINT | PRINTER} TO {1 | 2 | 3 | | LPT1 | LST | PRN} SET PROCEDURE TO [] SET RELATION TO {FIND | GOTO | GO} SET RELATION TO [ | RECNO() | INTO SET SAFETY {ON | off} SET {SAY | GET | ERASE} VIDEO TO SET TALK {ON | off} SET TOP MARGIN TO SET TOPFORM SET UNIQUE {on | OFF} ^D > SET Switches Page 1 | ^U > SET Switches Page 2 | Esc > CMD: ~52 98~ dBMAN Editing and CMD Mode Keys: .. execute CMD: or move to next field ... erase CMD: or field from cursor to end ... Toggle Insert / Overstrike Mode ... move cursor right ... move cursor left ... delete character BkSp .. delete character left of cursor ^L .... reload command F1 ... replace line in active PRG file F7 .... display memory F2 ... insert line in active PRG file F8 .... display status F3 ... delete line in active PRG file F9 .... display error F9 ... append line to fileTXT LOGFILE F10 ... display command F10 ... append screen image to SCRN.TXT ^D > Syntax Definitions | ^U > FUNCTIONS | Esc > CMD: ~101 104~ Key to dBMAN Syntax Definitions: < > = Argument Supplied by User [ ] = Optional Item(s) { } = List of Required Items (means CHOOSE ONE) | = Separates Alternative Items (means OR) .. = Denotes an Inclusive Range of Values Cexp = Character Expression, ONE or 1st Character Dexp = Date Expression, range Jan 1, 1940 .. Jan 1, 2040 Lexp = Logical Expression, evaluates to T or F Nexp = Numeric Expression Sexp = String Expression, 0 .. 254 Characters List = Items separated by "," Fi = File Area ID: FJ..FS Fm = Memory Area ID: FX, FY, FZ scope = { ALL | RECORD | NEXT | REST | WHILE } ^D > Function Codes | ^U > Editing and Command Keys | Esc > CMD: ~102 100~ dBMAN Function Codes: Tmode: 1 = "HHMMSS" 2 = "HH:MM:SS" 3 = "HHMMSSDD" 4 = "HH:MM:SS.DD" 5 = "HH:MM" 6 = "Hr:MM:SS pp" 7 = "Hr:MM pp" Key: HH = 0..24, Hr = 1..12, pp = AM..PM PICTURE Formats: Char Data { U L X A 9 # ! } Num Data { S # 9 $ * , . } ^D > Extended Key Codes | ^U > Syntax Definitions | Esc > CMD: ~103 101~ dBMAN INKEY() Extended KeyCodes: ^A ... ^Z = 1 ... 26 Esc = 27 ^D > Functions | ^U > Function Codes | Esc > CMD:~104 102~ Functions Page 1 # Current record number !() Converts the string to upper case $(,[,]) Extracts string data ABS() Absolute function APPROX(]) APPROX switch setting ARCCOS() Arc cosine trigonometric ARCSIN() Arc sine trigonometric ARCTAN() Arc tangent trigonometric AT(, [,]) Searches for the substring BAR(,,,, ) Draws a bar BOF([]) Checks beginning of file ^D > Functions Page 2 | ^U > Editing and Command Keys | Esc > CMD:~105 100~ Functions Page 2 BOX(r1>,,,,, ,,,, ) Draws a box CDOW() Character day of week CENTER(,) Centers a string CHKKEY() Checks a character in keyboard buffer CHR() Converts a number to character CMONTH() Name of the month COL([]) Cursor column position COS() Cosine trigonometric CTOD() Character to date DATE() System date DAY() Day of the month DBF() DBF file name in use ^D > Functions Page 3 | ^U > Function Page 1 | Esc > CMD:~106 104~ Functions Page 3 DELETED() Checks if the record is deleted DELREC([]) Checks if the record is deleted DFLTDRV({DBF | NDX | TXT | MEM | CMD | SYSTEM | DXX}) Default path DOW() Day of week DRAWLINE(,,,, ,,) Draws a line DTOC() Date to character string DTOK() Date to key string DUPCHAR(,) Duplicates the character EOF([]) Checks end of file ERRCMD() Command with an error ERRCODE() Last error code ERRLINE() Error line number ^D > Functions Page 4 | ^U > Function Page 2 | Esc > CMD:~107 105~ Functions Page 4 ERROR() Last error code ERRPRG() PRG file name with an error ESC() Send printer control codes EXP() Exponential function EXTRACT(,,) Extracts a string EXTRACT2(,,,) Extracts a string FIELD/FIELDSPEC([,] [,]) Field definition FIELDTYPE() Check field type FILE() Checks if the file exist FILENAME([]) DBF file name in use FILESIZE() File size *FLOCK() Locks the current file ^D > Functions Page 5 | ^U > Function Page 3 | Esc > CMD:~108 106~ Functions Page 5 FMENU(,,, Menu selection for field names [,[,]]) FOUND() Result of database search FRAC() Fraction GETNAME() GET variable name GETNO() GET field number HMENU([,,, [,, , [,]]]) Horizontal menu IIFC (,,) Returns one of the two character strings IIFD (,,) Returns one of the two date values IIFL (,,) Returns one of the two logic values IIFN (,,) Returns one of the two numeric values INDEXNAME([ [,]]) NDX file name in use ^D > Functions Page 6 | ^U > Function Page 4 | Esc > CMD:~109 107~ Functions Page 6 INKEY([<0>]) Returns a key from the keyboard INSET(,,) Checks if element exists in a set INT() Truncates the number to integer KEYSTROKES([]) Number of keystrokes LASTKEY() Last key code LASTREC([]) Number of records in the database LEFT(,) Extracts a string from the left LEN() String length LN() Natural log LOCK() Locks the current record LOG() Logarithm ^D > Functions Page 7 | ^U > Function Page 5 | Esc > CMD:~110 108~ Functions Page 7 LONGYEAR([]) Long year format LOWER() Converts string to lower case LPAD(,,) Pads leading blanks LTOC() Converts logical to character LTON () Converts logical to numeric LTRIM() Trims leading blanks MAX(,) Returns the maximum value MIDSTR(,,) Replaces string inside a string MIN(,) Returns the minimum value MOD(,) Modulus MODCHAR(,,) Modifies a character in a string MONTH() Month of the year NATE() Naperian constant NDX() Index file name in use ^D > Functions Page 8 | ^U > Function Page 6 | Esc > CMD:~111 109~ Functions Page 8 NLIST(,,..,) Checks if a number is in the list NTOL () Converts number to logical value NTOTIME(,) Convert number to time value NRANGE(,,) Checks if a number is within range PAGENO() Current page number PCOL() Printer column position PI() Constant PMENU([,,, ,...,]) Creates a pull down menu PRNFLG() PRINT switch setting PROW() Printer row position RANK() Converts ASCII to ASCII code READKEY() Last key code RECCOUNT([]) Number of records in the database ^D > Functions Page 9 | ^U > Function Page 7 | Esc > CMD:~112 110~ Functions Page 9 RECLEN([]) Record length RECNO([]) Current record number RECSIZE([]) Record length REPLICATE(,) Duplicates the character RETRYCNT([]) Sets retry counter (multi-user) RIGHT(,) Extracts a string from the right *RLOCK() Locks the current record ROUND(,) Round ROW([]) Cursor row position RTJUST(,) Right justify a string RTRIM() Removes trailing blanks SAMEMONTH(,) Checks two Dexps for same month SAMEWEEK (,) Checks two Dexps for same week SELECTED() Selected file id ^D > Functions Page 10 | ^U > Function Page 8 | Esc > CMD:~113 111~ Functions Page 10 SOUNDEX() Generates soundex code SPACE() Creates a string of blanks SRCH(,[,]) Searches string1 in string2 STATION([]) Station number STK() Bytes remaining in stack STR(, [,]) Converts number to string STUFF(,,,) Replace portion of a string SUBSTR(,[,]) Extracts substring data SRCH(,[,]) Searches string1 in string2 STATION([]) Station number TIME([]) System time TIMEADD(,) Add two time values TIMESUB(,) Subtract two time values TIMETON(